[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38261.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ffuB.bssp"
#ERROR : Can't open dsspfile "1qj2H.bssp"
#ERROR : Can't open dsspfile "1qj2B.bssp"
#ERROR : Can't open dsspfile "1n63B.bssp"
#ERROR : Can't open dsspfile "1n60E.bssp"
#ERROR : Can't open dsspfile "1n60B.bssp"
#ERROR : Can't open dsspfile "1n5wE.bssp"
#ERROR : Can't open dsspfile "1n5wB.bssp"
#ERROR : Can't open dsspfile "1zxiE.bssp"
#ERROR : Can't open dsspfile "1zxiB.bssp"
#ERROR : Can't open dsspfile "1t3qB.bssp"
#ERROR : Can't open dsspfile "1rm6D.bssp"
#ERROR : Can't open dsspfile "1rm6A.bssp"
#ERROR : Can't open dsspfile "1jroB.bssp"
#ERROR : Can't open dsspfile "2w55B.bssp"
#ERROR : Can't open dsspfile "3b9jK.bssp"
#ERROR : Can't open dsspfile "1vdvA.bssp"
#ERROR : Can't open dsspfile "1v97B.bssp"
#ERROR : Can't open dsspfile "1v97A.bssp"
#ERROR : Can't open dsspfile "1n5xA.bssp"
#ERROR : Can't open dsspfile "1fiqC.bssp"
#ERROR : Can't open dsspfile "3eub4.bssp"
#ERROR : Can't open dsspfile "3eubC.bssp"
#ERROR : Can't open dsspfile "3etrC.bssp"
#ERROR : Can't open dsspfile "3bdjA.bssp"
#ERROR : Can't open dsspfile "3b9jC.bssp"
#ERROR : Can't open dsspfile "3hrdA.bssp"
#ERROR : Can't open dsspfile "2e1qA.bssp"
#ERROR : Can't open dsspfile "2ckjD.bssp"
#ERROR : Can't open dsspfile "2ckjC.bssp"
#ERROR : Can't open dsspfile "2ckjB.bssp"
#ERROR : Can't open dsspfile "2ckjA.bssp"
#ERROR : Can't open dsspfile "1wygA.bssp"
#ERROR : Can't open dsspfile "2e3tB.bssp"
#ERROR : Can't open dsspfile "2e3tA.bssp"
#ERROR : Can't open dsspfile "1dgjA.bssp"
#ERROR : Can't open dsspfile "1vlbA.bssp"
#ERROR : Can't open dsspfile "1hlrA.bssp"
#ERROR : Can't open dsspfile "3hrdB.bssp"

## Summary of PDB Search
:781
    e-129  39%  1ffuB  [d.41.1 - d.133.1] CUTL, MOLYBDOPROTEIN OF CARBON MONOXIDE
    e-129  39%  1qj2H  [x.x.x] CARBON MONOXIDE DEHYDROGENASE
    e-129  39%  1qj2B  [x.x.x] CARBON MONOXIDE DEHYDROGENASE
    e-128  40%  1n63B  [d.41.1 - d.133.1] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1n60E  [d.41.1 - d.133.1] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1n60B  [d.41.1 - d.133.1] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1n5wE  [d.41.1 - d.133.1] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1n5wB  [d.41.1 - d.133.1] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1zxiE  [x.x.x] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-128  40%  1zxiB  [x.x.x] CARBON MONOXIDE DEHYDROGENASE LARGE CHAIN
    e-104  35%  1t3qB  [d.41.1 - d.133.1] QUINOLINE 2-OXIDOREDUCTASE LARGE SUBUNIT
    2e-57  30%  1rm6D  [d.41.1 - d.133.1] 4-HYDROXYBENZOYL-COA REDUCTASE ALPHA
    2e-57  30%  1rm6A  [d.41.1 - d.133.1] 4-HYDROXYBENZOYL-COA REDUCTASE ALPHA
    1e-32  28%  1jroB  [d.41.1 - d.133.1] XANTHINE DEHYDROGENASE, CHAIN B
    5e-30  28%  2w55B  [x.x.x] XANTHINE DEHYDROGENASE
    5e-30  26%  3b9jK  [x.x.x] XANTHINE OXIDASE
    8e-30  26%  1vdvA  [d.15.4 - a.56.1 - d.145.1 - d.87.2 - d.41.1 - d.133.1]
    8e-30  26%  1v97B  [d.15.4 - a.56.1 - d.145.1 - d.87.2 - d.41.1 - d.133.1]
    8e-30  26%  1v97A  [d.15.4 - a.56.1 - d.145.1 - d.87.2 - d.41.1 - d.133.1]
    8e-30  26%  1n5xA  [d.15.4 - a.56.1 - d.145.1 - d.87.2 - d.41.1 - d.133.1]
    8e-30  26%  1fiqC  [d.41.1 - d.133.1] XANTHINE OXIDASE
    8e-30  26%  3eub4  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    8e-30  26%  3eubC  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    8e-30  26%  3etrC  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    8e-30  26%  3bdjA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    8e-30  26%  3b9jC  [x.x.x] XANTHINE OXIDASE
    4e-27  27%  3hrdA  [x.x.x] NICOTINATE DEHYDROGENASE LARGE MOLYBDOPTERIN
    1e-26  26%  2e1qA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-26  26%  2ckjD  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-26  26%  2ckjC  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-26  26%  2ckjB  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-26  26%  2ckjA  [x.x.x] XANTHINE OXIDOREDUCTASE
    3e-24  25%  1wygA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-24  25%  2e3tB  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    3e-24  25%  2e3tA  [x.x.x] XANTHINE DEHYDROGENASE/OXIDASE
    7e-18  28%  1dgjA  [d.15.4 - a.56.1 - d.41.1 - d.133.1] ALDEHYDE OXIDOREDUCTASE
    2e-16  28%  1vlbA  [d.15.4 - a.56.1 - d.41.1 - d.133.1] ALDEHYDE OXIDOREDUCTASE
    2e-16  28%  1hlrA  [x.x.x] ALDEHYDE OXIDOREDUCTASE
    2e-15  27%  3hrdB  [x.x.x] NICOTINATE DEHYDROGENASE MEDIUM MOLYBDOPTERIN
:781

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
1ffuB           LALAGMGASRLRKEDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAE
1qj2H           --LQGMGCKRKRVEDIRFTEGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1qj2B           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1n63B           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1n60E           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1n60B           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1n5wE           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1n5wB           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1zxiE           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1zxiB           --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
1t3qB           ---KSIGTSVLRREDTRLLTGRGRYIADLVLSGMLHVASLRSPFAHARIVSIDVADAQALPGVELVWCGA
1rm6D           ------------------VTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVIAVCTGA
1rm6A           ------------------VTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVIAVCTGA
1jroB           -----VGKPLPHDSARAHVTGQARYLDDLPCPANTHLAFGLSTEASAAITGLDLEPVRESPGVIAVFTAA
2w55B           -----VGKPLPHDSARAHVTGQARYLDDLPCPANTHLAFGLSTEASAAITGLDLEPVRESPGVIAVFTAA
3b9jK           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1vdvA           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1v97B           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1v97A           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1n5xA           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
1fiqC           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3eub4           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3eubC           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3etrC           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3bdjA           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3b9jC           -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
3hrdA           -----LGKNKVKVDSLEKVMGTAKFAADYSFPDMLYAGVFRSTVPHARIVSLDLSKARAIDGVEAVLDYH
2e1qA           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjD           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjC           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjB           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
2ckjA           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
1wygA           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
2e3tB           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
2e3tA           -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
1dgjA           ------GSSIPRPSAVAKVTGLAEFGADAALRNTLHLALAQAKVSHALIKGIDTSEAEKMPGVYKVLTHK
1vlbA           ------------------VTGTLDYGADLGLAGTLHLAMVQAKVSHANIKGIDTSEALTMPGVHSVITHK
1hlrA           ------------------VTGTLDYGADLGLAGTLHLAMVQAKVSHANIKGIDTSEALTMPGVHSVITHK
3hrdB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDXXXXXXXXXXXXX
1ffuB           DLKPLK---------LHWMPTLAGDVAA--VLADEKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELP
1qj2H           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1qj2B           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1n63B           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1n60E           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1n60B           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1n5wE           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1n5wB           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1zxiE           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1zxiB           --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
1t3qB           DVAELSQG------IVATMQVEGFQTTIQPLLANGVTRFVGEXXXXXXXXXXXXXEDAAQLIQVEYEELP
1rm6D           E--------------------TPVPFGVLPPLARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLP
1rm6A           E--------------------TPVPFGVLPPLARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLP
1jroB           DLP-------------HDNDASPAPSPE-PVLATGEVHFVGQPIFLVXXXXXXXXXXXXXXXXXTYAPRP
2w55B           DLP-------------HDNDASPAPSPE-PVLATGEVHFVGQPIFLVXXXXXXXXXXXXXXXXXTYAPRP
3b9jK           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
1vdvA           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
1v97B           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
1v97A           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
1n5xA           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
1fiqC           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3eub4           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3eubC           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3etrC           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3bdjA           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3b9jC           DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
3hrdA           --------------AIPGKNRFGIIIKDEPCLVDDKVRRYGDAIAVVAAQTPDLVQEALDAITIEYEELE
2e1qA           DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
2ckjD           DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
2ckjC           DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
2ckjB           DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
2ckjA           DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
1wygA           DVPNSNATGLFNDETVFAKD---------------EVTCVGHIIGAVVADTPEHAQ-----------RAA
2e3tB           DVPNSNATGLFNDETVFAKD---------------EVTCVGHIIGAVVADTPEHAQ-----------RAA
2e3tA           DVPNSNATGLFNDETVFAKD---------------EVTCVGHIIGAVVADTPEHAQ-----------RAA
1dgjA           DV---KGKNRITGLITFPTN----KGDGWPILNDSKIFQYGDALAIVCXXXXXXXXXXXEKVKFDLELLP
1vlbA           DV---KGKNRITGLITFPTN----KGDGWPILCDEKVFQYGDCIALVCXXXXXXXXXXXEKVKVDLEELP
1hlrA           DV---KGKNRITGLITFPTN----KGDGWPILCDEKVFQYGDCIALVCXXXXXXXXXXXEKVKVDLEELP
3hrdB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
1ffuB           VVIDPIDALKPDAPVLREDLAGNHIFTWGAGDKAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASF
1qj2H           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1qj2B           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1n63B           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1n60E           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1n60B           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1n5wE           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1n5wB           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1zxiE           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1zxiB           VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
1t3qB           AVTGIEAALEGEA-RANDTLAGNVVSR----TSRARDELFASSAGVVRGQFSCGRVSACPMETRGAVAQY
1rm6D           AYMTPKAAMKAGAIALHDDKPNNILREAEFGD---VAAAFAEADLIREKTYTFAEVNHVHMELNATLAEY
1rm6A           AYMTPKAAMKAGAIALHDDKPNNILREAEFGD---VAAAFAEADLIREKTYTFAEVNHVHMELNATLAEY
1jroB           AILTLDQALAADSRF----EGGPVI--WARGD---VETALAGAAHLAEFEIGGQEHF--YLEGQAALA--
2w55B           AILTLDQALAADSRF----EGGPVI--WARGD---VETALAGAAHLAEFEIGGQEHF--YLEGQAALA--
3b9jK           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1vdvA           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1v97B           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1v97A           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1n5xA           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
1fiqC           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3eub4           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3eubC           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3etrC           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3bdjA           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3b9jC           HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
3hrdA           GIFTMERALEEDSPAIHGDTNIHQVKHLEYGD---VDAAFKQCDIVVEDTYSTHRLTHMFIEPDAGVSYY
2e1qA           ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjD           ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjC           ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjB           ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
2ckjA           ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
1wygA           RGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
2e3tB           RGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
2e3tA           RGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
1dgjA           EYMSAPEAMAPDAIEIHPGTP-NVYYDQL--EEKGEDTVFNDPANVVAEGSYYTQRQPHLIEPDVGYG-Y
1vlbA           AYMSGPAAAAEDAIEIHPGTP-NVYFEQPIVKGEDTGPIFASADVTVEGDFYVGRQPHMPIEPDVAFA-Y
1hlrA           AYMSGPAAAAEDAIEIHPGTP-NVYFEQPIVKGEDTGPIFASADVTVEGDFYVGRQPHMPIEPDVAFA-Y
3hrdB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
1ffuB           DPIKGDLTTYITSQAPHVVRTVVSMLSGI-PESKVRIVSPDIGGGFGNKVGIYPGYVCAIVASIVLGRPV
1qj2H           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1qj2B           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1n63B           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1n60E           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1n60B           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1n5wE           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1n5wB           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1zxiE           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1zxiB           DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
1t3qB           EWTTQQLILWTATQMPSFVRTMVAMFCAI-PEHLIEVRVPDVGGGFGQKAHLHPEELLVCLLSRALGRPV
1rm6D           DPVRDMLTLNTTTQVPYYVHLKVAACLQM-DSARIRVIKPFLGGGFGARTEALHFEIIAGLLARKAKGTV
1rm6A           DPVRDMLTLNTTTQVPYYVHLKVAACLQM-DSARIRVIKPFLGGGFGARTEALHFEIIAGLLARKAKGTV
1jroB           LPAEGGVVIHCSSQHPSEIQHKVAHALGLA-FHDVRVEMRRMGGGFGGKESQGNHLAIACAAARATGRPC
2w55B           LPAEGGVVIHCSSQHPSVAHALGLAFHDVRVEMRRMXXXXXXKQSQGNHLAI-----ACAVAARATGRPC
3b9jK           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
1vdvA           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
1v97B           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
1v97A           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
1n5xA           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
1fiqC           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3eub4           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3eubC           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3etrC           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3bdjA           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3b9jC           KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
3hrdA           DN-EGMLTVVVSTQNPHYDRGEVAGMLAL-PNSKVRIIQATTGGGFGGKLDLSVQCHCAL-LTYHTKKPV
2e1qA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKXXXXXXXXXXXXXXXKTGRPV
2ckjD           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKTRXXXXXXXXXXXXYKTGRPV
2ckjC           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKTRXXXXXXXXXXXXYKTGRPV
2ckjB           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKTRXXXXXXXXXXXXYKTGRPV
2ckjA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKTRXXXXXXXXXXXXYKTGRPV
1wygA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRSTVVSTALLAAHKTGRPV
2e3tB           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRSTVVSTALLAAHKTGRPV
2e3tA           KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRSTVVSTALLAAHKTGRPV
1dgjA           INEQGQVVIHSKSVAIHLHALMIAPGLGLEFPKDLVLVQNTTGGTFGYKFSPTMEALVGV-AVMATGRPC
1vlbA           MGDDGKCYIHSKSIGVHLHLYMIAPGVGLEPD-QLVLVANPMGGTFGYKFSPTSEALVAV-AAMATGRPV
1hlrA           MGDDGKCYIHSKSIGVHLHLYMIAPGVGLEPD-QLVLVANPMGGTFGYKFSPTSEALVAV-AAMATGRPV
3hrdB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
1ffuB           KWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADTKFPAGLFH-ICSGSYDI
1qj2H           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1qj2B           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1n63B           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1n60E           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1n60B           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1n5wE           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1n5wB           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1zxiE           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1zxiB           KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
1t3qB           RWIEDRQENFLGATHAKQQRNEMGLAFDGDGRFLALENRSITDGGAYNNLWTQLVESHVGNAVILGVYKV
1rm6D           RLLQTREETFIAH-RGRPWTEKMKIGLKKDGKIAALALE--XXXXXXXXXXXXXXXXXXXXXLMHGLYHI
1rm6A           RLLQTREETFIAH-RGRPWTEKMKIGLKKDGKIAALALE--XXXXXXXXXXXXXXXXXXXXXLMHGLYHI
1jroB           KMRYDRDDDMVITGKRHDFRIRYRIGADASGKLLGADFVHLARCGWSADL---SLPVCDRAMLADGSYFV
2w55B           KMRYDRDDDMVITGKRHDFRIRYRIGADASGKLLGADFVHLARCGWSADL---SLPVCDRAMLADGSYFV
3b9jK           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
1vdvA           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
1v97B           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
1v97A           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
1n5xA           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
1fiqC           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3eub4           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3eubC           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3etrC           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3bdjA           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3b9jC           RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
3hrdA           KMVRSREESTTVSSKRHPMTMHCKTGATKDGRLQAVQVEMFGDTGAYAS-YGPAVITRATVHCM-GPYVV
2e1qA           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2ckjD           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2ckjC           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2ckjB           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
2ckjA           RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
1wygA           RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFH--MDNAYKI
2e3tB           RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFH--MDNAYKI
2e3tA           RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFH--MDNAYKI
1dgjA           NYTGKRSPFWTTMRY----------AADRQGKILAMETDWSVDHGPYSEF--GDLLTLXXXXXXXXXXXX
1vlbA           HLRYNYQQQQQYTGKRSPWEMNVKFAAKKDGTLLAMESDWLVDHGPYSEF--GDLLTLRGAQFIGAGYNI
1hlrA           HLRYNYQQQQQYTGKRSPWEMNVKFAAKKDGTLLAMESDWLVDHGPYSEF--GDLLTLRGAQFIGAGYNI
3hrdB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
1ffuB           PRAHCSVKGVYTNKAPGGVAYSFRVTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRQFPYTTQFGFEYD
1qj2H           PVAHLAVDGVYTNKASGGAYRSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1qj2B           PVAHLAVDGVYTNKASGGAYRSFRVTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1n63B           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1n60E           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1n60B           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1n5wE           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1n5wB           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1zxiE           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1zxiB           PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
1t3qB           PAVSEESIAVATNKCPIGAYRGVGFTAGQIARETLIDRAARQLGLSPFEIRRRNVVMDFPFTNRLGQTHR
1rm6D           PAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLPQIPYVT--MYAQR
1rm6A           PAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLPQIPYVT--MYAQR
1jroB           PALRIESHRLRTNTQSNTAFRGFGGPQGALGMERAIEHLARGMGRDPAELRALNFYTQTTHYGQEVADCV
2w55B           PALRIESHRLRTNTQSNTAFRGFGGPQGALGMERAIEHLARGMGRDPAELRALNFYTQTTHYGQEVADCV
3b9jK           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
1vdvA           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
1v97B           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
1v97A           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
1n5xA           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
1fiqC           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3eub4           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3eubC           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3etrC           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3bdjA           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3b9jC           PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
3hrdA           PNVRVDAKFVYTNNPMSGAFRGFGVPQASVCHEGQMNALAKALGMDPIDIRILN----------------
2e1qA           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
2ckjD           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
2ckjC           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
2ckjB           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
2ckjA           PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
1wygA           PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGL-PAEEVRRKNMYKEGDLTHFNQKLE
2e3tB           PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGL-PAEEVRRKNMYKEGDLTHFNQKLE
2e3tA           PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGL-PAEEVRRKNMYKEGDLTHFNQKLE
1dgjA           XXXXXTGRTVATNHCWGAAFRGYGAPESEFPSEVLMDELAEKLGMDPFELRALN----------------
1vlbA           PNIRGLGRTVATNHVWGSAFRGYGAPQSMFASECLMDMLAEKLGMDPLELRYKN----------------
1hlrA           PNIRGLGRTVATNHVWGSAFRGYGAPQSMFASECLMDMLAEKLGMDPLELRYKN----------------
3hrdB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGDFGASLDAALKAADYSXXXXXXXXXXXXXXXXXXXFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
1ffuB           SGDYHTALKKVLDAVDYPALRAEQAARRADPNSPTLMLVTFTEVVGAGPSKMCDILG--VGMFDSCEIRI
1qj2H           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1qj2B           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1n63B           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1n60E           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1n60B           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1n5wE           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1n5wB           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1zxiE           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1zxiB           SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
1t3qB           EGTYLQTINLLEEMVNPXXXXXXXXXXXXXGKYLGLGVSVFNEVTGTG-TRTLSFLGTPTTTHDSATVRI
1rm6D           VMSYG--VPECLEKVKAASGWEEXXXXXXXXXXXXIALSHFVSGTS-TPKHWTGEPHATVNL------KL
1rm6A           VMSYG--VPECLEKVKAASGWEEXXXXXXXXXXXXIALSHFVSGTS-TPKHWTGEPHATVNL------KL
1jroB           LGELVTRLQ---KSANFTTRRAEIAAWNSTNRTLARGIALSPVKFGISFTLTLNQAGALVQIYTDGSVAL
2w55B           LGELVTRLQ---KSANFTTRRAEIAAWNSTNRTLARGIALSPVKFGISFTLTLNQAGALVQIYTDGSVAL
3b9jK           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
1vdvA           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
1v97B           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
1v97A           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
1n5xA           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
1fiqC           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3eub4           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3eubC           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3etrC           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3bdjA           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3b9jC           VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
3hrdA           ----------------------------------------------------------------------
2e1qA           LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
2ckjD           LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
2ckjC           LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
2ckjB           LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
2ckjA           LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
1wygA           GFTLPRCWDECIASSQYLARKREVEKFNRENRWKKRGLCIIPTKFGI--SFTLPFLNQGGAL-----VHV
2e3tB           GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGI--SFTLPFLNQGGAL-----VHV
2e3tA           GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGI--SFTLPFLNQGGAL-----VHV
1dgjA           -----------------------------------------------------------------AWVEL
1vlbA           ----------------------------------------------------------------------
1hlrA           ----------------------------------------------------------------------
3hrdB           --------------------------------------------------KGVGSMWYGIGNTAAAFVEI


                         *         .         .         .         .         +         .:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFXX
1ffuB           HPTGSAIARMXXXXXXXXXXXXYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVXXXXXXXX
1qj2H           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1qj2B           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1n63B           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1n60E           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1n60B           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1n5wE           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1n5wB           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1zxiE           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1zxiB           HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
1t3qB           DPTGKVTVTTSLASSGQGHETTLAQIAADVLGVPASDVVIQAGST-KNTYGFGAYASRGAVIGAGSIGRA
1rm6D           DFDGGITLLTGAADIGQGSNTMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISA
1rm6A           DFDGGITLLTGAADIGQGSNTMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISA
1jroB           NHGGT--------EMGQGLHAKMVQVAAAVLGIDPVQVRITATDTSKVPNTSATAASSGADMNGMAVKDA
2w55B           NHGGT--------EMGQGLHAKMVQVAAAVLGIDPVQVRITATDTSKVPNTSATAASSGADMNGMAVKDA
3b9jK           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
1vdvA           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
1v97B           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
1v97A           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
1n5xA           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
1fiqC           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3eub4           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3eubC           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3etrC           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3bdjA           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3b9jC           YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
3hrdA           ----------------------------------------------------------------------
2e1qA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
2ckjD           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
2ckjC           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
2ckjB           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
2ckjA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
1wygA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISEXXXXXXXXXXXXXXXXXXDLNGQGVYEA
2e3tB           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISEXXXXXXXXXXXXXXXXXXDLNGQGVYEA
2e3tA           YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISEXXXXXXXXXXXXXXXXXXDLNGQGVYEA
1dgjA           NDDGSVTLGNSWEDHGQGADAGSAHEALRPLGITPENIHLVMNDTSKTPNSGPAGGSRSQVVTGNAIRVA
1vlbA           ----------------------------------------------------------------------
1hlrA           ----------------------------------------------------------------------
3hrdB           HGDGSANVMFGAADIGQGSGTAMAQIAAEELGLDYEKIHVTWGDTMVTPDGGATSASRQTLITGNAVILA


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
1ffuB           XXXXXXXXXXXXXXMLEVNENDLDWEVDRFKVKGDDSKFKT-MADIAWQAYHQPPAGLEPGLEAVHYYDP
1qj2H           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1qj2B           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1n63B           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1n60E           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1n60B           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1n5wE           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1n5wB           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1zxiE           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1zxiB           XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
1t3qB           ASIVRERVKQLAGHLLEAASEDIVIEDGLVHVAGVPKGMPFAEVVGAAYFADATPPGFDATLEATATYDP
1rm6D           AEEXXXXXXXXXXXXXXXREEDIEVIDEMFMVSGSDPGLSFQEVVKAAMVTYTCPTEFQGDKKIRGSAIG
1rm6A           AEEXXXXXXXXXXXXXXXREEDIEVIDEMFMVSGSDPGLSFQEVVKAAMVTYTCPTEFQGDKKIRGSAIG
1jroB           CETLRGRLAGFVAAREGCAARDVIFDAGQVQASG--KSWRFAEIVAAAYMA-------RISLSATGFYAT
2w55B           CETLRGRLAGFVAAREGCAARDVIFDAGQVQASG--KSWRFAEIVAAAYMA-------RISLSATGFYAT
3b9jK           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
1vdvA           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
1v97B           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
1v97A           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
1n5xA           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
1fiqC           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3eub4           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3eubC           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3etrC           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3bdjA           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3b9jC           CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
3hrdA           ----------------------------------------------------------------------
2e1qA           CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
2ckjD           CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
2ckjC           CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
2ckjB           CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
2ckjA           CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
1wygA           CQTILKRLEPFKKKK----------PTGPWEAWVMDATSAVSLSATGFYKTPNLGYSFETNSGNPFHY--
2e3tB           CQTILKRLEPFKKKK----------PTGPWEAWVMDATSAVSLSATGFYKTPNLGYSFETNSGNPFHY--
2e3tA           CQTILKRLEPFKKKK----------PTGPWEAWVMDATSAVSLSATGFYKTPNLGYSFETNSGNPFHY--
1dgjA           C--------------------EMLIEGGGFFTPAEMKAEGRPMRYDGKWTA--------PAKDCDAKGQG
1vlbA           ----------------------------------------------------------------------
1hlrA           ----------------------------------------------------------------------
3hrdB           CRQXXXXXXXXXXXXXDCAPEELSFDNTVFITADPERSMTYGELMAAMKAAGRMAVGAGSYNPNTTGLAP


                         .         +         .         .         .         .         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
1ffuB           PNFTYPFGIYLCVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGN
1qj2H           PNMTYPFGAYFCIMDIDIDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1qj2B           PNMTYPFGAYFCIMDIDIDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1n63B           PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1n60E           PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1n60B           PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1n5wE           PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1n5wB           PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1zxiE           PNMTYPFGAYFCIMDIDIDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1zxiB           PNMTYPFGAYFCIMDIDIDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
1t3qB           SDLVLANGGHAAIVEIDASTYATRVTDFFAVEDCGTMINPMIVEXXXXXXXXXXXXXTLLEEVIYDDFGQ
1rm6D           ATMGFCYAAQVVEASVDEITGKVTAHKVWVAVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYD-NGR
1rm6A           ATMGFCYAAQVVEASVDEITGKVTAHKVWVAVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYD-NGR
1jroB           PKLSFAYGAAITEVVIDRLTGENRILRTDILHDAGASLNPALDIGQIEGAYVQGAGWLTTEELVWDHCGR
2w55B           PKLSFAYGAAITEVVIDRLTGENRILRTDILHDAGASLNPALDIGQIEGAYVQGAGWLTTEELVWDHCGR
3b9jK           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1vdvA           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1v97B           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1v97A           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1n5xA           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1fiqC           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3eub4           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3eubC           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3etrC           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3bdjA           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3b9jC           ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
3hrdA           ----------------------------------------------------------------------
2e1qA           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjD           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjC           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjB           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
2ckjA           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
1wygA           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
2e3tB           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
2e3tA           ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
1dgjA           SPFAYMYGLFLTEVAVEVATGKATVEKMVCVADIGKICNKLVVDGQIYGGLAQGVGLALSED--YEDLKK
1vlbA           -------GVFMAEVTVDVATGQTTVDGMTLMADLGSLCNQLATDGQIYGGLAQGIGLALSEDFEDIKKHA
1hlrA           -------GVFMAEVTVDVATGQTTVDGMTLMADLGSLCNQLATDGQIYGGLAQGIGLALSEDFEDIKKHA
3hrdB           ENMSFEVYSYIAXXXXXXXXXXXXXLKVVSAHDVGTPINRSMVEGQIEGGVTMGQGFVLMEEEVNTKNGA


                         .         .         .         .         +         .         .:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
1ffuB           LLGNTLMDYFLPTAVETPHWETDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHTHLDMPHTS
1qj2H           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1qj2B           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1n63B           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1n60E           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1n60B           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1n5wE           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1n5wB           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1zxiE           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1zxiB           VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
1t3qB           LVTTTLMDYLIPTTLDVPDIRIRHLETPSPLVPGGIKGMGESXXXXXXXXXXXXXXXXXXHLEVTVPITP
1rm6D           MVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEASEGMLAGFLPAIHEAVYEAVGVRATDFPLSP
1rm6A           MVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEASEGMLAGFLPAIHEAVYEAVGVRATDFPLSP
1jroB           LMTHAPSTYKIPAFSDRPRIQPNREETI-----FRSKAVGEPPGISAFLALHDACAACGPHPDLQAPATP
2w55B           LMTHAPSTYKIPAFSDRPRIQPNREETI-----FRSKAVGEPPGISAFLALHDACAACGPHPDLQAPATP
3b9jK           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAIQHTRLDSPATP
1vdvA           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
1v97B           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
1v97A           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
1n5xA           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
1fiqC           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3eub4           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3eubC           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3etrC           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3bdjA           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3b9jC           LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
3hrdA           ----------------------------------------------------------------------
2e1qA           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
2ckjD           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
2ckjC           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
2ckjB           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
2ckjA           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
1wygA           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKRYASKAVGEPPLFLAS-SIFFAIKDAIGDNQLDSPATP
2e3tB           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKRYASKAVGEPPLFLAS-SIFFAIKDAIGDNQLDSPATP
2e3tA           LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKRYASKAVGEPPLFLAS-SIFFAIKDAIGDNQLDSPATP
1dgjA           HSTMG--GAGIPSIKMIPDIEIVYVETPRKDGPFGASGVGEMPLTAPHAAIINGIYNACGARVRHLPARP
1vlbA           TLVGAGFPFIKQIPDKLDIVYVNHPR---PDGPFGASGVGELPLTSPHAAIINAIKSATGVRIYRLPAYP
1hlrA           TLVGAGFPFIKQIPDKLDIVYVNHPR---PDGPFGASGVGELPLTSPHAAIINAIKSATGVRIYRLPAYP
3hrdB           IKNPSMSKYIIPSNRDVPEIHSILVESEXXXXXXXXXXXXEPALIPMIPAVVAAIEDALGTRFTHTPIMP


                         .         .         *         .         .         .         .:840
query           DRVWHAIxxxx
1ffuB           YRVWKSL----
1qj2H           WRLW-------
1qj2B           WRLW-------
1n63B           WRLW-------
1n60E           WRLW-------
1n60B           WRLW-------
1n5wE           WRLW-------
1n5wB           WRLW-------
1zxiE           WRLW-------
1zxiB           WRLW-------
1t3qB           ERIFRSI----
1rm6D           DRI--------
1rm6A           DRI--------
1jroB           EAVLAAV----
2w55B           EAVLAAV----
3b9jK           EKIRNA-----
1vdvA           EKIRNA-----
1v97B           EKIRNA-----
1v97A           EKIRNA-----
1n5xA           EKIRNA-----
1fiqC           EKIRNA-----
3eub4           EKIRNA-----
3eubC           EKIRNA-----
3etrC           EKIRNA-----
3bdjA           EKIRNA-----
3b9jC           EKIRNA-----
3hrdA           -----------
2e1qA           EKIRNA-----
2ckjD           EKIRNA-----
2ckjC           EKIRNA-----
2ckjB           EKIRNA-----
2ckjA           EKIRNA-----
1wygA           EKIRNA-----
2e3tB           EKIRNA-----
2e3tA           EKIRNA-----
1dgjA           EKVLEAM----
1vlbA           EKVLEAL----
1hlrA           EKVLEAL----
3hrdB           KDIVAAV----