[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38359.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"

## Summary of PDB Search
:539
    5e-25  32%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-25  32%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-23  31%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    6e-23  31%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    6e-23  31%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-23  31%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-23  31%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22  30%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-22  30%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-20  34%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-20  29%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    7e-20  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-20  29%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-19  33%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    6e-19  26%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    6e-19  26%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    6e-19  31%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-18  26%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-17  26%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-17  28%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    9e-17  29%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    9e-17  29%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-16  24%  2oukB  [x.x.x] PROTEIN ARTP
    2e-16  24%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-16  29%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    4e-15  30%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-15  30%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-15  28%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    8e-15  30%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-15  30%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-15  26%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-14  27%  1ji0A  [c.37.1] ABC TRANSPORTER
    5e-13  30%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-13  30%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-13  28%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    8e-13  28%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-12  29%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-12  30%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    1e-12  30%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-12  27%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-12  27%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-12  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-12  29%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    3e-12  27%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-11  27%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-11  30%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    1e-11  27%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-11  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  26%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-11  26%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-11  30%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  31%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-11  31%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    6e-11  26%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    7e-11  31%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  29%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-10  29%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-10  28%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    1e-10  30%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-10  30%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    5e-10  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-10  27%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    8e-10  29%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-10  30%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    2e-09  28%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-09  27%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    5e-09  27%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-09  28%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-09  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-08  29%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  29%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  28%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-08  29%  1yqtA  [x.x.x] RNASE L INHIBITOR
    4e-08  28%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-08  30%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  30%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  29%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  30%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  30%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  27%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  27%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-07  37%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-07  37%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-07  37%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-07  37%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-07  37%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-07  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-07  25%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-06  26%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  26%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  29%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-06  24%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-06  25%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    5e-06  41%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-06  41%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    9e-06  28%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    9e-06  28%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    2e-05  29%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-05  29%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-05  28%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-05  29%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    1e-04  30%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-04  30%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-04  34%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-04  37%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-04  20%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-05  29%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN(query 339->505)
    5e-04  25%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 422->506)
    5e-04  25%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN(query 422->506)
    7e-06  26%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 422->505)
    3e-06  27%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID(query 422->505)
    7e-06  26%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 422->505)
    2e-05  30%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING(query 422->505)
    7e-04  26%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK(query 428->537)
:539

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLFQGLGLTKRYGDFTANSAIDIAIAPGQIHALLGENGAG
2it1B           -------------------------------------IVKKFGNFTALNNINLKIKDGEFMALLGPSGSG
2it1A           -------------------------------------IVKKFGNFTALNNINLKIKDGEFMALLGPSGSG
3dhwC           --------------------------------------------------VSLHVPAGQIYGVIGASGAG
1q12A           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
3fh6A           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awoA           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awnB           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2r6gB           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2r6gA           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awnC           ---------------------------------------------TVSKDINLDIHEGEFVVFVGPSGCG
1g9xA           -------------------------------------IVKYFGEFKALDGVSISVCKGDVTLIIGPNGSG
1gajA           -------------------------------------IVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
1g6hA           -------------------------------------IVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
2onkA           -------------------------------MFLKVRAEKRLGNFRLNVDFEMG---RDYCVLLGPTGAG
3fvqB           -------------------------------------LSKSFQNTPVLNDISLSLDPGEILFIIGASGCG
3fvqA           -------------------------------------LSKSFQNTPVLNDISLSLDPGEILFIIGASGCG
2awoC           ---------------------------------------------TVSKDINLDIHEGEFVVFVGPSGCG
2yyzA           -----------------------------------VNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCG
3d31A           -------------------------------------LSRKWKNFSLDN-LSLKVESGEYFVILGPTGAG
1g291           ---------------------------------------KVFGEVTAVREMSLEVKDGEFMILLGPSGCG
1oxvA           ------------------------------------------GKVVALDNVNINIENGERFGILGPSGAG
1oxsC           ------------------------------------------GKVVALDNVNINIENGERFGILGPSGAG
2oukB           -------------------------------------LKKSFGSLEVLKGINVHIREGEVVVVIGPSGSG
2oljA           -------------------------------------LKKSFGSLEVLKGINVHIREGEVVVVIGPSGSG
3gfoA           -------------------------------------LNYNYSDGTALKGINMNIKRGEVTAILGGNGVG
3g60A           --------------------------------------------------LSLEVKKGQTLALVGSSGCG
3g5uA           --------------------------------------------------LSLEVKKGQTLALVGSSGCG
2pcjA           --------------------------------------------------ISLSVKKGEFVSIIGASGSG
1l2tB           --------------------------------------------------VNLNIKEGEFVSIMGPSGSG
1l2tA           --------------------------------------------------VNLNIKEGEFVSIMGPSGSG
1b0uA           -----------------------------------IDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXX
1ji0A           -----------------------------------------YGAIHAIKGIDLKVPRGQIVTLIGANGAG
2yz2B           --------------------------------------------------VSLVINEGECLLVAGNTGSG
2yz2A           --------------------------------------------------VSLVINEGECLLVAGNTGSG
1mt0A           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
2ff7A           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
1pf4A           ----------------------------------------------ALSHVSFSIPQGKTVALVGRSGSG
2hydA           --------------------------------------------------INLSIEKGETVAFVGMSGGG
2ghiC           -------------------------------------------------SINFFIPSGTTCALVGHTGSG
2fgkA           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
2ffbA           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
3b5jA           --------------------------------------------------INLSIKQGEVIGIVGRAGSG
1vplA           ------------------------------------------------------------------NGAG
1v43A           -------------------------------------LTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCG
1xefA           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
2ghiA           -------------------------------------------------SINFFIPSGTTCALVGHTGSG
2ffaA           --------------------------------------------------INLSIKQGEVIGIVGRSGSG
2nq2D           --------------------------------------------YQAFQQLNFDLNKGDILAVLGQNGCG
1z47B           -----------------------------------VGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSG
1z47A           -----------------------------------VGVEKIYGGARSVRGVSFQIREGEMVGLLGPSGSG
2nq2C           ---------------------------------------------------------GDILAVLGQNGCG
1mv5D           -------------------------------------LSARHVDFAYDDSISFEAQPNSIIAFAGPSGGG
1mv5A           -------------------------------------LSARHVDFAYDDSISFEAQPNSIIAFAGPSGGG
1oxxK           ------------------------------------------GKVVALDNVNINIENGERFGILGPSGAG
1f3oA           ---------------------------------------------------------------IGPSGSG
2ixfC           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
2ixfA           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
2ghiD           -------------------------------------------------SINFFIPSGTTCALVGHTGSG
2awnA           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2d62A           -----------------------------------INIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCG
1xmiB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2ixgA           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
1jj7A           -------------------------------------------DVLVLQGLTFTLRPGEVTALVGPNGSG
2ixfD           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
2ghiB           -------------------------------------------------SINFFIPSGTTCALVGHTGSG
2ixeA           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
2zu0C           --------------------------------------------------LSLDVHPGEVHAIMGPNGSG
2d3wA           --------------------------------------------------LSLDVHPGEVHAIMGPNGSG
2ixeD           --------------------------------------------------LTFTLYPGKVTALVGPNGSG
3bk7A           -------------------------------------LVKDYGSFKLEVEPG-EIRKGEVIGIVGPNGIG
1xmiD           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzgB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzgA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzeB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzeA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
1xmiE           --------------------------------------------------INFKIERGQLLAVAGSTGAG
1xmiC           --------------------------------------------------INFKIERGQLLAVAGSTGAG
1xmiA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2d3wB           --------------------------------------------------LSLDVHPGEVHAIMGPNGSG
1yqtA           -------------------------------------LVKDYGSFRLEVEPG-EIKKGEVIGIVGPNGIG
2d3wD           --------------------------------------------------LSLDVHPGEVHAIMGPNGSG
2bbtB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2bbsA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzfA           -------------------------------------VTAFWGGTPVLKDINFKIERGQLLAVAGSTGAG
2bbtA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2bbsB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2bboA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2pzfB           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2d3wC           --------------------------------------------------LSLDVHPGEVHAIMGPNGSG
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmjA           --------------------------------------------------INFKIERGQLLAVAGSTGAG
2d2eA           ---------------------------------------------TILKGVNLVVPKGEVHALMGPNGAG
1r10A           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0zD           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0zC           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0zB           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0zA           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0xD           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0xC           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0xB           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0xA           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0wC           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0wB           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1r0wA           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1q3hD           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1q3hC           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1q3hB           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1q3hA           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1xfaA           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1xf9D           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1xf9C           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1xf9B           --------------------------------------------------INLNIEKGEMLAITGSTGSG
1xf9A           --------------------------------------------------INLNIEKGEMLAITGSTGSG
2ihyA           ------------------------------------------------------IAKGDKWILYGLNGAG
2d2fA           ---------------------------------------------TILKGVNLVVPKGEVHALMGPNGAG
1sgwA           --------------------------------------------------ITMTIEKGNVVNFHGPNGIG
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           --------------------------------------------------INLKIPAGKTVALVGRSGSG
3b60A           --------------------------------------------------INLKIPAGKTVALVGRSGSG
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2ihyB           ------------------------------------------------------IAKGDKWILYGLNGAG
2iw3A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2awnD           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awoD           -------------------------------------VTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2cbzA           ------------------------------------------------NGITFSIPEGALVAVVGQVGCG
3dhwC           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSTLVKTICGLIQPDDGAMRWRXXXXXXXXXXXXXXXXIGLVSQHFALFDNLTVAENVALGQRGGESLDI
2it1B           KSTLLYTIAGIYKPTSGKIYF---DEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIALRKAPREEID-
2it1A           KSTLLYTIAGIYKPTSGKIYF---DEKDVTELPPKDRNVGLVFQNWALYPHMTVYKNIALRKAPREEID-
3dhwC           KSTLIRCVNLLERPTEGSVLGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPELDNTPKDE
1q12A           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
3fh6A           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
2awoA           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
2awnB           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
2r6gB           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
2r6gA           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
2awnC           KSTLLRMIAGL--------------------------GVGMVFQSYALYPHLSVAENMSFGLKAGAKKEV
1g9xA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGENPGESPEE
1gajA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGENPGESPEE
1g6hA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEIPGESPEE
2onkA           KSVFLELIAGIVKPDRGEVRLNGADITPLPPERRG---IGFVPQDYALFPHLSVYRNIAYGLXXXXXXXX
3fvqB           KTTLLRCLAGFEQPDSGEISLSKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTA
3fvqA           KTTLLRCLAGFEQPDSGEISLSKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTA
2awoC           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMV----ALYPHLSVAENMSFGLKAGAKKEV
2yyzA           KTTTLLMLAGIYKPTSGEIYF---DDVLVNDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRSKDE
3d31A           KTLFLELIAGFHVPDSGRI---LLDGKDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKD-
1g291           KTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKIAMVFQSYALYPHMTVYDNIAFPLKLRKPRQE
1oxvA           KTTFMRIIAGLDVPSTGELYFRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKSKEE
1oxsC           KTTFMRIIAGLDVPSTGELYFRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKSKEE
2oukB           KSTFLRCL-NLLEDXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWEK
2oljA           KSTFLRCL-NLLEDXXXXXXXXXNLKAKDTNLNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWEK
3gfoA           KSTLFQNFNGILKPSSGRILFNKPIDYSRKGIMKLRESIGIVFQDNQLF-SASVYQDVSFGAVNMKPEDE
3g60A           KSTVVQLLERFYDPMAGSV-FLDGKEIKQLNVQWLRAQLGIVSQEPILFD-CSIAENIAYGDRAAKEANI
3g5uA           KSTVVQLLERFYDPMAGSV-FLDGKEIKQLNVQWLRAQLGIVSQEPILFD-CSIAENIAYGDRAAKEANI
2pcjA           KSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELSLLRLGFVFQFHYLIPELTALENVIVPMKMGKPKKE
1l2tB           KSTMLNIIGCLDKPTEGEVNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELGAMSGEALEC
1l2tA           KSTMLNIIGCLDKPTEGEVNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELGAMSGEALEC
1b0uA           KSTFLRCINFLEKPSEGAIKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMIQVLGLSKHDA
1ji0A           KTTTLSAIAGLVRAQKGKIIFN-GQDITNKPAHVINRGIALVPEGRRIFPELTVYEN--LGAYNRKDKEG
2yz2B           KSTLLQIVAGLIEPTSGDVLY----DGERKKGYEIRRNIGIAFQYFAVFDEVAFAVKNFYPDRDPVPL--
2yz2A           KSTLLQIVAGLIEPTSGDVLY----DGERKKGYEIRRNIGIAFQYFAVFDEVAFAVKNFYPDRDPVPL--
1mt0A           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
2ff7A           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
1pf4A           KSTIANLFTRFYDVDSGSI-CLDGHDVRDYKLTNLRRHFALVSQNVHLFND-TIANNIAYAAEGEYTREQ
2hydA           KSTLINLIPRFYDVTSGQILI-DGHNIKDFLTGSLRNQIGLVQQDNILFSD-TVKENILLGRPTATDEEV
2ghiC           KSTIAKLLYRFYDAEGDIKI--GGKNVNKYNRNSIRSIIGIVPQDTILF-NETIKYNILYGKLDATEEVI
2fgkA           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
2ffbA           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
3b5jA           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
1vplA           KTTTLRIISTLIKPSSGIV--TVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIERFVAGFYASSSSEI
1v43A           KTTTLRMIAGLEEPTEGRIYF---GDRDVTYLPPKDRNISMVFQH------MTVYENIAFPLKKFPK-DE
1xefA           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
2ghiA           KSTIAKLLYRFYDAEGDIKI--GGKNVNKYNRNSIRSIIGIVPQDTILF-NETIKYNILYGKLDATDEEV
2ffaA           KSTLTKLIQRFYIPENGQVLI-DGHDLALADPNWLRRQVGVVLQDNVLL-NRSIIDNISLANPGMSVEKV
2nq2D           KSTLLDLLLGIHRPIQGKIE--------------VYQSIGFVPQFFSSPFAYSVLDIVLMGR--STHINT
1z47B           KTTILRLIAGLERPTKGDV-W--IGGKRVTDLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRPKDE
1z47A           KTTILRLIAGLERPTKGDV-W--IGGKRVTDLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRPKDE
2nq2C           KSTLLDLLLGIHRPIQGKIE--------------VYQSIGFVPQFFSSPFAYSVLDIVLMGR--STHINT
1mv5D           KSTIFSLLERFYQPTAGEITI-DGQPIDNISLENWRSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDED
1mv5A           KSTIFSLLERFYQPTAGEITI-DGQPIDNISLENWRSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDED
1oxxK           KTTFMRIIAGLDVPSTGELYFRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKSKEE
1f3oA           KSTLNIIGC-LDKPTEGEVNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPYRGASGEER
2ixfC           KSTVAALLQNLYQPTGGKV-LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEE
2ixfA           KSTVAALLQNLYQPTGGKV-LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEE
2ghiD           KSTIAKLLYRFYDAEGDIKI--GGKNVNKYNRNSIRSIIGIVPQDTILF-NETIKYNILYGKLDATDEEV
2awnA           KSTLLRMIAGLETITSGDL---FIGEKRMNDTPPAERGVGMVFQSYA--------------------LEV
2d62A           KTTTLR-IAGLEEPTRGQIEDNLVADPEKGVFVPPKERDVAVFQSYALYPH-TVYDNIALKLRKVPKQEI
1xmiB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIAGVSYDE----
2ixgA           KSTVAALLQNLYQPTGGKV-LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEE
1jj7A           KSTVAALLQNLYQPTGGQL-LLDGKPLPQYEHRYLHRQVAAVGQEPQVFGR-SLQENIAYGLTQKPTMEE
2ixfD           KSTVAALLQNLYQPTGGKVLL-DGEPLVQYDHHYLHTQVAAVGQ---LLFGRSFRENIAYGLTRTPTMEE
2ghiB           KSTIAKLLYRFYDAEGDIKI--GGKNVNKYNRNSIRSIIGIVPQDTILF-NETIKYNILYGKLDATDEEV
2ixeA           KSTVAALLQNLYQPTGGKV-LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGR-SFRENIAYGLTRTPTMEE
2zu0C           KSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGLQTALNAVRSYRGQETLDR
2d3wA           KSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGLQTALNAVRSYRGQETLDR
2ixeD           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQ----VAAVGPLLFGRSFRENIAYGLTRTPTMEE
3bk7A           KTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIKAEYE--GTVYELLSKIDSSKLNSNF------------
1xmiD           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIAGYRSVIKACQ
2pzgB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIFGYRSVIKACQ
2pzgA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIFGYRSVIKACQ
2pzeB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIFGYRSVIKACQ
2pzeA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIFGYRSVIKACQ
1xmiE           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIAGYRSVIKACQ
1xmiC           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIAGYRSVIKACQ
1xmiA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIAGYRSVIKACQ
2d3wB           KSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGLQTALNAVRSYRGQETLDR
1yqtA           KTTFVK-LAGVEEPTEGKIEW--------------DLTVAYKPQYIKADYEGTVYELLSKIDASKLNSNF
2d3wD           KSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGLQTALNAVRSYRGQETLDR
2bbtB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQNSWIMPG-TIKENII-----GVSYDQ
2bbsA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQNSWIMPG-TIKENII-----GVSYDQ
2pzfA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENII-----GVSYDQ
2bbtA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQNSWIMPG-TIKENII-----GVSYDQ
2bbsB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQNSWIMPG-TIKENII-----GVSYDQ
2bboA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENIIFGYRSVIKACQ
2pzfB           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENII-----GVSYDQ
2d3wC           KSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGLQTALNAVRSYRGQETLDR
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmjA           KTSLLMMIMGELEPSEGKIK--------------HSGRISFCSQ-FSWIMPGTIKENII-----GVSYDQ
2d2eA           KSTLGKILAG--DPEYTVERGEILLDGENILELSPDERAGLLAFQYPVVPGVTIANRLALQAKLGREVGV
1r10A           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0zD           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0zC           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0zB           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0zA           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0xD           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0xC           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0xB           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0xA           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0wC           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0wB           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1r0wA           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1q3hD           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1q3hC           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1q3hB           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1q3hA           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIFGVSYDEKACQ
1xfaA           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIIRGVSYDEKACQ
1xf9D           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIISGVSYDEKACQ
1xf9C           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIISGVSYDEKACQ
1xf9B           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIISGVSYDEKACQ
1xf9A           KTSLLMLILGELEASEGIIK--------------HSGRVSFCSQ-FSWIMPGTIKENIISGVSYDEKACQ
2ihyA           KTTLLNILNAYEPATSGTVN---LFGKPGYSAETVRQHIGFVSH--SLLEKFQEGERVIDVVISGAIDDE
2d2fA           KSTLGKILAGEYTVERGEILLDGENILELSPDERARKGLFLAFQYPVEVPGVTIANRLALQAKLGREVGV
1sgwA           KTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLAVASLYGVKVNKNEIMDA
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           KSTIASLITRFYDIDEGHI-LMDGHDLREYTLASLRNQVALVSQNVHLF-NDTVANNIAYAR-----TEE
3b60A           KSTIASLITRFYDIDEGHI-LMDGHDLREYTLASLRNQVALVSQNVHLF-NDTVANNIAYAR-----TEE
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2ihyB           KTTLLNILNAYEPATSGTVNLFGKPGKVGYSAETVRQHIGFVSH--SLLEKFQEGERVIDVVISGQDIDD
2iw3A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------LVESHSKMVAEVDMKEALASGQ-----FRP
2iwhB           ----------------------------------------LVESHSKMVAEVDMKEALASGQ-----FRP
2awnD           KSTLLRMIAGL-----------------------------------------------------------
2awoD           KSTLLRMIAGL-----------------------------------------------------------
2cbzA           KSSLLSALLAEMDKVEGHVAIKGS--------------VAYVPQQ-AWIQNDSLRENILFGCQLEEPYRS
3dhwC           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LSRRLAQIAERYGLPLDPKREVWRLSVGERQRIEIVRALMQDPQFLILDEPTAVLTPAEADRLFDVLEQL
2it1B           --KKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRL
2it1A           --KKVREVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRL
3dhwC           VKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDI
1q12A           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
3fh6A           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
2awoA           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
2awnB           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
2r6gB           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAARVQMRIEISRLH
2r6gA           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAARVQMRIEISRLH
2awnC           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
1g9xA           MVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLEL
1gajA           MVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLEL
1g6hA           MVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLEL
2onkA           XXXXXX-MAEKLGIAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEP---LSAVDLKTKGVLMEEL
3fvqB           QERRIEAMLELTGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAAL
3fvqA           QERRIEAMLELTGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAAL
2awoC           INQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
2yyzA           VEKRVVEIARKLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHL
3d31A           -PKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVL
1g291           IDQRVREVAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKL
1oxvA           IRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEV
1oxsC           IRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEV
2oukB           AEAKAMELLDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQL
2oljA           AEAKAMELLDKVGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQL
3gfoA           IRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEM
3g60A           -HQFIDSLPDKYNTRVGDKGT--QLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKA
3g5uA           -HQFIDSLPDKYNTRVGDKGT--QLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKA
2pcjA           AKERGEYLLSELGLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKI
1l2tB           L--KMAELEERFA-----NHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKL
1l2tA           L--KMAELEERFA-----NHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKL
1b0uA           RERALKYLAK---VGIDERAQPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQL
1ji0A           IKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQLAIGRALSRPK---LLDEPSLGLAPILVSEVFEVIQKI
2yz2B           ----VKKAMEFVGLDFDSDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKW
2yz2A           ----VKKAMEFVGLDFDSDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKW
1mt0A           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
2ff7A           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
1pf4A           IEQAARQAHAMQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL
2hydA           VEAAKMANAHDFNLPQGYDTEVGKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVL
2ghiC           KATKSAQLYDFIALPKKWDTIVGGMKLGERQRIAIARCLLKDPKIVIFDEATSSL-DSKTEYLFQAVEDL
2fgkA           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI
2ffbA           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI
3b5jA           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
1vplA           -EEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQA
1v43A           IDKRVRWAAELLQIEELLNRYPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPDAKLRVAMRAEIKKLQQKL
1xefA           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
2ghiA           I--KATKSAQLYDF-IEALPKKWKLSGGERQRIAIARCLLKDPKIVIFDEATSSL-DSKTEYLFQAVEDL
2ffaA           IYAAISELREGYNTIVGEQGA--GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI
2nq2D           FAKPKSQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDL
1z47B           MDARVRELLRFMRLESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQV
1z47A           MDARVRELLRFMRLESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQV
2nq2C           FAKPKSQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDL
1mv5D           LWQVLDLAFARSNMPDQLNTEVGKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSL
1mv5A           LWQVLDLAFARSNMPDQLNTEVGKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSL
1oxxK           IRKRVEEVAKILDIHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEV
1f3oA           RKRALAELEERFA-----NHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLN
2ixfC           ITAVAMESGAHSGFPQGYDTEVGQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLESP
2ixfA           ITAVAMESGAHSGFPQGYDTEVGQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLESP
2ghiD           IKATKSAQLYDFIEALPKKWDTIVLSGGERQRIAIARCLLKDPKIVIFDD-------SKTEYLF---QKA
2awnA           INQRVNQVAE-------------VLAIG--------RTLVAEPSVFLLDEPLSNLDAARVQMRIEISRLH
2d62A           -DKRVREVAE-LGLTELLNRKPRELSGGQRQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQ
1xmiB           --YRYRSVIKACQLEEDISKIVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2ixgA           ITAVAMESGAHSGFPQGYDTEVGQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLESP
1jj7A           ITAAAVKSGAHSGLPQGYDTEVSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLESP
2ixfD           ITAVAMESGAHSGFPQGYDTEVGQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLESP
2ghiB           I--KATKSAQLYDF-IEALPKKWKLSGGERQRIAIARCLLKDPKIVIFDEAT---SDSKTEYLFQAVEDL
2ixeA           ITAVAMESGAHSGFPQGYDTEVGQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLESP
2zu0C           FDFQ-DLMEEKIALLKMPEDLLTRFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSL
2d3wA           FDFQ-DLMEEKIALLKMPEDLLTRFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSL
2ixeD           ITAVAMESGAHSGFPQGYDTEV-QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLESP
3bk7A           ---YKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLD----------VEQR
1xmiD           LEEDISKFAEKDNIVLG---EI-TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzgB           LEEDISKFAEKDNIVLG-----ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzgA           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzeB           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzeA           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
1xmiE           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
1xmiC           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
1xmiA           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2d3wB           FDFQ-DLMEEKIALLKMPEDLLTRFSGGEKKRNDILQMAVLEPELCILDESDSLDIDA-LKVVADGVNSL
1yqtA           YKTELLKIIDLYD------REVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHL
2d3wD           FDFQ-DLMEEKIALLKMPEDLLTRFSGGEKKRNDILQMAVLEPELCILDESDGLDIDA-LKVVADGVNSL
2bbtB           LEEDISKFAEKDNIVLG-----ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2bbsA           LEEDISKFAEKDNIVL------ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzfA           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2bbtA           LEEDISKFAEKDNIVLGG----ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2bbsB           LEEDISKFAEKDNIVLGG----ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2bboA           LEEDISKFAEKDNIVLGEGGIT--LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2pzfB           LEEDISKFAEKDNIVLGEGGIT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2d3wC           FDFQ-DLMEEKIALLKMPEDLLTRFSGGEKKRNDILQMAVLEPELCILDESDDI---DALKVVADGVNSL
2vf8B           ------------------------LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENL
2vf8A           ------------------------LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENL
2vf7C           ------------------------LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENL
2vf7B           ------------------------LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENL
2vf7A           ------------------------LSPGELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENL
1xmjA           LEEDISKFAEKDNIVLGEGGIT--LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCK
2d2eA           AEFWTKVKKALELLDWDESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAM
1r10A           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0zD           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0zC           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0zB           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0zA           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0xD           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0xC           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0xB           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0xA           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0wC           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0wB           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1r0wA           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1q3hD           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1q3hC           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1q3hB           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1q3hA           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1xfaA           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1xf9D           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1xf9C           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1xf9B           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
1xf9A           LQQDITKFAEQDNTVLGEGGVT--LSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCK
2ihyA           IRNEAHQLLKLVG-SAKAQQYIGYLSTGEKQRV-IARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXX
2d2fA           -AEFWTKVKKALELLDWDESYLSRFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAM
1sgwA           LESVEV---------LDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKLKSILEIL
2r6fB           ------------------------LSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRL
2r6fA           ------------------------LSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRL
1z2rA           YSREQIEEAARMAYAMDFINKMDNLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL
3b60A           YSREQIEEAARMAYAMDFINKMDNLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDEL
2ix8A           ------EIEEHCSLGLDPESRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYL---DRDSLGALSKAL
2iw3B           ------EIEEHCSLGLDPESRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYL---DRDSLGALSKAL
2ihyB           EIRNEAHQLLKLVGSAKAQQYIGYLSTGEKQRV-IARALGQ-PQVLILDEPAAGLDFIAREXXXXXXXXX
2iw3A           ------EIEEHCSLGLDPESRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYL---DRDSLGALSKAL
2ix3A           LTRK--EIEEHCSLGLDPESRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYL---DRDSLGALSKAL
2iwhB           LTRK--EIEEHCSLGLDPESRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYL---DRDSLGALSKAL
2awnD           ---------------------------------------MVEPSVFLLDEPLSNLDAALRVQMRIEISRL
2awoD           ---------------------------------------MVEPSVFLLDEPLRVQMRIEISRLHKRL---
2cbzA           VIQACALLPDLEILPSGDRTEIGELSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFEIGPKG
3dhwC           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RADGRALLYISHKLEEVKRLCDTATILRAGRVVAACNPRAETAASLARMMVGVDVIPPxxxxxxxxxxxx
2it1B           QKEGITTVYVTHDQAEALAMADRIAVIREGEILQVGTP--------------------------------
2it1A           QKEGITTVYVTHDQAEALAMADRIAVIREGEILQVGTP--------------------------------
3dhwC           RRLGLTILLITHEMDVVKRICDCVAVISNGELI-------------------------------------
1q12A           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
3fh6A           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2awoA           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2awnB           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2r6gB           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2r6gA           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2awnC           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
1g9xA           KAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA------------------------------------
1gajA           KAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA------------------------------------
1g6hA           KAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIA------------------------------------
2onkA           RFVQRPILHVTHDLIEAAMLADEVAVMLNGRIV-------------------------------------
3fvqB           RANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHRQPADLDAALFIGEGIVFP------------
3fvqA           RANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHRQPADLDAALFIGEGIVFP------------
2awoC           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2yyzA           QQEGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTP--------------------------------
3d31A           HKKNKTVLHITHDQTEARIMADRIAVVMDGKLIQVGKP--------------------------------
1g291           RQLGVTTIYVTHDQVEAMTMGDRIAVMNRG----------------------------------------
1oxvA           QSRGVTLLVVSHDPADIFAIAD------------------------------------------------
1oxsC           QSRGVTLLVVSHDPADIFAIAD------------------------------------------------
2oukB           ANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKP--------------------------------
2oljA           ANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKP--------------------------------
3gfoA           QKEGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPK-------------------------------
3g60A           R-EGRTCIVIAHRLSTIQN-ADLIVVIQNGKV--------------------------------------
3g5uA           R-EGRTCIVIAHRLSTIQN-ADLIVVIQNGKV--------------------------------------
2pcjA           NEGGTSIVMVTHE-RELAELTHRTLEMKDGKVV-------------------------------------
1l2tB           EEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--------------------------------------
1l2tA           EEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--------------------------------------
1b0uA           AEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDP--------------------------------
1ji0A           NQEGTTILLVEQNALGALKVAHYGYVLETGQIV-------------------------------------
2yz2B           KTLGKTVILISHDIETVINHVDRVVVLEKGKKV-------------------------------------
2yz2A           KTLGKTVILISHDIETVINHVDRVVVLEKGKKV-------------------------------------
1mt0A           -CKGRTVIIIAHRLSTVKN-ADRIIVMEKGKIV-------------------------------------
2ff7A           -CKGRTVIIIAHRLSTVKN-ADRIIVMEKGKIV-------------------------------------
1pf4A           QKN-KTVLVIAHRLSTIEQVVDEGEIIERGR---------------------------------------
2hydA           SKD-RTTLIVAHRLSTITH-ADKIVVIENGHIV-------------------------------------
2ghiC           RKN-RTLIIIAHRLSTISS-AESIILLNKGKIV-------------------------------------
2fgkA           -CKGRTVIIIAHRLSTVKN-ADRIIVMEKGKIV-------------------------------------
2ffbA           -CKGRTVIIIAHRLSTVKN-ADRIIVMEKGKIV-------------------------------------
3b5jA           -CKGRTVIIIAHRLSTVKN-ADRIIVMEKGKIV-------------------------------------
1vplA           SQEGLTILVSSHNMLEVEFLCDRIALIHNGTIV-------------------------------------
1v43A           KV---TTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSP--------------------------------
1xefA           -CKGRTVIIIAARLSTVKN-ADRIIVMEKGKIV-------------------------------------
2ghiA           RKN-RTLIIIAHRLSTISS-AESIILLNKGKIV-------------------------------------
2ffaA           -CKGRTVIIIAARLSTVKN-ADRIIVMEKGKIV-------------------------------------
2nq2D           QSQNMTVVFTTHQPNQVVAIANKTLLL-------------------------------------------
1z47B           HDEGVTSVFVTHDQEEALEVADRVLVLHEGNV--------------------------------------
1z47A           HDEGVTSVFVTHDQEEALEVADRVLVLHEGNV--------------------------------------
2nq2C           QSQNMTVVFTTHQPNQVVAIANKTLLL-------------------------------------------
1mv5D           -MKGRTTLVIAHRLSTI-----------------------------------------------------
1mv5A           -MKGRTTLVIAHRLSTI-----------------------------------------------------
1oxxK           QSRGVTLLVVSHDPADIFAIAD------------------------------------------------
1f3oA           EEDGKTVVVVTHDI-NVARFGERIIYLKDGEV--------------------------------------
2ixfC           EWASRTVLLITHQLSLAER---------------------------------------------------
2ixfA           EWASRTVLLITHQLSLAER---------------------------------------------------
2ghiD           VEDNRTLIIIAHRLSTISS-AESIILLNKGKIV-------------------------------------
2awnA           KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2d62A           RQLGVTTIYVTH----------------------------------------------------------
1xmiB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2ixgA           EWASRTVLLITQQLSLAER---------------------------------------------------
1jj7A           ERYSRSVLLITQHLSLVEQ-ADHILFLEGGAI--------------------------------------
2ixfD           EWASRTVLLITHQLSLAER---------------------------------------------------
2ghiB           RKN-RTLIIIAHR---TISSAESIILLNKGKIV-------------------------------------
2ixeA           EWASRTVLLITQQLSLAER---------------------------------------------------
2zu0C           RDGKRSFIIVTHYLDYIKP--DYVHVLYQGRIV-------------------------------------
2d3wA           RDGKRSFIIVTHYLDYIKP--DYVHVLYQGRIV-------------------------------------
2ixeD           EWASRTVLLITQQLSLAER---------------------------------------------------
3bk7A           LAVSRAIRHLMEKNEK------------------------------------------------------
1xmiD           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzgB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzgA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzeB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzeA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
1xmiE           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
1xmiC           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
1xmiA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2d3wB           RDGKRSFIIVTHYLDYIKP--DYVHVLYQGRIV-------------------------------------
1yqtA           EKNEKTALVVEH----------------------------------------------------------
2d3wD           RDGKRSFIIVTHYLDYIKP--DYVHVLYQGRIV-------------------------------------
2bbtB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2bbsA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzfA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2bbtA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2bbsB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2bboA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2pzfB           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2d3wC           RDGKRSFIIVTHYLDYIKP--DYVHVLYQGRIV-------------------------------------
2vf8B           KRGGNSLFVVEHDLDVIRR---------------------------------------------------
2vf8A           KRGGNSLFVVEHDLDVIRR---------------------------------------------------
2vf7C           KRGGNSLFVVEHDLDVIRR---------------------------------------------------
2vf7B           KRGGNSLFVVEHDLDVIRR---------------------------------------------------
2vf7A           KRGGNSLFVVEHDLDVIRR---------------------------------------------------
1xmjA           LMANKTRILVTSKMEHLKK-ADKILILHEG----------------------------------------
2d2eA           RGPNFGALVITHYQRILNYIPDKVHVMMDGRVVATGGP--------------------------------
1r10A           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0zD           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0zC           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0zB           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0zA           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0xD           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0xC           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0xB           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0xA           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0wC           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0wB           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1r0wA           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1q3hD           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1q3hC           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1q3hB           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1q3hA           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1xfaA           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1xf9D           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1xf9C           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1xf9B           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
1xf9A           LMANKTRILVTSKMEHLRK-ADKILILHQG----------------------------------------
2ihyA           XXXYPTLIYVTHFIEEITANFSKILLLKDGQSI-------------------------------------
2d2fA           RGPNFGALVITHYQRILNYIPDKVHVMMDGRVVATGGP--------------------------------
1sgwA           KEKGIVII--------------------------------------------------------------
2r6fB           VDNGDTVLVIEHNLDVIK----TADYIRGGQIVAVGTP--------------------------------
2r6fA           VDNGDTVLVIEHNLDVIK----TADYIRGGQIVAVGTP--------------------------------
1z2rA           QKN-RTSLVIAHRLSTIEQ---------------------------------------------------
3b60A           QKN-RTSLVIAHRLSTIEQ---------------------------------------------------
2ix8A           KEFEGGVIIITHSAEFTKNLTEEVWAVKDGRTPSGHN---------------------------------
2iw3B           KEFEGGVIIITHSAEFTKNLTEEVWAVKDGRTPSGHN---------------------------------
2ihyB           XXXYPTLIYVTHFIEEITANFSKILLLKDGQSI-------------------------------------
2iw3A           KEFEGGVIIITHSAEFTKNLTEEVWAVKDGR---------------------------------------
2ix3A           KEFEGGVIIITHSAEFTKNLTEEVWAVKDGRM--------------------------------------
2iwhB           KEFEGGVIIITHSAEFTKNLTEEVWAVKDGRM--------------------------------------
2awnD           HKRGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2awoD           ---GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP--------------------------------
2cbzA           MLKNKTRILVTHSMSYLPQV-DVIIVMSGGKI--------------------------------------
3dhwC           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTILIDGQAAGDL
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------SVLVDGQELTTL
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SITARRRFGAAFIPEQRLGHATVPTMRLSENALLTSHADPGVVRRGFVDRAALLGLVDRVTAAFGVRKAQ
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           SESARRQIGMIFQHFNLLSSRTV-----FGNVALPLELDKDEVKRRVTELLSLVGLGDK-----------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RDPEAERLSGGNLQKFIVGREILRQPKLLVVNQPSWXXXXXXXXXXXXXXXXXXXGGAAVLVISQDLDEL
2it1B           ----------------------------------------------------------------------
2it1A           ----------------------------------------------------------------------
3dhwC           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
2onkA           ----------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2yyzA           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1g291           ----------------------------------------------------------------------
1oxvA           ----------------------------------------------------------------------
1oxsC           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3gfoA           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1l2tB           ----------------------------------------------------------------------
1l2tA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2ghiC           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
2nq2C           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ghiB           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2zu0C           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
3bk7A           -DRELHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVL
1xmiD           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
1yqtA           ---EIQHLSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVL
2d3wD           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bboA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmjA           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
2d2fA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3dhwC           HDSYPSNLSGGQKQRVAIARALASNPKVLLCDETSALDPATTRSILELLKDINRRLGLTILLITHEMDVV
2r6gB           -DRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA
2r6gA           -DRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEA
1g9xA           -DRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIV
1gajA           -DRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIV
1g6hA           -DRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIV
2onkA           -DRKPARLSGGERQRVALARALVIQPRLLLLDEPSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEA
1g291           -------LSGGQRQRVALGRAIVRKPQVFLMDEPSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEA


                         *         .         .         .         .         +         .:560
query           LEIADSIAVMYHGRLSPPLAAAETGREQLGLLMGGSGWPQQSVHDAIxx
2it1B           -------------------------------------------------
2it1A           -------------------------------------------------
3dhwC           -------------------------------------------------
1q12A           -------------------------------------------------
3fh6A           -------------------------------------------------
2awoA           -------------------------------------------------
2awnB           -------------------------------------------------
2r6gB           -------------------------------------------------
2r6gA           -------------------------------------------------
2awnC           -------------------------------------------------
1g9xA           -------------------------------------------------
1gajA           -------------------------------------------------
1g6hA           -------------------------------------------------
2onkA           -------------------------------------------------
3fvqB           -------------------------------------------------
3fvqA           -------------------------------------------------
2awoC           -------------------------------------------------
2yyzA           -------------------------------------------------
3d31A           -------------------------------------------------
1g291           -------------------------------------------------
1oxvA           -------------------------------------------------
1oxsC           -------------------------------------------------
2oukB           -------------------------------------------------
2oljA           -------------------------------------------------
3gfoA           -------------------------------------------------
3g60A           -------------------------------------------------
3g5uA           -------------------------------------------------
2pcjA           -------------------------------------------------
1l2tB           -------------------------------------------------
1l2tA           -------------------------------------------------
1b0uA           -------------------------------------------------
1ji0A           -------------------------------------------------
2yz2B           -------------------------------------------------
2yz2A           -------------------------------------------------
1mt0A           -------------------------------------------------
2ff7A           -------------------------------------------------
1pf4A           -------------------------------------------------
2hydA           -------------------------------------------------
2ghiC           -------------------------------------------------
2fgkA           -------------------------------------------------
2ffbA           -------------------------------------------------
3b5jA           -------------------------------------------------
1vplA           -------------------------------------------------
1v43A           -------------------------------------------------
1xefA           -------------------------------------------------
2ghiA           -------------------------------------------------
2ffaA           -------------------------------------------------
2nq2D           -------------------------------------------------
1z47B           -------------------------------------------------
1z47A           -------------------------------------------------
2nq2C           -------------------------------------------------
1mv5D           -------------------------------------------------
1mv5A           -------------------------------------------------
1oxxK           -------------------------------------------------
1f3oA           -------------------------------------------------
2ixfC           -------------------------------------------------
2ixfA           -------------------------------------------------
2ghiD           -------------------------------------------------
2awnA           -------------------------------------------------
2d62A           -------------------------------------------------
1xmiB           -------------------------------------------------
2ixgA           -------------------------------------------------
1jj7A           -------------------------------------------------
2ixfD           -------------------------------------------------
2ghiB           -------------------------------------------------
2ixeA           -------------------------------------------------
2zu0C           -------------------------------------------------
2d3wA           -------------------------------------------------
2ixeD           -------------------------------------------------
3bk7A           DYLSDVIHVVY--------------------------------------
1xmiD           -------------------------------------------------
2pzgB           -------------------------------------------------
2pzgA           -------------------------------------------------
2pzeB           -------------------------------------------------
2pzeA           -------------------------------------------------
1xmiE           -------------------------------------------------
1xmiC           -------------------------------------------------
1xmiA           -------------------------------------------------
2d3wB           -------------------------------------------------
1yqtA           DYLSDIIHVVY--------------------------------------
2d3wD           -------------------------------------------------
2bbtB           -------------------------------------------------
2bbsA           -------------------------------------------------
2pzfA           -------------------------------------------------
2bbtA           -------------------------------------------------
2bbsB           -------------------------------------------------
2bboA           -------------------------------------------------
2pzfB           -------------------------------------------------
2d3wC           -------------------------------------------------
2vf8B           -------------------------------------------------
2vf8A           -------------------------------------------------
2vf7C           -------------------------------------------------
2vf7B           -------------------------------------------------
2vf7A           -------------------------------------------------
1xmjA           -------------------------------------------------
2d2eA           -------------------------------------------------
1r10A           -------------------------------------------------
1r0zD           -------------------------------------------------
1r0zC           -------------------------------------------------
1r0zB           -------------------------------------------------
1r0zA           -------------------------------------------------
1r0xD           -------------------------------------------------
1r0xC           -------------------------------------------------
1r0xB           -------------------------------------------------
1r0xA           -------------------------------------------------
1r0wC           -------------------------------------------------
1r0wB           -------------------------------------------------
1r0wA           -------------------------------------------------
1q3hD           -------------------------------------------------
1q3hC           -------------------------------------------------
1q3hB           -------------------------------------------------
1q3hA           -------------------------------------------------
1xfaA           -------------------------------------------------
1xf9D           -------------------------------------------------
1xf9C           -------------------------------------------------
1xf9B           -------------------------------------------------
1xf9A           -------------------------------------------------
2ihyA           -------------------------------------------------
2d2fA           -------------------------------------------------
1sgwA           -------------------------------------------------
2r6fB           -------------------------------------------------
2r6fA           -------------------------------------------------
1z2rA           -------------------------------------------------
3b60A           -------------------------------------------------
2ix8A           -------------------------------------------------
2iw3B           -------------------------------------------------
2ihyB           -------------------------------------------------
2iw3A           -------------------------------------------------
2ix3A           -------------------------------------------------
2iwhB           -------------------------------------------------
2awnD           -------------------------------------------------
2awoD           -------------------------------------------------
2cbzA           -------------------------------------------------
3dhwC           KRICDCVAVISNGEL----------------------------------
2r6gB           MTLADKIVVLDAGRVA---------------------------------
2r6gA           MTLADKIVVLDAGRVA---------------------------------
1g9xA           LNYIDHLYVMFNGQI----------------------------------
1gajA           LNYIDHLYVMFNGQI----------------------------------
1g6hA           LNYIDHLYVMFNGQI----------------------------------
2onkA           AMLADEVAVMLNGRI----------------------------------
1g291           MTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGIGSPPMNFLDAI--