[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38488.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eihA.bssp"
#ERROR : Can't open dsspfile "1yb5A.bssp"
#ERROR : Can't open dsspfile "2j8zA.bssp"
#ERROR : Can't open dsspfile "2obyA.bssp"
#ERROR : Can't open dsspfile "1wlyA.bssp"
#ERROR : Can't open dsspfile "1rjwA.bssp"
#ERROR : Can't open dsspfile "1qorA.bssp"
#ERROR : Can't open dsspfile "2vn8B.bssp"
#ERROR : Can't open dsspfile "2vn8A.bssp"
#ERROR : Can't open dsspfile "2eerB.bssp"
#ERROR : Can't open dsspfile "2eerA.bssp"
#ERROR : Can't open dsspfile "1h2bB.bssp"
#ERROR : Can't open dsspfile "1h2bA.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "2c0cB.bssp"
#ERROR : Can't open dsspfile "2c0cA.bssp"
#ERROR : Can't open dsspfile "1lluA.bssp"
#ERROR : Can't open dsspfile "1zsyA.bssp"
#ERROR : Can't open dsspfile "2vcyA.bssp"
#ERROR : Can't open dsspfile "2vz9B.bssp"
#ERROR : Can't open dsspfile "2vz9A.bssp"
#ERROR : Can't open dsspfile "2vz8B.bssp"
#ERROR : Can't open dsspfile "2vz8A.bssp"
#ERROR : Can't open dsspfile "1pqwB.bssp"
#ERROR : Can't open dsspfile "1pl8A.bssp"
#ERROR : Can't open dsspfile "1xa0B.bssp"
#ERROR : Can't open dsspfile "2j3hB.bssp"
#ERROR : Can't open dsspfile "2j3hA.bssp"
#ERROR : Can't open dsspfile "1xa0A.bssp"
#ERROR : Can't open dsspfile "1pl6A.bssp"
#ERROR : Can't open dsspfile "3fbgB.bssp"
#ERROR : Can't open dsspfile "3fbgA.bssp"
#ERROR : Can't open dsspfile "1tt7A.bssp"
#ERROR : Can't open dsspfile "2hcyA.bssp"
#ERROR : Can't open dsspfile "2d8aA.bssp"
#ERROR : Can't open dsspfile "1v3vB.bssp"
#ERROR : Can't open dsspfile "1v3uB.bssp"
#ERROR : Can't open dsspfile "1v3tB.bssp"
#ERROR : Can't open dsspfile "1v3tA.bssp"
#ERROR : Can't open dsspfile "2dm6A.bssp"
#ERROR : Can't open dsspfile "1v3uA.bssp"
#ERROR : Can't open dsspfile "3gfbA.bssp"
#ERROR : Can't open dsspfile "2dfvA.bssp"
#ERROR : Can't open dsspfile "3ip1C.bssp"
#ERROR : Can't open dsspfile "3ip1A.bssp"
#ERROR : Can't open dsspfile "1e3jA.bssp"
#ERROR : Can't open dsspfile "3gmsA.bssp"
#ERROR : Can't open dsspfile "3gqvA.bssp"
#ERROR : Can't open dsspfile "3b70A.bssp"
#ERROR : Can't open dsspfile "3b6zA.bssp"
#ERROR : Can't open dsspfile "1o8cA.bssp"
#ERROR : Can't open dsspfile "1o8cC.bssp"
#ERROR : Can't open dsspfile "3i4cA.bssp"
#ERROR : Can't open dsspfile "1r37A.bssp"
#ERROR : Can't open dsspfile "1o89A.bssp"
#ERROR : Can't open dsspfile "3i4cH.bssp"
#ERROR : Can't open dsspfile "1iyzA.bssp"
#ERROR : Can't open dsspfile "2cf5A.bssp"
#ERROR : Can't open dsspfile "1ntoA.bssp"
#ERROR : Can't open dsspfile "1zsvA.bssp"
#ERROR : Can't open dsspfile "3i4cD.bssp"

## Summary of PDB Search
:339
    5e-39  37%  2eihA  [x.x.x] ALCOHOL DEHYDROGENASE
    3e-28  30%  1yb5A  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    1e-25  30%  2j8zA  [x.x.x] QUINONE OXIDOREDUCTASE
    7e-25  30%  2obyA  [x.x.x] PUTATIVE QUINONE OXIDOREDUCTASE
    9e-23  38%  1wlyA  [x.x.x] 2-HALOACRYLATE REDUCTASE
    3e-20  32%  1rjwA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    5e-20  34%  1qorA  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    2e-17  28%  2vn8B  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    2e-17  28%  2vn8A  [x.x.x] RETICULON-4-INTERACTING PROTEIN 1
    5e-16  27%  2eerB  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    3e-15  27%  2eerA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    7e-15  34%  1h2bB  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    7e-15  34%  1h2bA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    2e-14  36%  1pqwA  [c.2.1] POLYKETIDE SYNTHASE
    2e-14  30%  2c0cB  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    2e-14  30%  2c0cA  [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
    4e-14  30%  1lluA  [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
    6e-14  26%  1zsyA  [x.x.x] MITOCHONDRIAL 2-ENOYL THIOESTER REDUCTASE
    6e-14  26%  2vcyA  [x.x.x] TRANS-2-ENOYL-COA REDUCTASE
    2e-13  30%  2vz9B  [x.x.x] FATTY ACID SYNTHASE
    2e-13  30%  2vz9A  [x.x.x] FATTY ACID SYNTHASE
    2e-13  30%  2vz8B  [x.x.x] FATTY ACID SYNTHASE
    2e-13  30%  2vz8A  [x.x.x] FATTY ACID SYNTHASE
    2e-13  36%  1pqwB  [c.2.1] POLYKETIDE SYNTHASE
    6e-13  31%  1pl8A  [b.35.1 - c.2.1] HUMAN SORBITOL DEHYDROGENASE
    2e-11  33%  1xa0B  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    3e-11  33%  2j3hB  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    3e-11  33%  2j3hA  [x.x.x] NADP-DEPENDENT OXIDOREDUCTASE P1
    5e-11  32%  1xa0A  [b.35.1 - c.2.1] PUTATIVE NADPH DEPENDENT OXIDOREDUCTASES
    5e-11  29%  1pl6A  [b.35.1 - c.2.1] SORBITOL DEHYDROGENASE
    8e-11  28%  3fbgB  [x.x.x] PUTATIVE ARGINATE LYASE
    8e-11  28%  3fbgA  [x.x.x] PUTATIVE ARGINATE LYASE
    3e-09  29%  1tt7A  [b.35.1 - c.2.1] YHFP
    4e-09  24%  2hcyA  [x.x.x] ALCOHOL DEHYDROGENASE 1
    1e-08  37%  2d8aA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    2e-08  32%  1v3vB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-08  32%  1v3uB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-08  32%  1v3tB  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-08  32%  1v3tA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    2e-08  32%  2dm6A  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    4e-08  31%  1v3uA  [b.35.1 - c.2.1] LEUKOTRIENE B4 12-
    5e-08  35%  3gfbA  [x.x.x] L-THREONINE 3-DEHYDROGENASE
    6e-08  32%  2dfvA  [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
    1e-07  43%  3ip1C  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    1e-07  43%  3ip1A  [x.x.x] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING
    1e-07  35%  1e3jA  [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
    7e-07  26%  3gmsA  [x.x.x] PUTATIVE NADPH:QUINONE REDUCTASE
    2e-06  32%  3gqvA  [x.x.x] ENOYL REDUCTASE
    2e-06  32%  3b70A  [x.x.x] ENOYL REDUCTASE
    2e-06  32%  3b6zA  [x.x.x] ENOYL REDUCTASE
    1e-05  26%  1o8cA  [b.35.1 - c.2.1] YHDH
    2e-05  26%  1o8cC  [b.35.1 - c.2.1] YHDH
    2e-05  24%  3i4cA  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-05  26%  1r37A  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    5e-05  28%  1o89A  [b.35.1 - c.2.1] YHDH
    5e-05  25%  3i4cH  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    6e-05  38%  1iyzA  [b.35.1 - c.2.1] QUINONE OXIDOREDUCTASE
    8e-05  26%  2cf5A  [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
    1e-04  26%  1ntoA  [b.35.1 - c.2.1] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
    2e-04  26%  1zsvA  [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
    4e-04  27%  3i4cD  [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
:339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXX
2eihA           MRAVVMRARGGPEVLEV-ADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPLPHXXXXXXXXXX
1yb5A           MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVI
2j8zA           MLAVHFDKPGGPENL-YVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHV
2obyA           MLAVHFDKPGGPENL-YVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHV
1wlyA           ----------------------------------------------------------------------
1rjwA           -----------------------PTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLXXXXXXXXXX
1qorA           ----------------------------------------------------------------------
2vn8B           --AWVIDKYGKNEVLRFTQNMMMPIIHPNEVIVKVHAASVNPIDVNMRSGYGATALPLHVIKGEEFPLTL
2vn8A           --AWVIDKYGKNEVLRFTQNMMMPIIHPNEVIVKVHAASVNPIDVNMRSGYGATALPLHVIKGEEFPLTL
2eerB           MRAMRLVEIGKPLKLE---DIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGLGVKLPVTLGHEIAGRI
2eerA           MRAMRLVEIGKPLKLE---DIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGLGVKLPVTLGHEIAGRI
1h2bB           ----------------------------------------------------------------------
1h2bA           ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
2c0cB           ------------EAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEV
2c0cA           ------------EAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEV
1lluA           MKAAVVHAYGAPLRIE-EVKVPLP--GPGQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEXXXXX
1zsyA           VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQV
2vcyA           VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQV
2vz9B           ----------------------------------------------------------------------
2vz9A           ----------------------------------------------------------------------
2vz8B           ----------------------------------------------------------------------
2vz8A           ----------------------------------------------------------------------
1pqwB           ----------------------------------------------------------------------
1pl8A           -------------------NYPIPEPGPNEVLLRMHSVGICGSDVYWEYGRIGFIVKKPMVLGHEASGTV
1xa0B           ------------------------DLPEGDVLVRVHYSSVNYKDGLA--SIPDGKIKTPFVPGID-----
2j3hB           ----------------------------------------------------------------------
2j3hA           ----------------------------------------------------------------------
1xa0A           ------------------------DLPEGDVLVRVHYSSVNYKDGLA--SIPDGKIKTPFVPGID--LAG
1pl6A           -------------------NYPIPEPGPNEVLLRHSVGICGSDVHYWEYGRIGNFIVKKPVLGHEASGTV
3fbgB           ---------------TFNLDIPEPKVH--EILVKIQSISVNPVD--TKQRLMDVS---PRVLGFDAIGVV
3fbgA           ---------------TFNLDIPEPKVH--EILVKIQSISVNPVD--TKQRLMDVS-KAPRVLGFDAIGVV
1tt7A           ------------------------DLPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAAGTV
2hcyA           ----------------------------------------------------------------------
2d8aA           -----------------------PKPGPGEVLIKVLATSICGTDIYEWNEWAQSRIKPPQI-GHXXXXXX
1v3vB           ----------------------------------------------------------------------
1v3uB           ----------------------------------------------------------------------
1v3tB           ----------------------------------------------------------------------
1v3tA           ----------------------------------------------------------------------
2dm6A           ----------------------------------------------------------------------
1v3uA           ----------------------------------------------------------------------
3gfbA           -----------------------PKPGPGEVLIKVLATSICGTDIYEWNEWAQSRIKPPQIMXXXXXXXX
2dfvA           ----------------------------------------------------------------------
3ip1C           ----------------------------------------------------------------------
3ip1A           ----------------------------------------------------------------------
1e3jA           ----------------------------------------------------------------------
3gmsA           -----------------------------EVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIV
3gqvA           ----------------------------------------------------------------------
3b70A           ----------------------------------------------------------------------
3b6zA           ----------------------------------------------------------------------
1o8cA           LQALLLEQQDG-KTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAG
1o8cC           -QALLLEQQDG-KTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAG
3i4cA           MRAVRLVEPLSLQEIGV----PKPK-GP-QVLIKVEAAGVCHSDVHMRQGVEDLGVKLPVTLGHEIAGKI
1r37A           ----------------------------------------------------------------------
1o89A           ----------------------------GDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAG
3i4cH           MRAVRLVEIGKPLSLQ-EIGVPKPK-GP-QVLIKVEAAGVCHSDVHMRQGRFG-NVKLPVTLGHEIAGKI
1iyzA           MKAWVLKRLGGPLELV---DLPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGM------
2cf5A           ----------------------------------------------------------------------
1ntoA           ----------------------------------------------------------------------
1zsvA           ----------------------------------------------------------------------
3i4cD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
2eihA           XXXXXXXEGFAPGDEVVINPCERCLAGILGEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTA
1yb5A           EAVGDNASAFKKGDRVFTS-----------STISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTA
2j8zA           AELGPGCQHWKIGDTA------------MALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
2obyA           AELGPGCQGHW-----------KIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
1wlyA           --------------------------------------------AEKLIKVPKDLDLDDVAGLMLKGMTA
1rjwA           XXXXXXXTHLKVGDRVGIPWLYSACGHCAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTT
1qorA           --------------------------------------------------LPAAISFEQAAASFLKGLTV
2vn8B           GRDVSGVVMECGLDVKYFKPGDEVWAAVP-PWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPTAWSAI
2vn8A           GRDVSGVVMECGLDVKYFKPGDEVWAAVP-PWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPTAWSAI
2eerB           EEVGDEVVGYSKGDLVAVNPWEG-EGNCLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
2eerA           EEVGDEVVGYSKGDLVAVNPWEG-EGNCLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
1h2bB           -----------------------------GLNIDGGFAEFMRTSHRSVIKLPKDISREEMAPLADAGITA
1h2bA           -----------------------------GLNIDGGFAEFMRTSHRSVIKLPKDISREEMAPLADAGITA
1pqwA           ----------------------------------------------------------EAATFGVAYLTA
2c0cB           VALG------------LSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVP-SVKPEYLTLL-VSGTTA
2c0cA           VALG------------LSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVP-SVKPEYLTLL-VSGTTA
1lluA           XXXXXXXTRVKEGDRVGIPWLYTACGCCTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTV
1zsyA           VAVGSNVTGLKPGDWVI--PANAGLGTWRTEAVFSEEA---------LIQVPSDIPLQSAATLGVNPCTA
2vcyA           VAVGSNVTGLKPGDWVI--PANAGLGTWRTEAVFSEEA---------LIQVPSDIPLQSAATLGVNPCTA
2vz9B           ---------------------------VMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTA
2vz9A           ---------------------------VMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTA
2vz8B           ---------------------------VMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTA
2vz8A           ---------------------------VMGMVPAEGLATSVLLLQHATWEVPSTWTLEEAASVPIVYTTA
1pqwB           ------------------------------------------------------------ATFGVAYLTA
1pl8A           EKVGSSVKHLKPGDRVAIEPRENDEFCKMGRYNDGNLCRFYKHNAAFCYKLPDNVTFEEGALIPLSVGIH
1xa0B           LAGVVVSSQHPEGDEVI------ATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAAIGTAGFTAA
2j3hB           ----------------------------------------------------------------------
2j3hA           ----------------------------------------------------------------------
1xa0A           VVVSSQHPRFREGDEVI------ATGYEIGVTHFGGYSEYARLHGEWLVPLPKGLTLKEAAIGTAGFTAA
1pl6A           EKVGSSVKHLKPGDRVAIEPGAPRENDEFCKGRDGNLCRFYKHNAAFCYKLPDNVTFEEGALIPLSVGIH
3fbgB           ESVGNEVTMFNQGDIVYYSG---------SPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITA
3fbgA           ESVGNEVTMFNQGDIVYYSG---------SPDQNGSNAEYQLINERLVAKAPKNISAEQAVSLPLTGITA
1tt7A           VSSNDPRFAEG--DEVIATSYE------LGVSRDGGLSEYASVPGDWLVPLPQNLSLKEAV-----YGTA
2hcyA           ---------------------------LSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITV
2d8aA           XXXXXXXXXXXXXDYVSVETCGKCYTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYAT-LQEPLGNA
1v3vB           ----------------------------------------------------------------------
1v3uB           ----------------------------------------------------------------------
1v3tB           ----------------------------------------------------------------------
1v3tA           ----------------------------------------------------------------------
2dm6A           ----------------------------------------------------------------------
1v3uA           ----------------------------------------------------------------------
3gfbA           XXXXXXXXDLQVGDYISVETHNRYHTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPPEYAA-LQEPLGNA
2dfvA           ---------------------------IFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYAT-LQEPLGNA
3ip1C           ----------------------------------------------------------------VAYNA-
3ip1A           ----------------------------------------------------------------VAYNA-
1e3jA           ---------------------------------DGNLARYYVHAADFCHKLPDNVSLEEGALLPLSVGVH
3gmsA           ENVGAFVSRELIGKRVLP---------LRGE---GTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTA
3gqvA           ----------------------------------GAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
3b70A           ----------------------------------GAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
3b6zA           ----------------------------------GAFSQYTVTRGRVWAKIPKGLSFEQAAALPAGISTA
1o8cA           TVRTSEDPRFHAGQEVL------LTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
1o8cC           TVRTSEDPRFHAGQEVL------LTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
3i4cA           EEVGDEVVGYSKGDLVAVNPLQG-EGNCLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITT
1r37A           ----------------------------------------------------------------------
1o89A           TVRTSEDPRFHAGQEVL------LTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
3i4cH           EEVGDEVVGYSKGDLVAVNPLQG-EGNCLGINFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITT
1iyzA           ----------------------------------------------------------------------
2cf5A           -----------------------------GQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTV
1ntoA           ----------------------------------------------------------------------
1zsvA           ----------------------------------------------------------------------
3i4cD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
2eihA           WQMVVDKLGVRPGDDVLVMXXXXXXXXXXIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTHPDWP
1yb5A           YRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYI
2j8zA           FQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFS
2obyA           FQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFS
1wlyA           QYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFA
1rjwA           YKALKVTG-AKPGEWVAIYGI-GGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAA
1qorA           YYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLV
2vn8B           NKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYSVEEQL
2vn8A           NKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYSVEEQL
2eerB           YRAVR-KASLDPSKTLVVIGAGGGLGTMAIQIAKVSGATIIGVDVREEALEAAKRAGADYVINASSQDPV
2eerA           YRAVR-KASLDPSKTLVVIGAGGGLGTMAIQIAKVSGATIIGVDVREEALEAAKRAGADYVINASSQDPV
1h2bB           YRAVKKAARLYPGAYVAIVGV-GGLGHIAVQLLKVTPATVIALDVKEEKLKLAERLGADHVVDARRDPVK
1h2bA           YRAVKKAARLYPGAYVAIVGV-GGLGHIAVQLLKVTPATVIALDVKEEKLKLAERLGADHVVDARRDPVK
1pqwA           WHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFA
2c0cB           YISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
2c0cA           YISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
1lluA           YKGLKQT-NARPGQWVAISGI-GGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPV
1zsyA           YRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDQKLSDRLKSLGAEHVI--TEEEL-
2vcyA           YRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDQKLSDRLKSLGAEHVI--TEEEL-
2vz9B           YYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQAPQLDETCFANSRDTQ
2vz9A           YYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQAPQLDETCFANSRDTQ
2vz8B           YYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQAPQLDETCFANSRDTQ
2vz8A           YYSLVVRGRMQPGESVLIHSGSGGVGQAAIAIALSRGCRVFTTVGSAEKRAYLQAPQLDETCFANSRDTQ
1pqwB           WHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFA
1pl8A           ---ACRRGGVTLGHKVLVCGA-GPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQISKESPQ
1xa0B           LSIHRLEEHGLTPERVLVTGATGGVGSLAVSLAK-RGYTVEASTGKAAEHDYLRVLGAKEVL---AERIR
2j3hB           ----------KEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKKFGFDDAFNYKEESDL
2j3hA           ----------KEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKKFGFDDAFNYKEESDL
1xa0A           LSIHRLEEHGLTPERVLVTGATGGVGSLAVSLAK-RGYTVEASTGKAAEHDYLRVLGAKEVLA------R
1pl6A           ---ACRRGGVTLGHKVLVCGA-GPIGVTLL-VAKAGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQ
3fbgB           YETLSRNRNENEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGAD-IVLNHKESLL
3fbgA           YETLSRNRNENEGKTLLIINGAGGVGSIATQIAKAYGLRVITTASRNETIEWTKKMGAD-IVLNHKESLL
1tt7A           HRL-EQNGLSPEKXXXXXXXXXXXXXXXXXXLNK-RGYDVVASTGNREAADYLKQLGASEVI--SREDVY
2hcyA           YKALKS-ANLMAGHWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEDIV
2d8aA           --VDTVLAGPISGKSVLITGA-GPLGLLGIAVAKASGAYVIVSEPSDFRRELAKKVGADYVINPFEEDVV
1v3vB           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1v3uB           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1v3tB           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1v3tA           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
2dm6A           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
1v3uA           ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
3gfbA           --VDTVLAGPIAGRSTLITGA-GPLGLLGIAVAKASGAYVIVSEPSEFRRKLAKKVGADYVVNPFEEDPV
2dfvA           --VDTVLAGPISGKSVLITGA-GPLGLLGIAVAKASGAYVIVSEPSDFRRELAKKVGADYVINPFEEDVV
3ip1C           --VIVRGGGIRPGDNVVILGG-GPIGLAAVAILKHAGASVILSEPSEVRRNLAKELGADHVIDPTKENFV
3ip1A           --VIVRGGGIRPGDNVVILGG-GPIGLAAVAILKHAGASVILSEPSEVRRNLAKELGADHVIDPTKENFV
1e3jA           ---ACRRAGVQLGTTVLVIGA-GPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLV-------
3gmsA           WVTCTETLNLQRNDVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVIDTSTAPLY
3gqvA           GLAMKLLGHSKP-VYVLVYGGSTATATVTMQMLRLSG-YIPIATCSPHNFDLAKSRGAEEVFDYRAPNLA
3b70A           GLAMKLLGHSKP-VYVLVYGGSTATATVTMQMLRLSG-YIPIATCSPHNFDLAKSRGAEEVFDYRAPNLA
3b6zA           GLAMKLLGHSKP-VYVLVYGGSTATATVTMQMLRLSG-YIPIATCSPHNFDLAKSRGAEEVFDYRAPNLA
1o8cA           --MLCVMALEDAGVRIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL--------
1o8cC           --MLCVMALEDAGVRIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL--------
3i4cA           YRAVR-KASLDPTKXXXXXXXXXXXXXXXXQIAKVSGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPL
1r37A           ----------------------------------------------------------------------
1o89A           --MLCVMALEDAGVRIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL--------
3i4cH           YRAVR-KASLDPTKXXXXXXXXXXXXXXXXQIAKVSGATIIXXXXXXXXXXXXXXXXXXYVINASMQDPL
1iyzA           ----------------------------------------------------------------------
2cf5A           YSPLSHFG-LKQPXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSNKKREELQDLGADDYVI-------
1ntoA           ----------------------------------------------------------------------
1zsvA           ---------VKGGETXXXXXXXXXXXXXXXXXXKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESL
3i4cD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
2eihA           KEVR-------RLTGGK----GADKVVDHTGALYFEGVIKATXXXXXXXXXXXXXXYEGTLPFAHVFYRQ
1yb5A           DKIKKYVGEK-----------GIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSTIEINPRDTM----AKE
2j8zA           EATLK-----------FTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFK
2obyA           EATLK-----------FTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFK
1wlyA           EVVRE-------ITGGK----GVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGV--ADPIRVV--ED
1rjwA           KFMKEKXXXXXXXXXXXXSKPAFQSAYN------------SIRRGGACVLVGLPPEEMPIPIFDTVLN-G
1qorA           E-------RLKEITGGKK----VRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLGI-----
2vn8B           KSLKPFDFILDNV-GGSTETWAPDFLKKWSGATPFLLNMDRLGIADGMLQTGVTVG---SKALKHFWKYR
2vn8A           KSLKPFDFILDNV-GGSTETWAPDFLKKWSGATPFLLNMDRLGIADGMLQTGVTVG---SKALKHFWKYR
2eerB           SEIRR-----------ITQGKGADAVIDLNNSEKTLSIYPVLAKQGKYVMVGLF-GADLKYHAPLITLNE
2eerA           SEIRR-----------ITQGKGADAVIDLNNSEKTLSIYPVLAKQGKYVMVGLF-GADLKYHAPLITLNE
1h2bB           QVMELTRGR------------GVNVAMDFVGSQATVDYTPYL-LGGRLIIVG-YGGELRFPTIRVI-SSE
1h2bA           QVMELTRGR------------GVNVAMDFVGSQATVDYTPYL-LGGRLIIVG-YGGELRFPTIRVI-SSE
1pqwA           DEILE-----------LTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELG------------------
2c0cB           TVLKQEYPE------------GVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGY-------------
2c0cA           TVLKQEYPE------------GVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGY-------------
1lluA           EAIQRDIG------------GAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLK-G
1zsyA           --------RRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKD
2vcyA           --------RRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKD
2vz9B           HVLRHTAGK------------GVDLVLNSLAEEKLQASVRCLAQHGRFLEIGGMAVFLKNVTFHGILLDS
2vz9A           HVLRHTAGK------------GVDLVLNSLAEEKLQASVRCLAQHGRFLEIGGMAVFLKNVTFHGILLDS
2vz8B           HVLRHTAGK------------GVDLVLNSLAEEKLQASVRCLAQHGRFLEIGGMAVFLKNVTFHGILLDS
2vz8A           HVLRHTAGK------------GVDLVLNSLAEEKLQASVRCLAQHGRFLEIGGMAVFLKNVTFHGILLDS
1pqwB           DEILE-----------LTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFI---------------------
1pl8A           EIARKVEGQ-------------------------------------------------------------
1xa0B           PLDKQRWAAAVDPVGGSRRYGGAVAVSGLTGGAEVPTTVHPFILRG-VSLLGIDSVYCP--DLRLIW---
2j3hB           TAALKR-----------CFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYEGVHNLSNIIYKR
2j3hA           TAALKR-----------CFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYEGVHNLSNIIYKR
1xa0A           ELDKQRWAAAVDPVGGSRRYGGAVAVSGLTGGAEVPTTVHPFILRG-VSLLGIDSVYCP--DLRLIW---
1pl6A           EIARKVEGQ-------------------------------------------------------------
3fbgB           ----------------------------------------------------------------------
3fbgA           ----------------------------------------------------------------------
1tt7A           DGTLKALSKQQ-------WQGAVDPV----GGKQLASLLSKIQYGGSVAVSGLTGG---GEVPATVYPFI
2hcyA           GAVLK------------ATDGGAHGVINVSVSEAAIESTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKS
2d8aA           KEV------------DITDGNGVDVFLEFSGAPKALQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKA
1v3vB           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
1v3uB           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
1v3tB           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
1v3tA           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
2dm6A           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
1v3uA           EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAIS-LPPGPSPESIIYKQ
3gfbA           KFVMD-----------ITDGAGVEVFLEFSGAPKALQGLKAVTPGGRVSLLGLFPREVTIDFNNLIIFKA
2dfvA           KEV------------DITDGNGVDVFLEFSGAPKALQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKA
3ip1C           EAV-------------------------------------------------------------------
3ip1A           EAV-------------------------------------------------------------------
1e3jA           ----------------------------------------------------------------------
3gmsA           ETVMEL------------TNGGADAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSG--------------
3gqvA           QTIR------------------------------------------------------------------
3b70A           QTIR------------------------------------------------------------------
3b6zA           QTIR------------------------------------------------------------------
1o8cA           ----------------------------------------------------------------------
1o8cC           ----------------------------------------------------------------------
3i4cA           AEIRR-----------ITESKGVDAVIDLNYSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE
1r37A           -----------------TESKGVDAVIDLNNSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE
1o89A           ----------------------------------------------------------------------
3i4cH           AEIRR-----------ITESKGVDAVIDLNYSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE
1iyzA           ----------------------------------------------------------------------
2cf5A           ----------------------------------------------------------------------
1ntoA           -----------------TESKGVDAVIDLNYSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE
1zsvA           EETLKK-----------ASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYN------------
3i4cD           -----------------TESKGVDAVIDLNYSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE


                         .         *         .         .         .         .         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP
2eihA           LSILGSTMASKSRLFPILRFVEEGKLKPVVGQVLPLEAAAEGHRLLEERRVFGKVVL--
1yb5A           SSIIGVTLFSKEEFQQYAAALQAGMLKPVIGSQYPLEKVAEA-----------------
2j8zA           ---RGSNKYKQMLVEQILPHFSTQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
2obyA           ---RGSNKYKQEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
1wlyA           LGVRGSNRSEIDEGSKLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLP
1rjwA           IKIIGSIVGTRKDLQEALQFAAEGKVKTIIE-VQPLEKINEVFDRMLKGQINGRVVLT-
1qorA           LNQKGSLYVTRPSLQELFSLIASGVIKVDVQQKYPLKDAQRAHEILESRATQGSSLLIP
2vn8B           WAFFMASGPCLDDIAE---LVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
2vn8A           WAFFMASGPCLDDIAE---LVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
2eerB           VQFIGSLVGNQSDFLGIMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVLVP
2eerA           VQFIGSLVGNQSDFLGIMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVL--
1h2bB           VSFEGSLVGNYVELHELVTLALQGKVRVEVD-IHKLDEINDVLERLEKGEVLGRAVLIP
1h2bA           VSFEGSLVGNYVELHELVTLALQGKVRVEVD-IHKLDEINDVLERLEKGEVLGRAVLIP
1pqwA           -----------------------------------------------------------
2c0cB           -----------------------------------------------------------
2c0cA           -----------------------------------------------------------
1lluA           LHIAGSIVGTRADLQEALDFAGEGLVKATIGKLDDINQILDQMRQIEGRIV--------
1zsyA           LKLRGLSQWKKDHILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILT-
2vcyA           LKLRGLSQWKKDHILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILT-
2vz9B           LFEEGGATWQ-EVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz9A           LFEEGGATWQ-EVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz8B           LFEEGGATWQ-EVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
2vz8A           LFEEGGATWQ-EVSELLKAGIQEGVVQPLKCTVFPRTKVEAAFRYMAQGKHIGKVVI--
1pqwB           -----------------------------------------------------------
1pl8A           -----------------------------------------------------------
1xa0B           -----------------------------------------------------------
2j3hB           NRIQGSDFYDKYSLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
2j3hA           NRIQGSDFYDKYSLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
1xa0A           -----------------------------------------------------------
1pl6A           -----------------------------------------------------------
3fbgB           -----------------------------------------------------------
3fbgA           -----------------------------------------------------------
1tt7A           LRGVSLLGWERS------SDLKPDQLLTIVDREVSLEETPGALKDILQNRIQGRVIV--
2hcyA           ISIVGSYVGNRADTREALDFFARGLVKSPI-KVVGLSTLPEIYEKMEKGQIVGRYVV--
2d8aA           LTIYGITGWE--TWYTVSRLLQSGKL---------------------------------
1v3vB           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
1v3uB           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
1v3tB           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
1v3tA           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
2dm6A           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
1v3uA           LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
3gfbA           LEVHGITGWE--TWYTVSSLIQSGKL---------------------------------
2dfvA           LTIYGITGWE--TWYTVSRLLQSGKL---------------------------------
3ip1C           -----------------------------------------------------------
3ip1A           -----------------------------------------------------------
1e3jA           -----------------------------------------------------------
3gmsA           -----------------------------------------------------------
3gqvA           -----------------------------------------------------------
3b70A           -----------------------------------------------------------
3b6zA           -----------------------------------------------------------
1o8cA           -----------------------------------------------------------
1o8cC           -----------------------------------------------------------
3i4cA           IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
1r37A           IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
1o89A           -----------------------------------------------------------
3i4cH           IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLEGRQV--------
1iyzA           -----------------------------------------------------------
2cf5A           -----------------------------------------------------------
1ntoA           IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
1zsvA           -----------------------------------------------------------
3i4cD           IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENRQV--------