[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38511.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dh3C.bssp"
#ERROR : Can't open dsspfile "3dh3B.bssp"
#ERROR : Can't open dsspfile "3dh3A.bssp"
#ERROR : Can't open dsspfile "2omlA.bssp"
#ERROR : Can't open dsspfile "2olwB.bssp"
#ERROR : Can't open dsspfile "2olwA.bssp"
#ERROR : Can't open dsspfile "1kskA.bssp"
#ERROR : Can't open dsspfile "1vioA.bssp"
#ERROR : Can't open dsspfile "2gmlA.bssp"
#ERROR : Can't open dsspfile "2i6lA.bssp"

## Summary of PDB Search
:795
    1e-19  32%  3dh3C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    1e-19  32%  3dh3B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    1e-19  32%  3dh3A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    3e-19  36%  2omlA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    3e-19  36%  2olwB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    3e-19  36%  2olwA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    1e-13  32%  1kskA  [d.66.1 - d.265.1] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE
    6e-09  27%  1vioA  [d.66.1 - d.265.1] RIBOSOMAL SMALL SUBUNIT PSEUDOURIDINE
    9e-08  31%  2gmlA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
    3e-04  40%  2i6lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
:795

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRIAKVVARAGLCSR
3dh3C           --------------------------------------------------------RLNKYISESGICSR
3dh3B           --------------------------------------------------------RLNKYISESGICSR
3dh3A           --------------------------------------------------------RLNKYISESGICSR
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           --------------------------------------------------------RLDKFIAQQLGVSR
1vioA           --------------------------------------------------------RLDKFIAENVGLTR
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
3dh3C           READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPREAEDLVLINKPVGIVSTTEDGE-RDNIV
3dh3B           READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPREAEDLVLINKPVGIVSTTEDGE-RDNIV
3dh3A           READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPREAEDLVLINKPVGIVSTTEDGE-RDNIV
2omlA           --------------------------------------------TRVILFNKPYDVLPQFTDEAGRKTLK
2olwB           --------------------------------------------TRVILFNKPYDVLPQFTDEAGRKTLK
2olwA           --------------------------------------------TRVILFNKPYDVLPQFTDEAGRKTLK
1kskA           AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFL-NKPQGYVCSTDDPD-HPTVL
1vioA           SQATKAIRQSAVKINGEIVKSGSVQISQEDEIYFEDELLTWIEEGQYFMLNKPQGCVCSNDD---YPTIY
2gmlA           ----------------------------------------------LIALNKPVGIVSTTEDGE-RDNIV
2i6lA           -------------------------------------PLLE-EHARLFMYQLLRGLKYIHS---------


                         .         .         .         *         .         .         .:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
3dh3C           DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
3dh3B           DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
3dh3A           DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
2omlA           EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
2olwB           EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
2olwA           EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
1kskA           YFLDEPVAKLHAAGRLDIDTTG-LVLTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
1vioA           QFFDYPLAKLHSAGRXXXXXXXXXXXXXXXQWSHRITSPKHHCEKTYLVTLADPVEENYSAACAEGILLR
2gmlA           DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITE-EFIRGSAGVPIL
2i6lA           ---ANVLHRDLKPANLFINTEDLVLKIGDFGLARIMHLSETKWYRSPRLLLSPNNYTKAIDMWAAG----


                         .         +         .         .         .         .         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVxx
3dh3C           GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
3dh3B           GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
3dh3A           GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
2omlA           DGPTLPAGAELRRKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREV--
2olwB           DGPTLPAGAELRRKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREV--
2olwA           DGPTLPAGAELRRKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREV--
1kskA           NEKDLTKPAVLEVITPTQVRL--TISEGRYHQVKR-FAAVGNHVVELHRERIGGITL-------------
1vioA           GEKEPTKPAKLEILDDYNVNL--TISEGRYHQVKRMFAALGNKVVGLHRWKIGDVVLDELEEGE------
2gmlA           GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRR-CEHFGYEVKKLER---------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           ----------------------------------------------------------------------
3dh3B           ----------------------------------------------------------------------
3dh3A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------
1kskA           ----------------------------------------------------------------------
1vioA           ----------------------------------------------------------------------
2gmlA           ----------------------------------------------------------------------
2i6lA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxx
3dh3C           -------------------------
3dh3B           -------------------------
3dh3A           -------------------------
2omlA           -------------------------
2olwB           -------------------------
2olwA           -------------------------
1kskA           -------------------------
1vioA           -------------------------
2gmlA           -------------------------
2i6lA           -------------------------