[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38614.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2onkC.bssp"
#ERROR : Can't open dsspfile "3d31C.bssp"
#ERROR : Can't open dsspfile "2r6gF.bssp"
#ERROR : Can't open dsspfile "3fh6F.bssp"

## Summary of PDB Search
:287
    1e-23  36%  2onkC  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE
    5e-21  38%  3d31C  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, PERMEASE
    6e-04  26%  2r6gF  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
    6e-04  26%  3fh6F  [x.x.x] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALF
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLRNLGDPGTLHAM
2onkC           --------------------------------------------------------FLKAASDPAVWKVV
3d31C           ----------------------------------------------------------------------
2r6gF           ----------------------------------------------------------------------
3fh6F           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIVAGVAYLFVYGSQGLFGPLLD
2onkC           LTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSF--
3d31C           ----------------------YILARFDFPGKRLVESIIDVPVVVPHTVAGIALLTVFGSRGLIGEPLE
2r6gF           --TVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIF------KGLFNQSFG
3fh6F           --TVVFSLITVFLTVAVGMVLACLVQWEALRGKAVYRVLLILPYAVPSFISILIF------KGLFNQSFG


                         +         .         .         .         .         *         .:210
query           QLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDEEEAAVTLGAGGFATFFRVTLPNIRWAMLYG
2onkC           -SPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAG
3d31C           SY-IQFRDALPGIVVAMLFVSMPYLANSAREGFKSVDPRLENAARSLGAPLWKAFFFVTLPLSARYLLIG
2r6gF           EINM-MLSALFGVIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFF--------------
3fh6F           EINM-MLSALFGVIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFF--------------


                         .         .         .         +         .         .         .:280
query           AILCNARVLGEFGAVSVVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2onkC           AIMSWARGISEFGAVVVIA---------------------------------------------------
3d31C           SVMTWARAISEFGAVVILA---------------------------------------------------
2r6gF           ----------------------------------------------------------------------
3fh6F           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxx
2onkC           -------
3d31C           -------
2r6gF           -------
3fh6F           -------