[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38720.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1mpyA.bssp"
#ERROR : Can't open dsspfile "3ghjA.bssp"
#ERROR : Can't open dsspfile "1zswA.bssp"

## Summary of PDB Search
:180
    2e-05  44%  1mpyA  [d.32.1 - d.32.1] CATECHOL 2,3-DIOXYGENASE
    4e-05  30%  3ghjA  [x.x.x] PUTATIVE INTEGRON GENE CASSETTE PROTEIN
    1e-04  27%  1zswA  [x.x.x] GLYOXALASE FAMILY PROTEIN
:180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
1mpyA           ----------------------------------------------------------------------
3ghjA           --IKGLFEVAVKVKNLEKSSQFYTEILGFEA-GLLDSAR--------RWNFLWVSGRAGVVL--------
1zswA           -EIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPS------MYHLFYTGSPGTELSFFEI---


                         .         .         *         .         .         .         .:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
1mpyA           --------------HVSFHLETWEDLLRAADLISMTDTSIIGPTRHTHGKTIYFFDPSGNRNEV------
3ghjA           -----QEEKENWQQHFSFRVEKSE-IEPLKKALESKGVSVHGPVNQEWQASLYFADPNGHALEFTA----
1zswA           PLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFEDAEGLRLVLL-----


                         +         .         .         .         .         *         .:210
query           PQQLAQMKDVAHAMVDEWAETKKPPRHxxxxxxxxxxxxx
1mpyA           ----------------------------------------
3ghjA           ----------------------------------------
1zswA           ---VSNGEKVEH--WETWEKSEVPAKH-------------