[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38755.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"

## Summary of PDB Search
:253
    2e-34  32%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    3e-34  31%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    4e-34  32%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    9e-28  35%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-26  33%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    6e-26  32%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    6e-26  32%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-25  28%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    2e-25  28%  2oukB  [x.x.x] PROTEIN ARTP
    4e-25  34%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    2e-24  32%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    3e-24  32%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    3e-23  30%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-23  30%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-22  28%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-22  28%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-22  28%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-22  27%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    3e-22  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    4e-22  27%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-22  27%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-21  31%  1ji0A  [c.37.1] ABC TRANSPORTER
    2e-21  29%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    1e-20  31%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  31%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-20  29%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-20  33%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    1e-19  32%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-19  32%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-19  32%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-19  27%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    2e-18  28%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-18  30%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    2e-18  30%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-18  30%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-18  29%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-18  29%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-18  30%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-17  27%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    1e-17  27%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-17  29%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-17  29%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-17  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-16  30%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    1e-15  27%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-15  32%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    2e-15  28%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    5e-15  30%  2d2fA  [x.x.x] SUFC PROTEIN
    7e-15  26%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-15  26%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-14  29%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-14  31%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-14  26%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    7e-14  28%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-14  28%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-14  25%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-13  25%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-13  26%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-13  25%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-13  26%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-13  27%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-13  27%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-13  25%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-13  25%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    7e-12  30%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-11  25%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    1e-11  22%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    2e-11  27%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-11  27%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-11  31%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-11  24%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-10  26%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-10  27%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-09  27%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-09  28%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09  26%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  30%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    2e-09  29%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-09  27%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-09  23%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    1e-08  26%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  26%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  34%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-08  34%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-08  34%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-08  34%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-08  34%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    4e-08  25%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  25%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-08  25%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-08  29%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-08  29%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-08  25%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  26%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  27%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  25%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    1e-07  26%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  25%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  28%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-07  28%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-07  29%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    3e-07  29%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    3e-07  28%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  27%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-07  27%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-07  30%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    7e-07  30%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    7e-07  30%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    7e-07  28%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-07  25%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-06  25%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-06  26%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  26%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  26%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  26%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  25%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  25%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-06  25%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  32%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-05  31%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MALLEISDLSKTFGGVLAVQNVSFSVDQGIVYSVIGPNGAGKTTLFNLITGIYTPCDGEIRLGGELVSGL
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1gajA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1g9xA           MEILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
2yyzA           ---IRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDI
3dhwC           --MIKLSNITKVFHQIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTL
1z47B           -------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
1z47A           -------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL
2oljA           LQMIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXXXXXXXXXNLKAKD
2oukB           --MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXXXXXXXXXNLKAKD
1g291           MAGVRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADF
2it1A           MVEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
2it1B           ---IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTEL
1oxvA           MVRIIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASI
1oxsC           MVRIIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASI
3fh6A           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awoA           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awnB           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1q12A           ---VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLV
2r6gB           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2r6gA           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
1ji0A           --VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
3d31A           --MIEIESLSRKWKN-FSLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDL
1l2tB           --MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
1l2tA           --MIKLKNVTKTYKMIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDL
2pcjA           --ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYT
1v43A           MVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYL
2yz2B           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
2yz2A           -----------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGY
1f3oA           ---IKLKNVTKTYKGIYALKNVNLNIKEGEFVS-IGPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDL
3gfoA           --ILKVEELNYNYSGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNK-----
1oxxK           MVRIIVKNVSKVFGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASI
1mt0A           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ff7A           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
1vplA           ------------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE-
2fgkA           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ffbA           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3b5jA           ------------------LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
3fvqB           -AALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSK
3fvqA           -AALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSK
1xefA           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2ffaA           ------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA
2awoC           ---------------VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2onkA           --------------------NVDF--EMGRDYCVLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPL
2ixfD           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2d62A           -AEVKLINIWKRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLVAD-
1pf4A           ---VDVKDVTFTYQGKEALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
2d2fA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILEL
2ixfC           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixfA           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2awnC           ---------------VTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL------------------
2d2eA           ---LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILEL
2hydA           ------------------LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDF
1mv5D           ------------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
1mv5A           ------------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNI
1jj7A           --LVQFQDVSFAYPNVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQY
2ixeA           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2nq2D           -----------------AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEV--------
2ixgA           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2ixeD           --LVKFQDVSFAYPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY
2nq2C           -------------------QQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQSI--GF
3bk7A           --LVEYPRLVKDYGS-FKLEVEPGEIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEW--DLTVAY
3g60A           ------------------LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
3g5uA           ------------------LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQL
1yqtA           -------------------------IKKGEVIGIVGPNGIGKTTFVKL-AGVEEPTEGKIEW--DLTVAY
2ghiD           ---IEFSDVNFSYHRTL--KSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFY-DAEGDIKIGGKNVNKY
2ghiA           ------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKY
2zu0C           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2d3wA           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2awnA           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2ghiC           ------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFY-DAEGDIKIGGKNVNKY
2ihyB           --LIQLDQIGRKQGKTI-LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKVG
2d3wD           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2ihyA           --LIQLDQIGRKQGKTI-LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK--PGY
2d3wB           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2pzgA           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2pjzA           --MIQLKNVGITLSGKFSLENINLEVN-GEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFINGMEVRKI
2d3wC           --MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGDYEVTGGTVEFKGKDLLAL
2pzgB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2ghiB           ------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFY-DAEGDIKIGGKNVNKY
2pzeB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2pzeA           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmiE           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1xmiC           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1xmiA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2awoD           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2awnD           -ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT
2pzfA           -----MENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1xmiD           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1xmiB           ----ELFEKAKSFSGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1sgwA           ---LEIRDLSVGYDKPV-LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPIT--
2pzfB           -------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2bboA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2ix3A           -------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIAN-------------------
2iwhB           -------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIAN-------------------
2bbtA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2bbsA           --------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2bbtB           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2ix8A           -------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANG---QVDG------------
2iw3B           -------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANG---QVDG------------
2iw3A           -------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANG---QVDG------------
2bbsB           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
2cbzA           ------------------LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSV--AY
1xmjA           ------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRI----
1r0xB           --LLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0xA           --LLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1xf9B           --LLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1xf9A           --LLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1xfaA           --LLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r10A           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0zD           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0zC           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0zB           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0zA           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0xD           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0xC           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0wC           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0wB           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1r0wA           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1q3hD           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1q3hC           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1q3hB           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1q3hA           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1xf9D           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
1xf9C           ------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFC
3b60A           ---LEFRNVTFTYPGVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH---DL
1z2rA           ----EFRNVTFTYPGVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH---DL


                         .         .         *         .         .         .         .:140
query           APHQLARKGMGRTFQNLQICMNMTAIENVMVGGHLSLDRNLVKSMLRFPSLRRADAVLREHAAELMVYVG
1g6hA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLI-GEICPGESPLNSLFYKKWIPKEEEMV-EKAFKILEFLK
1gajA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLI-GEINPGESPLNSLFYKKWIPKEEEMV-EKAFKILEFLK
1g9xA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLI-GEINPGESPLNSLFYKKWIPKEEEMV-EKAFKILEFLK
2yyzA           PPKY---REVGMVFQNYALYPHMTVFENI-----------------AFP--LRARRISKDEVEKRVVEIA
3dhwC           SESELARRQIGMIFQHFNLLSSRTVFGNVAL--PLELD-NTPKD------------EVKRRVTELLSLVG
1z47B           PPQ---KRNVGLVFQNYALFQHMTVYDNVSFG---LREKRVPKDEM--------DARVR----ELLRFMR
1z47A           PPQ---KRNVGLVFQNYALFQHMTVYDNVSFG---LREKRVPKDEM--------DARVR----ELLRFMR
2oljA           TNLNKVREEVGMVFQRFNLFPHMTVLNNI----------TLAPMKVRKWPREKAEA----KAMELLDKVG
2oukB           TNLNKVREEVGMVFQRFNLFPHMTVLNNI----------TLAPMKVRKWPREKAEA----KAMELLDKVG
1g291           VPPK--DRDIAMVFQSYALYPHMTVYDNI-----------AFPLKLRKVPRQEIDQRVRE-VAELL---G
2it1A           PPKD---RNVGLVFQNWALYPHMTVYKNI-----------AFPLELRKAPREEIDKKVREVAKMLHI---
2it1B           PPKD---RNVGLVFQNWALYPHMTVYKNI-----------AFPLELRKAPREEIDKKVREVAKMLHI---
1oxvA           VPPEDRKIGM--VFQTWALYPNLTAFENI-----------------AFPNMKMSKEEIRKRVEEVAKILD
1oxsC           VPPEDRKIGM--VFQTWALYPNLTAFENI-----------------AFPNMKMSKEEIRKRVEEVAKILD
3fh6A           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
2awoA           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
2awnB           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
1q12A           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
1b0uA           RDKRLLRTRLTMVFQHFNLWSHMTVLENVM------------EAPIQVLGLSKHDA--RERALKYLAKVG
2r6gB           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
2r6gA           PP---AERGVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKK--EVINQRVNQVAEVLQ
1ji0A           PAHVINR-GIALVPEGRRIFPELTVYEN--LGAYNRKDKEGIKRDLEW---------------IFSLFPR
3d31A           SPE---KHDIAFVYQNYSLFPHMNVKKNLEFG-------------MRMKKIKDPKRVL-DTARDLKI---
1l2tB           DDDELTRDKIGFVFQQFNLIPLLTALENV----ELPLIFKYRGAMSGEERRKRALECLKMAELE------
1l2tA           DDDELTRDKIGFVFQQFNLIPLLTALENV----ELPLIFKYRGAMSGEERRKRALECLKMAELE------
2pcjA           NEKELSNRKLGFVFQFHYLIPELTALENVIV------------PMLKMGKPKKE---AKERGEYLLSELG
1v43A           PPKD----------RNIS-----------MVFQHMTVYENIAFPLKKFPK-DEIDKRVR-WAAELL---Q
2yz2B           E----IRRNIGIAFQEDQFFAERVFDEVAFAVKNFYPDRDPV------PLVKKA-----------MEFVG
2yz2A           E----IRRNIGIAFQEDQFFAERVFDEVAFAVKNFYPDRDPV------PLVKKA-----------MEFVG
1f3oA           DDDELTRDKIGFVFQQFNLIPLLTALENVELP-------------LIFKYRGASGEERRKRALECLKAEL
3gfoA           -PIDYSRKGIMKLRESIGIVFQDP--DNQLFSASVYQDVSFGAVNMKLP-----EDEIRKRVDNALKRTG
1oxxK           VPPEDRKIGM--VFQTWALYPNLTAFENI-----------------AFPNMKMSKEEIRKRVEEVAKILD
1mt0A           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
2ff7A           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
1vplA           EPHEV-RKLISYLPEEAGAYRNMQGIEYLFVAGFYASSSSEIEEMV-------------ERATEI---AG
2fgkA           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
2ffbA           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
3b5jA           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
3fvqB           NTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYGGRTAQERQRIEAMLEL--------------------TG
3fvqA           NTNLPVRRRLGYLVQEGVLFPHLTVYRNIAYGGRTAQERQRIEAMLEL--------------------TG
1xefA           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
2ffaA           DPNWL-RRQVGVVLQD-NVLLNRSIIDNILANPGMSVEKVIYAAKL---------AGAHDFISELR--EG
2awoC           PP---AERGVGM----------------VALYPHLSVAENM-SFGLKLAGAKK--EVINQRVNQVAEVLQ
2onkA           PPE---RRGIGFVPQDYALFPHLSVYRNIAYG-------------LXXXXXXXXXXXXXXMAEKL----G
2ixfD           DHHYLHTQ--------------VAAVGQLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFISQG
2d62A           -----PEKGVFVPPKERDVAV----FQSYALYPHTVYDNIAFPLKLRKVPKQEIDKRVRE-VAEL----G
1pf4A           KLTNL-RRHFALVSQNVHL-FNDTIANNIAYAAEGEYTREQIEQAAR-----------QAHAMEFIENMG
2d2fA           SPDERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEF-WTKVKKALELLDWDESY------
2ixfC           DHHYLHTQ------------VAAVGQEPLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFISQG
2ixfA           DHHYLHTQ------------VAAVGQEPLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFISQG
2awnC           --------GVGMVFQSYALYPHLSVAENMSFG-------------LKLAGAKKE--VINQRVNQVAEVLQ
2d2eA           SPDERARKGLFLAFQ-------YPVVPGVTIANFLRL--ALQAKLGREVGVAEFWTKVKK-ALELLDWD-
2hydA           LTGSL-RNQIGLVQQD-NILFSDTVKENILLGRPTATDEEVVE----------AAKMANAHDFIMNLPQG
1mv5D           SLENW-RSQIGFVSQDSAI-MAGTIRENLTYG----LEGDYTEDLWQVLDLAFARSFVENMPDQLNTEVG
1mv5A           SLENW-RSQIGFVSQDSAI-MAGTIRENLTYG----LEGDYTEDLWQVLDLAFARSFVENMPDQLNTEVG
1jj7A           -EHRYLHRQVAAVGQEPQVFGR-------------SLQENIAYGLTQKPTMEEITAAAVKSGAHSFISQG
2ixeA           DHHYLHTQ------------VAAVGQEPLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFISQG
2nq2D           ------YQSIGFVPQFFSSPFAYSVLDIVLMGRSTHIN--------TFAKPKSHD---YQVAMQALDYLN
2ixgA           DHHYLHTQ------------VAAVGQEPLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFISQG
2ixeD           DHHYLHTQ--------------VAAVGPLLFG--RSFRENIAYGLTRTPTMEEITAVAMESGAHDFI-SG
2nq2C           VP------------QFFSSPFAYSVLDIVLMGRSTHINT--------FAKPKSHDYQV---AMQALDYLN
3bk7A           KPQYIKAEYEGTVYELLS-----------------KIDSSKLNSNF--------------YKTELLKPLG
3g60A           NV-QWLRAQLGIVSQE-PILFDCSIAENIAYGDN--------SRVVSYEEIVRAAKEANIHQFIDSLPDK
3g5uA           NV-QWLRAQLGIVSQE-PILFDCSIAENIAYGDN--------SRVVSYEEIVRAAKEANIHQFIDSLPDK
1yqtA           KPQYIKADYEGTVYELLS-----------------KIDASKLNSNF--------------YKTELLKPLG
2ghiD           NRNSI-RSIIGIVPQD-TILFNETIKYNILYGKLDATDEEVIKA-----------------TKSAQLYDF
2ghiA           NRNSI-RSIIGIVPQDT-ILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKW---------
2zu0C           SPEDRAGEGI---FMAFQYPVEIPGVSNQF---FLQTALNAVRSYRGQETLDRFDDLMEEKIALLKMPED
2d3wA           SPEDRAGEGI---FMAFQYPVEIPGVSNQF---FLQTALNAVRSYRGQETLDRFDDLMEEKIALLKMPED
2awnA           PP---AERGVGMVFQSYAL-----EVINQRV--------NQVAEVL---------AIGRTLVAEPSVFLL
2ghiC           NRNSI-RSIIGIVPQD-TILFNETIKYNILY-GKLDATEEVIKA---------------TKSAQLYDFIA
2ihyB           YSAETVRQHIGFVSHSL--------LEKFQEGERV-IDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVG
2d3wD           SPEDRAGEGI---FMAFQYPVEIPGVSNQF---FLQTALNAVRSYRGQETLDRFDDLMEEKIALLKMPED
2ihyA           SA-ETVRQHIGFVSHSLEKFQEGERVIDVVISGAI-------------------DDEIRNEAHQLLKLVG
2d3wB           SPEDRAGEGI---FMAFQYPVEIPGVSNQF---FLQTALNAVRSYRGQETLDRFDDLMEEKIALLKMPED
2pzgA           -----------SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
2pjzA           RNYIRYSTNLPEAYE-----IGVTVNDIVYLYEELGLDRDLFLEMLK--ALKLGEEILRRKLYKL-----
2d3wC           SPEDRAGEGI---FMAFQYPVEIPGVSNQF---FLQTALNAVRSYRGQETLDRFDDLMEEKIALLKMPED
2pzgB           -----------SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQL---EEDISKFAEKDNIVLG
2ghiB           NRNSI-RSIIGIVPQD-TILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDT-------
2pzeB           -----------SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
2pzeA           -----------SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
1xmiE           -----------SFCSQFSWIMPGTIKENIIAG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
1xmiC           -----------SFCSQFSWIMPGTIKENIIAG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
1xmiA           -----------SFCSQFSWIMPGTIKENIIAG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
2awoD           PP---AERGVG-----------------------------------------------------------
2awnD           PP---AERGVG-----------------------------------------------------------
2pzfA           -----------SFCSQFSWIMPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAEKD--------
1xmiD           -----------SFCSQFSWIMPGTIKENIIAG--VSYDEYRYRSVIKACQL---EEDISKFAEKDNIVLG
1xmiB           -----------SFCSQFSWIMPGTIKENIIAG--VSYDEYRYRSVIK--------------------ACQ
1sgwA           -------KVKGKIF---------FLPEEIIVPRKISVE-DYLKAVASLYGVKVNKNEIMD-ALESVEVLD
2pzfB           -----------SFCSQFSWIMPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAEKD--------
2bboA           -----------SFCSQFSWIMPGTIKENIIFG--VSYDEYRYRSVIKACQLEEDISKFAEKD--------
2r6fB           ---------------------------------------------------------------ETLYDVG
2r6fA           ---------------------------------------------------------------ETLYDVG
2ix3A           --------GQVDGFPTQEECRTVY-VEHDIDGTHSDT------SVLDF--VFESGVGTKEAIKDKLIEFG
2iwhB           --------GQVDGFPTQEECRTVY-VEHDIDGTHSDT------SVLDF--VFESGVGTKEAIKDKLIEFG
2bbtA           ----------SFCSQNSWI-MPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAE--KDNIVLGG
2bbsA           ----------SFCSQNSWI-MPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLI---
2bbtB           ----------SFCSQNSWI-MPGTIKENII---GVSYDEYRYRSVIKACQL---EEDISKFAEKDNIVLG
2ix8A           -------------FPTQEECRTVY-VEHDIDGTHSDT------SVLDF--VFESGVGTKEAIKDKLIEFG
2iw3B           -------------FPTQEECRTVY-VEHDIDGTHSDT------SVLDF--VFESGVGTKEAIKDKLIEFG
2iw3A           -------------FPTQEECRTVY-VEHDIDGTHSDT------SVLDF--VFESGVGTKEAIKDKLIEFG
2bbsB           ----------SFCSQNSWI-MPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAE--KDNIVLGG
2cbzA           VPQQ-------------AWIQNDSLRENILFGCQLEYYRSVIQACALLPDLE-------------ILPSG
1xmjA           -----------SFCSQFSWIMPGTIKENII---GVSYDEYRYRSVIKACQLEEDISKFAEKD--------
1r0xB           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0xA           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1xf9B           SQFSWIMPG--------------TIKENIISG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1xf9A           SQFSWIMPG--------------TIKENIISG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1xfaA           SQFSWIMPG--------------TIKENIIRG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r10A           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0zD           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0zC           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0zB           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0zA           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0xD           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0xC           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0wC           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0wB           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1r0wA           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1q3hD           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1q3hC           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1q3hB           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1q3hA           SQFSWIMPG--------------TIKENIIFG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1xf9D           SQFSWIMPG--------------TIKENIISG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
1xf9C           SQFSWIMPG--------------TIKENIISG--VSYDEYRYKSVVKACQLQQDITKFAEQD--------
3b60A           REYTLARNQVALVSQNVHL-FNDTVANNI-----------------------------------------
1z2rA           REYTLARNQVALVSQNVHL-FNDTVANNI-----------------------------------------


                         +         .         .         .         .         *         .:210
query           LEAYLNSEASAMSYGALKRLEIARALAAKPRILFLDEPAAGFNPKETAEIDNLVRKIADSGITVVLVEHD
1g6hA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHR
1gajA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHR
1g9xA           LSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHR
2yyzA           IDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANMRAEIKHLQQEL---GITSVYVTHD
3dhwC           LGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDIRRLGLTILLITHE
1z47B           LESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHD
1z47A           LESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHD
2oljA           LKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHE
2oukB           LKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHE
1g291           LTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKMRAELKKLQRQL---GVTTIYVTHD
2it1A           -DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVAELKRLQKELGITTVYVTHD
2it1B           -DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVAELKRLQKELGITTVYVTHD
1oxvA           IHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHD
1oxsC           IHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHD
3fh6A           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2awoA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2awnB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
1q12A           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
1b0uA           IDERAQGKYPVLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHE
2r6gB           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2r6gA           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
1ji0A           LKERLKQLGGTLS-GGEQQLAIGRAL-SRPKL--LDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQN
3d31A           -EHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLKKNKLTVLHITHD
1l2tB           -ERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHD
1l2tA           -ERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLEEDGKTVVVVTHD
2pcjA           LGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHE
1v43A           IEELLNRYPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKMRAEIKKLQQKLK---VTTIYVTHD
2yz2B           LDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHD
2yz2A           LDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHD
1f3oA           EERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHD
3gfoA           IEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLVEMQKELGXXXXXXXXX
1oxxK           IHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHD
1mt0A           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHR
2ff7A           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHR
1vplA           LGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHN
2fgkA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC-KGRTVIIIAHR
2ffbA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC-KGRTVIIIAHR
3b5jA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHR
3fvqB           ISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAALRANGKSAVFVSHD
3fvqA           ISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIEDMIAALRANGKSAVFVSHD
1xefA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAAR
2ffaA           YNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAAR
2awoC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2onkA           IAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVREFDVPILHVTHD
2ixfD           YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQ
2d62A           LTELLNRKPRELSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKKRAELKKLQRQL---GVTTIYVTHD
1pf4A           LDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLVIAHR
2d2fA           LSRYLN---EGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHY
2ixfC           YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQ
2ixfA           YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQ
2awnC           LAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2d2eA           -ESYL---SRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHY
2hydA           YDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALD-LESESIIQEALDVLSKDRTTLIVAHR
1mv5D           ------ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLD----SESESMVQKALDSGRTTLVIAHR
1mv5A           ------ERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLD----SESESMVQKALDSGRTTLVIAHR
1jj7A           YDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQ
2ixeA           YDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQ
2nq2D           LTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQ
2ixgA           YDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQ
2ixeD           FPQGYDTEVQ-LSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLITQ
2nq2C           LTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQ
3bk7A           IIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNKTALVVEHD
3g60A           YNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDK-AREGRTCIVIAHR
3g5uA           YNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDK-AREGRTCIVIAHR
1yqtA           IIDLYDREVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHD
2ghiD           IEALPKKDTIVLSGGERQRIAIARCLLKDPKIVIFDD----------SKTEYLFQKAVEDNRTLIIIAHR
2ghiA           -DTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNR-TLIIIAHR
2zu0C           L--LTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHY
2d3wA           L--LTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHY
2awnA           DEPLSNLDA---------------ALRVQMRI----------------EISRLHKRL---GRTMIYVTHD
2ghiC           LPKKWDTIVGGMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNR-TLIIIAHR
2ihyB           -SAKAQQYIGYLSTGEKQRV-IARAL-GQPQVLILDEPAAGFIAREXXXXXXXXXXXXYPTLAIYVTHFI
2d3wD           L--LTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGKRSFIIVTHY
2ihyA           -SAKAQQYIGYLSTGEKQRV-IARALG-QPQVLILDEPAAGFIAREXXXXXXXXXXXXYPTLAIYVTHFI
2d3wB           L--LTRSVNVGFSGGEKKRNDILQMAVLEPELCILDE-------SDSLDIDALVNSLRDGKRSFIIVTHY
2pzgA           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2pjzA           ------------SAGQSVLVRTSLALASQPEIVGLDEP---FENVDAARRHVISRYIKEYGKEGILVTHE
2d3wC           L--LTRSVNVGFSGGEKKRNDILQMAVLEPELCILD---------ESDDIDALVNSLRDGKRSFIIVTHY
2pzgB           I---------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2ghiB           ----IVGNKMKLSGGERQRIAIARCLLKDPKIVIFDEATS------DSKTEYLFQKAVEKNRTLIIIAH-
2pzeB           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2pzeA           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2vf8B           ----LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHK
2vf8A           ----LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHK
2vf7C           ----LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHK
2vf7B           ----LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHK
2vf7A           ----LGQPATELSGGEAQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHK
1xmiE           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1xmiC           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1xmiA           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2awoD           ----------------------------EPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2awnD           ----------------------------EPSVFLLDEPLAALRVQMRIEISRLHKRL---GRTMIYVTHD
2pzfA           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1xmiD           --------EITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1xmiB           LEEDISKIVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1sgwA           LKKKLGE----LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVKSILEILKEKGIVII-----
2pzfB           -NIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2bboA           -NIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2r6fB           LGYKLGQPATTLSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN
2r6fA           LGYKLGQPATTLSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN
2ix3A           FDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPT---NHLDTVNVAWLVNYLNTCGITSITISHD
2iwhB           FDEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPT---NHLDTVNVAWLVNYLNTCGITSITISHD
2bbtA           I---------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2bbsA           ----------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2bbtB           I---------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2ix8A           FTDEI-APISALS-GGWKKLALARAVLRNADILLLDEPT---NHLDTVNVAWLVNYLNTCGITSITISHD
2iw3B           FTDEI-APISALS-GGWKKLALARAVLRNADILLLDEPT---NHLDTVNVAWLVNYLNTCGITSITISHD
2iw3A           FTDEI-APISALS-GGWKKLALARAVLRNADILLLDEPT---NHLDTVNVAWLVNYLNTCGITSITISHD
2bbsB           I---------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
2cbzA           DRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENV--IGPKGMTRILVTHS
1xmjA           -NIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIESCVCKLM-ANKTRILVTSK
1r0xB           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0xA           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1xf9B           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1xf9A           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1xfaA           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r10A           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0zD           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0zC           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0zB           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0zA           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0xD           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0xC           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0wC           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0wB           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1r0wA           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1q3hD           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1q3hC           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1q3hB           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1q3hA           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1xf9D           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
1xf9C           -NTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVTEEQVFESCVCKLM-ANKTRILVTSK
3b60A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MKMVMNISDRILVLNYGRKLTEGSARDVRDNPEVIAAYLGTAA
1g6hA           LDIVLNYIDHLYVMFNGQIIAEGEIKNVLSDPKVVEIYIG---
1gajA           LDIVLNYIDHLYVMFNGQIIAEGEIKNVLSDPKVVEIYIG---
1g9xA           LDIVLNYIDHLYVMFNGQIIAEGEIKNVLSDPKVVEIYIG---
2yyzA           QAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKFVASFIG---
3dhwC           MDVVKRICDCVAVISNGELIEQDTVSEVFSHPK----------
1z47B           QEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTVASFIG---
1z47A           QEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTVASFIG---
2oljA           MGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQ----------
2oukB           MGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQ----------
1g291           QVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPTFVAGFIGS--
2it1A           QAEALAMADRIAVIREGEILQVGTPDEVYYKPKFVGGFLG---
2it1B           QAEALAMADRIAVIREGEILQVGTPDEVYYKPKFVGGFLG---
1oxvA           PADIFAIADRXXXXXXXXXXXXXXPEDLYDNP-----------
1oxsC           PADIFAIADRXXXXXXXXXXXXXXPEDLYDNP-----------
3fh6A           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2awoA           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2awnB           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
1q12A           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
1b0uA           MGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQ----------
2r6gB           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2r6gA           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
1ji0A           ALGALKVAHYGYVLETGQIVLEGKASELLDN-EVRKAYLGVA-
3d31A           QTEARIMADRIAVVMDGKLIQVGKPEEIFEKPVEVASFVG---
1l2tB           IN-VARFGERIIYLKDGEVEREEKLR-----------------
1l2tA           IN-VARFGERIIYLKDGEVEREEKLR-----------------
2pcjA           RELA-ELTHRTLEMKDGKVVGE---------------------
1v43A           QVEAMTMGDRIAVMNRGQLLQIGSPTEVRPNSVFVATFIG---
2yz2B           IETVINHVDRVVVLEKGKKVFDGT-------------------
2yz2A           IETVINHVDRVVVLEKGKKVFDGT-------------------
1f3oA           IN-VARFGERIIYLKDGEVEREEKLR-----------------
3gfoA           XXXVPLYCDNVFVMKEGRVILQGNPKEVFAEKEVI--------
1oxxK           PADIFAIADRXXXXXXXXXXXXXXPEDLYDNP-----------
1mt0A           LSTVKN-ADRIIVMEKGKIVEQG--------------------
2ff7A           LSTVKN-ADRIIVMEKGKIVEQG--------------------
1vplA           MLEVEFLCDRIALIHNGTIVETGTVEELKE-------------
2fgkA           LSTVKN-ADRIIVMEKGKIVEQG--------------------
2ffbA           LSTVKN-ADRIIVMEKGKIVEQG--------------------
3b5jA           LSTVKN-ADRIIVMEKGKIVEQG--------------------
3fvqB           REEALQYADRIAVMKQGRILQTASPHELYRQPADLDAAL----
3fvqA           REEALQYADRIAVMKQGRILQTASPHELYRQPADLDAAL----
1xefA           LSTVKN-ADRIIVMEKGKIVEQG--------------------
2ffaA           LSTVKN-ADRIIVMEKGKIVEQG--------------------
2awoC           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2onkA           LIEAAMLADEVAVMLNGRIVEKGKLKEL---------------
2ixfD           LSLAER-AHHILFLKEGSVCEQGT-------------------
2d62A           --QVEATGDRIAV-NKGELQQVGTPDEVYYKPTFVAGFIGS--
1pf4A           LSTIEQ-ADEILVVDEGEIIERGRHAD----------------
2d2fA           QRILNYIQDKVHVMMDGRVVATG--------------------
2ixfC           LSLAER-AHHILFLKEGSVCEQGT-------------------
2ixfA           LSLAER-AHHILFLKEGSVCEQGT-------------------
2awnC           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2d2eA           QRILNYIQDKVHVMMDGRVVATG--------------------
2hydA           LSTITH-ADKIVVIENGHIVETGTHREL---------------
1mv5D           LSTIVD-ADKIYFIEKGQITGSGKHNELVATHPLYAKYV----
1mv5A           LSTIVD-ADKIYFIEKGQITGSGKHNELVATHPLYAKYV----
1jj7A           HLSLVEQADHILFLEGG--------------------------
2ixeA           QLSLAERAHHILFLKEGSVCEQGT-------------------
2nq2D           PNQVVAIANKTLLLN-KQNFKFGETRNILTSENLTALF-----
2ixgA           QLSLAERAHHILFLKEGSVCEQGT-------------------
2ixeD           QLSLAERAHHILFLKEGSVCEQGT-------------------
2nq2C           PNQVVAIANKTLLLN-KQNFKFGETRNILTSENLTALF-----
3bk7A           VLMIDYVSDRLIVFRHGRALPPMGMRE----------------
3g60A           LSTIQN-ADLIVVIQNGKVKEHGT-------------------
3g5uA           LSTIQN-ADLIVVIQNGKVKEHGT-------------------
1yqtA           V-LIDYVSDRLVFEKYGRALPPG--------------------
2ghiD           LSTISS-AESIILLNKGKIVEKGTHKDL---------------
2ghiA           LSTISS-AESIILLNKGKIVEKGTHKDL---------------
2zu0C           QRILDYIKDYVHVLYQGRIVKSG--------------------
2d3wA           QRILDYIKDYVHVLYQGRIVKSG--------------------
2awnA           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2ghiC           LSTISS-AESIILLNKGKIVEKGTHKDL---------------
2ihyB           EEITANFS-KILLLKDGQSIQQGAVEDI---------------
2d3wD           QRILDYIKDYVHVLYQGRIVKSG--------------------
2ihyA           EEITANFS-KILLLKDGQSIQQGAVEDI---------------
2d3wB           RILDYIKPDYVHVLYQGRIVKSG--------------------
2pzgA           MEHLKK-ADKILILHEGSSYFYGTFSELQ-NPDFSSKLMG---
2pjzA           LDML---------------------------------------
2d3wC           QRILDYIKDYVHVLYQGRIVKSG--------------------
2pzgB           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2ghiB           --RTISSAESIILLNKGKIVEKGTHKDL---------------
2pzeB           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2pzeA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2vf8B           MQVVA-ASDWVLDIDGGRLVAQGTPAEVAQAASVTAPYLRAA-
2vf8A           MQVVA-ASDWVLDIDGGRLVAQGTPAEVAQAASVTAPYLRAA-
2vf7C           MQVVA-ASDWVLDIDGGRLVAQGTPAEVAQAASVTAPYLRAA-
2vf7B           MQVVA-ASDWVLDIDGGRLVAQGTPAEVAQAASVTAPYLRAA-
2vf7A           MQVVA-ASDWVLDIDGGRLVAQGTPAEVAQAASVTAPYLRAA-
1xmiE           MEHLKK-ADKILILHEGSSYFYGTFSELQNQPDFSSKLMG---
1xmiC           MEHLKK-ADKILILHEGSSYFYGTFSELQNQPDFSSKLMG---
1xmiA           MEHLKK-ADKILILHEGSSYFYGTFSELQNQPDFSSKLMG---
2awoD           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2awnD           QVEAMTLADKIVVLDAGRVAQVGKPLELYHYPRFVAGFIGS--
2pzfA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
1xmiD           MEHLKK-ADKILILHEGSSYFYGTFSELQNQPDFSSKLMG---
1xmiB           MEHLKK-ADKILILHEGSSYFYGTFSELQNQPDFSSKLMG---
1sgwA           -------------------------------------------
2pzfB           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2bboA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2r6fB           LDVI---------------------------------------
2r6fA           LDVI---------------------------------------
2ix3A           SVFLDNVCE--YIINYGLKL-----------------------
2iwhB           SVFLDNVCE--YIINYGLKL-----------------------
2bbtA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2bbsA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2bbtB           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2ix8A           SVFLDNVCE--YIINYGLKL-----------------------
2iw3B           SVFLDNVCE--YIINYGLKL-----------------------
2iw3A           SVFLDNVCE--YIINYGLKL-----------------------
2bbsB           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
2cbzA           MSYLPQV-DVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYA
1xmjA           MEHLKK-ADKILILHEGSSYFYGTFSELQN-------------
1r0xB           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0xA           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1xf9B           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1xf9A           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1xfaA           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r10A           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0zD           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0zC           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0zB           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0zA           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0xD           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0xC           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0wC           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0wB           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1r0wA           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1q3hD           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1q3hC           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1q3hB           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1q3hA           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1xf9D           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
1xf9C           MEHLRK-ADKILILHQGSSYFYGTFSELQSRPDFSSKLMG---
3b60A           -------------------------------------------
1z2rA           -------------------------------------------