[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38782.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3h81A.bssp"
#ERROR : Can't open dsspfile "3h81B.bssp"
#ERROR : Can't open dsspfile "2hw5A.bssp"
#ERROR : Can't open dsspfile "1ey3A.bssp"
#ERROR : Can't open dsspfile "1dubB.bssp"
#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "2dubD.bssp"
#ERROR : Can't open dsspfile "1mj3A.bssp"
#ERROR : Can't open dsspfile "2dubE.bssp"
#ERROR : Can't open dsspfile "2dubA.bssp"
#ERROR : Can't open dsspfile "2qq3I.bssp"
#ERROR : Can't open dsspfile "2qq3C.bssp"
#ERROR : Can't open dsspfile "2pbpA.bssp"
#ERROR : Can't open dsspfile "2vx2F.bssp"
#ERROR : Can't open dsspfile "2vx2E.bssp"
#ERROR : Can't open dsspfile "2vx2A.bssp"
#ERROR : Can't open dsspfile "2vx2I.bssp"
#ERROR : Can't open dsspfile "2vx2H.bssp"
#ERROR : Can't open dsspfile "2vx2G.bssp"
#ERROR : Can't open dsspfile "2vx2B.bssp"
#ERROR : Can't open dsspfile "2zqqF.bssp"
#ERROR : Can't open dsspfile "1hzdB.bssp"
#ERROR : Can't open dsspfile "1hzdA.bssp"
#ERROR : Can't open dsspfile "2iexB.bssp"
#ERROR : Can't open dsspfile "2iexA.bssp"
#ERROR : Can't open dsspfile "2ppyE.bssp"
#ERROR : Can't open dsspfile "2ppyC.bssp"
#ERROR : Can't open dsspfile "2ppyB.bssp"
#ERROR : Can't open dsspfile "2ppyA.bssp"
#ERROR : Can't open dsspfile "3gowF.bssp"
#ERROR : Can't open dsspfile "3hrxF.bssp"
#ERROR : Can't open dsspfile "3gowA.bssp"
#ERROR : Can't open dsspfile "1ef9A.bssp"
#ERROR : Can't open dsspfile "1ef8C.bssp"
#ERROR : Can't open dsspfile "1ef8B.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "2vreA.bssp"
#ERROR : Can't open dsspfile "2vreC.bssp"
#ERROR : Can't open dsspfile "2vreB.bssp"
#ERROR : Can't open dsspfile "2uzfB.bssp"
#ERROR : Can't open dsspfile "2uzfA.bssp"
#ERROR : Can't open dsspfile "3hinA.bssp"
#ERROR : Can't open dsspfile "3hinB.bssp"
#ERROR : Can't open dsspfile "2vssE.bssp"
#ERROR : Can't open dsspfile "2vsuE.bssp"
#ERROR : Can't open dsspfile "2vssF.bssp"
#ERROR : Can't open dsspfile "2vssC.bssp"
#ERROR : Can't open dsspfile "2vssA.bssp"
#ERROR : Can't open dsspfile "2j5iI.bssp"
#ERROR : Can't open dsspfile "2j5iG.bssp"
#ERROR : Can't open dsspfile "2j5iF.bssp"
#ERROR : Can't open dsspfile "2j5iE.bssp"
#ERROR : Can't open dsspfile "2j5iD.bssp"
#ERROR : Can't open dsspfile "2j5iC.bssp"
#ERROR : Can't open dsspfile "2j5iB.bssp"
#ERROR : Can't open dsspfile "2j5iA.bssp"
#ERROR : Can't open dsspfile "2vsuF.bssp"
#ERROR : Can't open dsspfile "2vsuD.bssp"
#ERROR : Can't open dsspfile "2vsuC.bssp"
#ERROR : Can't open dsspfile "2vsuB.bssp"
#ERROR : Can't open dsspfile "2vsuA.bssp"
#ERROR : Can't open dsspfile "3h0uC.bssp"
#ERROR : Can't open dsspfile "3h0uB.bssp"
#ERROR : Can't open dsspfile "3h0uA.bssp"
#ERROR : Can't open dsspfile "2pg8C.bssp"
#ERROR : Can't open dsspfile "2pg8A.bssp"
#ERROR : Can't open dsspfile "2np9C.bssp"
#ERROR : Can't open dsspfile "2np9B.bssp"
#ERROR : Can't open dsspfile "2np9A.bssp"
#ERROR : Can't open dsspfile "2fw2F.bssp"
#ERROR : Can't open dsspfile "2fw2E.bssp"
#ERROR : Can't open dsspfile "2fw2A.bssp"
#ERROR : Can't open dsspfile "2fw2D.bssp"
#ERROR : Can't open dsspfile "2fw2C.bssp"
#ERROR : Can't open dsspfile "3h02E.bssp"
#ERROR : Can't open dsspfile "3h02D.bssp"
#ERROR : Can't open dsspfile "3h02C.bssp"
#ERROR : Can't open dsspfile "3h02B.bssp"
#ERROR : Can't open dsspfile "3h02A.bssp"
#ERROR : Can't open dsspfile "2fw2B.bssp"
#ERROR : Can't open dsspfile "2ej5A.bssp"
#ERROR : Can't open dsspfile "1rjnB.bssp"
#ERROR : Can't open dsspfile "1wdmB.bssp"
#ERROR : Can't open dsspfile "1wdmA.bssp"
#ERROR : Can't open dsspfile "1wdlB.bssp"
#ERROR : Can't open dsspfile "1wdlA.bssp"
#ERROR : Can't open dsspfile "1wdkB.bssp"
#ERROR : Can't open dsspfile "1wdkA.bssp"
#ERROR : Can't open dsspfile "2ej5B.bssp"
#ERROR : Can't open dsspfile "1q51A.bssp"
#ERROR : Can't open dsspfile "2gtrB.bssp"
#ERROR : Can't open dsspfile "1q52K.bssp"
#ERROR : Can't open dsspfile "1q52B.bssp"
#ERROR : Can't open dsspfile "1q52A.bssp"
#ERROR : Can't open dsspfile "1q51B.bssp"
#ERROR : Can't open dsspfile "2gtrA.bssp"
#ERROR : Can't open dsspfile "2fbmB.bssp"
#ERROR : Can't open dsspfile "2fbmA.bssp"
#ERROR : Can't open dsspfile "2a7kC.bssp"
#ERROR : Can't open dsspfile "2gtrC.bssp"
#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "2a81A.bssp"
#ERROR : Can't open dsspfile "2a7kI.bssp"
#ERROR : Can't open dsspfile "2a7kH.bssp"
#ERROR : Can't open dsspfile "2a7kG.bssp"
#ERROR : Can't open dsspfile "2a7kF.bssp"
#ERROR : Can't open dsspfile "2a7kE.bssp"
#ERROR : Can't open dsspfile "2a7kD.bssp"
#ERROR : Can't open dsspfile "2a7kB.bssp"
#ERROR : Can't open dsspfile "2a7kA.bssp"
#ERROR : Can't open dsspfile "3gkbC.bssp"
#ERROR : Can't open dsspfile "3gkbB.bssp"
#ERROR : Can't open dsspfile "3gkbA.bssp"
#ERROR : Can't open dsspfile "3he2C.bssp"
#ERROR : Can't open dsspfile "3he2A.bssp"
#ERROR : Can't open dsspfile "3h02F.bssp"
#ERROR : Can't open dsspfile "1nzyC.bssp"
#ERROR : Can't open dsspfile "1nzyB.bssp"
#ERROR : Can't open dsspfile "1nzyA.bssp"
#ERROR : Can't open dsspfile "1jxzC.bssp"
#ERROR : Can't open dsspfile "1jxzB.bssp"
#ERROR : Can't open dsspfile "1jxzA.bssp"
#ERROR : Can't open dsspfile "3i47A.bssp"
#ERROR : Can't open dsspfile "1rjnA.bssp"
#ERROR : Can't open dsspfile "1rjnC.bssp"
#ERROR : Can't open dsspfile "1rjmB.bssp"
#ERROR : Can't open dsspfile "1rjmA.bssp"
#ERROR : Can't open dsspfile "1uiyA.bssp"
#ERROR : Can't open dsspfile "1szoF.bssp"
#ERROR : Can't open dsspfile "1szoD.bssp"
#ERROR : Can't open dsspfile "1szoB.bssp"
#ERROR : Can't open dsspfile "1szoA.bssp"
#ERROR : Can't open dsspfile "3g64A.bssp"
#ERROR : Can't open dsspfile "1o8uF.bssp"
#ERROR : Can't open dsspfile "1o8uC.bssp"
#ERROR : Can't open dsspfile "1o8uA.bssp"
#ERROR : Can't open dsspfile "3fduF.bssp"
#ERROR : Can't open dsspfile "3fduE.bssp"
#ERROR : Can't open dsspfile "3fduD.bssp"
#ERROR : Can't open dsspfile "3fduC.bssp"
#ERROR : Can't open dsspfile "3fduB.bssp"
#ERROR : Can't open dsspfile "3fduA.bssp"
#ERROR : Can't open dsspfile "1wz8A.bssp"
#ERROR : Can't open dsspfile "2j5sA.bssp"
#ERROR : Can't open dsspfile "2j5gE.bssp"
#ERROR : Can't open dsspfile "2j5gD.bssp"
#ERROR : Can't open dsspfile "2j5gB.bssp"
#ERROR : Can't open dsspfile "2j5gA.bssp"
#ERROR : Can't open dsspfile "3isaF.bssp"
#ERROR : Can't open dsspfile "3isaD.bssp"
#ERROR : Can't open dsspfile "3isaC.bssp"
#ERROR : Can't open dsspfile "3isaB.bssp"
#ERROR : Can't open dsspfile "3isaA.bssp"
#ERROR : Can't open dsspfile "1rjmC.bssp"
#ERROR : Can't open dsspfile "3hp0B.bssp"
#ERROR : Can't open dsspfile "3hp0A.bssp"
#ERROR : Can't open dsspfile "1xx4A.bssp"
#ERROR : Can't open dsspfile "3bptA.bssp"
#ERROR : Can't open dsspfile "1sg4C.bssp"
#ERROR : Can't open dsspfile "1sg4B.bssp"
#ERROR : Can't open dsspfile "1sg4A.bssp"

## Summary of PDB Search
:258
    3e-54  60%  3h81A  [x.x.x] ENOYL-COA HYDRATASE ECHA8
    1e-53  60%  3h81B  [x.x.x] ENOYL-COA HYDRATASE ECHA8
    1e-49  42%  2hw5A  [x.x.x] ENOYL-COA HYDRATASE
    1e-47  41%  1ey3A  [c.14.1] ENOYL-COA HYDRATASE
    1e-47  41%  1dubB  [c.14.1] 2-ENOYL-COA HYDRATASE
    1e-47  41%  1dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    2e-46  41%  2dubD  [c.14.1] 2-ENOYL-COA HYDRATASE
    4e-46  41%  1mj3A  [c.14.1] ENOYL-COA HYDRATASE, MITOCHONDRIAL
    6e-46  41%  2dubE  [c.14.1] 2-ENOYL-COA HYDRATASE
    6e-46  41%  2dubA  [c.14.1] 2-ENOYL-COA HYDRATASE
    3e-38  35%  2qq3I  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    3e-38  35%  2qq3C  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    3e-38  35%  2pbpA  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT I
    1e-26  38%  2vx2F  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-26  38%  2vx2E  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    1e-26  38%  2vx2A  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    5e-26  38%  2vx2I  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    5e-26  38%  2vx2H  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    5e-26  38%  2vx2G  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    5e-26  38%  2vx2B  [x.x.x] ENOYL-COA HYDRATASE DOMAIN-CONTAINING PROTEIN 3
    3e-24  42%  2zqqF  [x.x.x] METHYLGLUTACONYL-COA HYDRATASE
    3e-24  42%  1hzdB  [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    3e-24  42%  1hzdA  [c.14.1] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    1e-22  40%  2iexB  [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
    1e-22  40%  2iexA  [x.x.x] DIHYDROXYNAPTHOIC ACID SYNTHETASE
    4e-22  36%  2ppyE  [x.x.x] ENOYL-COA HYDRATASE
    4e-22  36%  2ppyC  [x.x.x] ENOYL-COA HYDRATASE
    4e-22  36%  2ppyB  [x.x.x] ENOYL-COA HYDRATASE
    4e-22  36%  2ppyA  [x.x.x] ENOYL-COA HYDRATASE
    6e-22  29%  3gowF  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    1e-21  29%  3hrxF  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    1e-21  29%  3gowA  [x.x.x] PROBABLE ENOYL-COA HYDRATASE
    2e-20  31%  1ef9A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    2e-20  31%  1ef8C  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    2e-20  31%  1ef8B  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    2e-20  31%  1ef8A  [c.14.1] METHYLMALONYL COA DECARBOXYLASE
    5e-19  36%  2vreA  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    8e-19  39%  2vreC  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    8e-19  39%  2vreB  [x.x.x] DELTA(3,5)-DELTA(2,4)-DIENOYL-COA ISOMERASE
    3e-18  34%  2uzfB  [x.x.x] NAPHTHOATE SYNTHASE
    3e-18  34%  2uzfA  [x.x.x] NAPHTHOATE SYNTHASE
    6e-17  26%  3hinA  [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
    7e-17  26%  3hinB  [x.x.x] PUTATIVE 3-HYDROXYBUTYRYL-COA DEHYDRATASE
    2e-15  30%  2vssE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2vsuE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2vssF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2vssC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2vssA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iI  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iG  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iE  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iD  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iB  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    3e-15  30%  2j5iA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-15  30%  2vsuF  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-15  30%  2vsuD  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-15  30%  2vsuC  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-15  30%  2vsuB  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    4e-15  30%  2vsuA  [x.x.x] P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
    9e-15  35%  3h0uC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    9e-15  35%  3h0uB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    9e-15  35%  3h0uA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    2e-14  35%  2pg8C  [x.x.x] DPGC
    2e-14  35%  2pg8A  [x.x.x] DPGC
    2e-14  35%  2np9C  [x.x.x] DPGC
    2e-14  35%  2np9B  [x.x.x] DPGC
    2e-14  35%  2np9A  [x.x.x] DPGC
    3e-14  28%  2fw2F  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    3e-14  28%  2fw2E  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    3e-14  28%  2fw2A  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    4e-14  28%  2fw2D  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    4e-14  28%  2fw2C  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    6e-14  37%  3h02E  [x.x.x] NAPHTHOATE SYNTHASE
    6e-14  37%  3h02D  [x.x.x] NAPHTHOATE SYNTHASE
    6e-14  37%  3h02C  [x.x.x] NAPHTHOATE SYNTHASE
    6e-14  37%  3h02B  [x.x.x] NAPHTHOATE SYNTHASE
    6e-14  37%  3h02A  [x.x.x] NAPHTHOATE SYNTHASE
    8e-14  29%  2fw2B  [x.x.x] TESTIS-SPECIFIC CHROMODOMAIN PROTEIN Y 2
    8e-14  23%  2ej5A  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    1e-13  29%  1rjnB  [c.14.1] MENB
    1e-13  45%  1wdmB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  45%  1wdmA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  45%  1wdlB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  45%  1wdlA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  45%  1wdkB  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  45%  1wdkA  [c.14.1 - c.2.1 - a.100.1 - a.100.1] FATTY OXIDATION COMPLEX
    1e-13  23%  2ej5B  [x.x.x] ENOYL-COA HYDRATASE SUBUNIT II
    2e-13  29%  1q51A  [c.14.1] MENB
    2e-13  28%  2gtrB  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    3e-13  30%  1q52K  [c.14.1] MENB
    3e-13  30%  1q52B  [c.14.1] MENB
    3e-13  30%  1q52A  [c.14.1] MENB
    3e-13  30%  1q51B  [c.14.1] MENB
    4e-13  28%  2gtrA  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    8e-13  29%  2fbmB  [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
    8e-13  29%  2fbmA  [x.x.x] Y CHROMOSOME CHROMODOMAIN PROTEIN 1, TELOMERIC
    1e-12  31%  2a7kC  [x.x.x] CARB
    2e-12  33%  2gtrC  [x.x.x] CHROMODOMAIN Y-LIKE PROTEIN
    2e-12  30%  1dciA  [c.14.1] DIENOYL-COA ISOMERASE
    3e-12  30%  2a81A  [x.x.x] CARB
    3e-12  30%  2a7kI  [x.x.x] CARB
    3e-12  30%  2a7kH  [x.x.x] CARB
    3e-12  30%  2a7kG  [x.x.x] CARB
    3e-12  30%  2a7kF  [x.x.x] CARB
    3e-12  30%  2a7kE  [x.x.x] CARB
    3e-12  30%  2a7kD  [x.x.x] CARB
    3e-12  30%  2a7kB  [x.x.x] CARB
    3e-12  30%  2a7kA  [x.x.x] CARB
    4e-12  30%  3gkbC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    4e-12  30%  3gkbB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    4e-12  30%  3gkbA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    7e-12  31%  3he2C  [x.x.x] ENOYL-COA HYDRATASE ECHA6
    7e-12  31%  3he2A  [x.x.x] ENOYL-COA HYDRATASE ECHA6
    8e-11  39%  3h02F  [x.x.x] NAPHTHOATE SYNTHASE
    1e-10  29%  1nzyC  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  29%  1nzyB  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  29%  1nzyA  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  29%  1jxzC  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  29%  1jxzB  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  29%  1jxzA  [c.14.1] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-10  33%  3i47A  [x.x.x] ENOYL COA HYDRATASE/ISOMERASE (CROTONASE)
    5e-10  29%  1rjnA  [c.14.1] MENB
    1e-09  30%  1rjnC  [c.14.1] MENB
    1e-09  30%  1rjmB  [c.14.1] MENB
    1e-09  30%  1rjmA  [c.14.1] MENB
    1e-09  32%  1uiyA  [c.14.1] ENOYL-COA HYDRATASE
    2e-09  32%  1szoF  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    2e-09  32%  1szoD  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    2e-09  32%  1szoB  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    2e-09  32%  1szoA  [c.14.1] 6-OXOCAMPHOR HYDROLASE
    3e-09  33%  3g64A  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE
    3e-09  32%  1o8uF  [c.14.1] 6-OXO CAMPHOR HYDROLASE
    3e-09  32%  1o8uC  [c.14.1] 6-OXO CAMPHOR HYDROLASE
    3e-09  32%  1o8uA  [c.14.1] 6-OXO CAMPHOR HYDROLASE
    4e-09  31%  3fduF  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-09  31%  3fduE  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-09  31%  3fduD  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-09  31%  3fduC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-09  31%  3fduB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    4e-09  31%  3fduA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    1e-08  35%  1wz8A  [x.x.x] ENOYL-COA HYDRATASE
    6e-08  27%  2j5sA  [x.x.x] BETA-DIKETONE HYDROLASE
    6e-08  27%  2j5gE  [x.x.x] ALR4455 PROTEIN
    6e-08  27%  2j5gD  [x.x.x] ALR4455 PROTEIN
    6e-08  27%  2j5gB  [x.x.x] ALR4455 PROTEIN
    6e-08  27%  2j5gA  [x.x.x] ALR4455 PROTEIN
    6e-08  39%  3isaF  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    6e-08  39%  3isaD  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    6e-08  39%  3isaC  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    6e-08  39%  3isaB  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    6e-08  39%  3isaA  [x.x.x] PUTATIVE ENOYL-COA HYDRATASE/ISOMERASE
    2e-07  30%  1rjmC  [c.14.1] MENB
    1e-05  36%  3hp0B  [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
    1e-05  36%  3hp0A  [x.x.x] PUTATIVE POLYKETIDE BIOSYNTHESIS ENOYL-COA
    2e-05  24%  1xx4A  [c.14.1] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
    2e-05  35%  3bptA  [x.x.x] 3-HYDROXYISOBUTYRYL-COA HYDROLASE
    2e-04  23%  1sg4C  [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
    2e-04  23%  1sg4B  [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
    2e-04  23%  1sg4A  [x.x.x] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL
:258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxNVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
3h81A           -----ILVERDQRVGIITLNRPQALNALNSQ---------------------------------------
3h81B           -----ILVERDQRVGIITLNRPQALNALNSQ---------------------------------------
2hw5A           -----IIAEKRGKVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEM
1ey3A           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1dubB           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1dubA           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2dubD           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
1mj3A           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2dubE           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2dubA           -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
2qq3I           -----IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQ--
2qq3C           -----IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQ--
2pbpA           -----IAARQEGAVGIIELARPDVLNALSRQMVAEIVAAVEAFDRNEKVRVIVLTGRGRAFAAGADIQ--
2vx2F           ----------------------------------------------------------------------
2vx2E           ----------------------------------------------------------------------
2vx2A           ----------------------------------------------------------------------
2vx2I           ----------------------------------------------------------------------
2vx2H           ----------------------------------------------------------------------
2vx2G           ----------------------------------------------------------------------
2vx2B           ----------------------------------------------------------------------
2zqqF           ----------------------------------------------------------------------
1hzdB           ----------------------------------------------------------------------
1hzdA           ----------------------------------------------------------------------
2iexB           ----------------------------------------------------------------------
2iexA           ----------------------------------------------------------------------
2ppyE           ----------------------------------------------------------------------
2ppyC           ----------------------------------------------------------------------
2ppyB           ----------------------------------------------------------------------
2ppyA           ----------------------------------------------------------------------
3gowF           ----MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTED
3hrxF           ----MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEK
3gowA           ----MVLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEF
1ef9A           ----------------------------------------------------------------------
1ef8C           ----------------------------------------------------------------------
1ef8B           ----------------------------------------------------------------------
1ef8A           ----------------------------------------------------------------------
2vreA           ----------------------------------------------------------------------
2vreC           ----------------------------------------------------------------------
2vreB           ----------------------------------------------------------------------
2uzfB           ----------------------------------------------------------------------
2uzfA           ----------------------------------------------------------------------
3hinA           ---STLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRE
3hinB           ---STLVVDTVGPVLTIGLNRPKKRNALNDGLMAALKDCLTDIPDQIRAVVIHGIGDHFSAGLDLSELRE
2vssE           ----------------------------------------------------------------------
2vsuE           ----------------------------------------------------------------------
2vssF           ----------------------------------------------------------------------
2vssC           ----------------------------------------------------------------------
2vssA           ----------------------------------------------------------------------
2j5iI           ----------------------------------------------------------------------
2j5iG           ----------------------------------------------------------------------
2j5iF           ----------------------------------------------------------------------
2j5iE           ----------------------------------------------------------------------
2j5iD           ----------------------------------------------------------------------
2j5iC           ----------------------------------------------------------------------
2j5iB           ----------------------------------------------------------------------
2j5iA           ----------------------------------------------------------------------
2vsuF           ----------------------------------------------------------------------
2vsuD           ----------------------------------------------------------------------
2vsuC           ----------------------------------------------------------------------
2vsuB           ----------------------------------------------------------------------
2vsuA           ----------------------------------------------------------------------
3h0uC           ----------------------------------------------------------------------
3h0uB           ----------------------------------------------------------------------
3h0uA           ----------------------------------------------------------------------
2pg8C           ----------------------------------------------------------------------
2pg8A           ----------------------------------------------------------------------
2np9C           ----------------------------------------------------------------------
2np9B           ----------------------------------------------------------------------
2np9A           ----------------------------------------------------------------------
2fw2F           ----------------------------------------------------------------------
2fw2E           ----------------------------------------------------------------------
2fw2A           ----------------------------------------------------------------------
2fw2D           ----------------------------------------------------------------------
2fw2C           ----------------------------------------------------------------------
3h02E           ----------------------------------------------------------------------
3h02D           ----------------------------------------------------------------------
3h02C           ----------------------------------------------------------------------
3h02B           ----------------------------------------------------------------------
3h02A           ----------------------------------------------------------------------
2fw2B           ----------------------------------------------------------------------
2ej5A           --------EVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGE-----
1rjnB           ----------------------------------------------------------------------
1wdmB           ----------------------------------------------------------------------
1wdmA           ----------------------------------------------------------------------
1wdlB           ----------------------------------------------------------------------
1wdlA           ----------------------------------------------------------------------
1wdkB           ----------------------------------------------------------------------
1wdkA           ----------------------------------------------------------------------
2ej5B           --------EVKGQVAWLTLNRPDQLNAFTEQMNAEVTKALKQAGADPNVRCVVITGAGRAFCAGEDLS--
1q51A           ----------------------------------------------------------------------
2gtrB           ----------------------------------------------------------------------
1q52K           ----------------------------------------------------------------------
1q52B           ----------------------------------------------------------------------
1q52A           ----------------------------------------------------------------------
1q51B           ----------------------------------------------------------------------
2gtrA           ----------------------------------------------------------------------
2fbmB           ----------------------------------------------------------------------
2fbmA           ----------------------------------------------------------------------
2a7kC           ----------------------------------------------------------------------
2gtrC           ----------------------------------------------------------------------
1dciA           ----------------------------------------------------------------------
2a81A           ----------------------------------------------------------------------
2a7kI           ----------------------------------------------------------------------
2a7kH           ----------------------------------------------------------------------
2a7kG           ----------------------------------------------------------------------
2a7kF           ----------------------------------------------------------------------
2a7kE           ----------------------------------------------------------------------
2a7kD           ----------------------------------------------------------------------
2a7kB           ----------------------------------------------------------------------
2a7kA           ----------------------------------------------------------------------
3gkbC           ----------------------------------------------------------------------
3gkbB           ----------------------------------------------------------------------
3gkbA           ----------------------------------------------------------------------
3he2C           ----------------------------------------------------------------------
3he2A           ----------------------------------------------------------------------
3h02F           ----------------------------------------------------------------------
1nzyC           ----------------------------------------------------------------------
1nzyB           ----------------------------------------------------------------------
1nzyA           ----------------------------------------------------------------------
1jxzC           ----------------------------------------------------------------------
1jxzB           ----------------------------------------------------------------------
1jxzA           ----------------------------------------------------------------------
3i47A           ----------------------------------------------------------------------
1rjnA           ----------------------------------------------------------------------
1rjnC           ----------------------------------------------------------------------
1rjmB           ----------------------------------------------------------------------
1rjmA           ----------------------------------------------------------------------
1uiyA           ----------------------------------------------------------------------
1szoF           ----------------------------------------------------------------------
1szoD           ----------------------------------------------------------------------
1szoB           ----------------------------------------------------------------------
1szoA           ----------------------------------------------------------------------
3g64A           ----------------------------------------------------------------------
1o8uF           ----------------------------------------------------------------------
1o8uC           ----------------------------------------------------------------------
1o8uA           ----------------------------------------------------------------------
3fduF           ----------------------------------------------------------------------
3fduE           ----------------------------------------------------------------------
3fduD           ----------------------------------------------------------------------
3fduC           ----------------------------------------------------------------------
3fduB           ----------------------------------------------------------------------
3fduA           ----------------------------------------------------------------------
1wz8A           ----------------------------------------------------------------------
2j5sA           ----------------------------------------------------------------------
2j5gE           ----------------------------------------------------------------------
2j5gD           ----------------------------------------------------------------------
2j5gB           ----------------------------------------------------------------------
2j5gA           ----------------------------------------------------------------------
3isaF           ----------------------------------------------------------------------
3isaD           ----------------------------------------------------------------------
3isaC           ----------------------------------------------------------------------
3isaB           ----------------------------------------------------------------------
3isaA           ----------------------------------------------------------------------
1rjmC           ----------------------------------------------------------------------
3hp0B           ----------------------------------------------------------------------
3hp0A           ----------------------------------------------------------------------
1xx4A           ----------------------------------------------------------------------
3bptA           ----------------------------------------------------------------------
1sg4C           ----------------------------------------------------------------------
1sg4B           ----------------------------------------------------------------------
1sg4A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
3h81A           -----------------WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPG
3h81B           -----------------WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPG
2hw5A           QNLSFQDCYSSKFL-KHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPG
1ey3A           QNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1dubB           QNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1dubA           QNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2dubD           QNRTFQDCYSG----KHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
1mj3A           QNRTFQDCYSG---LSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2dubE           QNRTFQDCYS------HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2dubA           QNRTFQDCYS------HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
2qq3I           -EMAKDDPIRLEWLNQDWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGVMPG
2qq3C           -EMAKDDPIRLEWLNQDWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGVMPG
2pbpA           -EMAKDDPIRLEWLNQDWDRLSIVKTPMIAAVNXXXXXXXXXXXXSCDLIVASSAAEFGFPEVNLGVMPG
2vx2F           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2E           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2A           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2I           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2H           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2G           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2vx2B           --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
2zqqF           ----------------------------------------------CDIRVAASSAKMGLVETKLAIIPG
1hzdB           ----------------------------------------------CDIRVAASSAKMGLVETKLAIIPG
1hzdA           ----------------------------------------------CDIRVAASSAKMGLVETKLAIIPG
2iexB           --------------------IRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDG
2iexA           --------------------IRVIPKPVIAMVAGYAIGGGHVLHVVCDLTIAADNAIFGQTGPKVGSFDG
2ppyE           ------------FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAG
2ppyC           ------------FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAG
2ppyB           ------------FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAG
2ppyA           ------------FCNETLDKIARSPQVYIACLEGHTVGGGLE-ALACDLRFGDEAGKIGLPEVSLGVLAG
3gowF           RKPDY-EAHLRRY-NRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGLVPD
3hrxF           PDY---EAHLRRY-NRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGLVPD
3gowA           GDRKPDYEAHLRRYNRVVEALSGLEKPLXXXXXXXXXXXXMSLALWGDLRLAAVGASFTTAFVRIGLVPD
1ef9A           --------------------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
1ef8C           --------------------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
1ef8B           --------------------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
1ef8A           --------------------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
2vreA           --------YLRDIITRYQETIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAAD
2vreC           --------YLRDIITRYQETIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAAD
2vreB           --------YLRDIITRYQETIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAAD
2uzfB           --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
2uzfA           --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
3hinA           RDATEGLVHSQTW-HRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEXXXXXXXX
3hinB           RDATEGLVHSQTW-HRVFDKIQYCRVPVIAALKGAVIGGGLELACAAHIRVAEASAYYALPEXXXXXXXX
2vssE           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINYGIPPG
2vsuE           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPG
2vssF           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2vssC           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2vssA           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iI           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iG           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iF           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iE           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iD           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iC           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iB           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2j5iA           -----------------WKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPG
2vsuF           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPG
2vsuD           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPG
2vsuC           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPG
2vsuB           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPG
2vsuA           -----------------WKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPG
3h0uC           ----------------------------IAKLRGRARGAGSEFLLACDMRFASRNAILGQPEVXXXXXXX
3h0uB           ----------------------------IAKLRGRARGAGSEFLLACDMRFASRNAILGQPEVXXXXXXX
3h0uA           ----------------------------IAKLRGRARGAGSEFLLACDMRFASRNAILGQPEVXXXXXXX
2pg8C           -----------------WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPG
2pg8A           -----------------WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPG
2np9C           -----------------WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPG
2np9B           -----------------WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPG
2np9A           -----------------WWHSPRIEKPWVAAVDGFAIGGGAQLLLVFDRVLASSDAYFSLPAAKEGIIPG
2fw2F           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2fw2E           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2fw2A           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2fw2D           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2fw2C           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
3h02E           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
3h02D           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
3h02C           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
3h02B           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
3h02A           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
2fw2B           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2ej5A           -DLDHGDVLRSRYAPM-MKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASFAPAFIHVGLVPD
1rjnB           --WAFCSGGDQRHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1wdmB           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
1wdmA           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
1wdlB           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
1wdlA           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
1wdkB           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
1wdkA           -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
2ej5B           ---DHGDVLRSRYAPM-MKALHHLEKPXXXXXXXXXXXXXXXXXXXCDFRLLSEKASFAPAFIHVGLVPD
1q51A           --WAFCSGGDQLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
2gtrB           -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
1q52K           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1q52B           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1q52A           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1q51B           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
2gtrA           -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
2fbmB           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2fbmA           -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
2a7kC           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2gtrC           -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
1dciA           --------YLRDLISRYQKTIEKCPKPVXXXXXXXXXXXXVDLISACDIRYCTQDAFFQVKEVDVGLAAD
2a81A           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kI           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kH           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kG           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kF           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kE           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kD           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kB           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
2a7kA           -----------------YQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGIGCS
3gkbC           ------------------ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXLGQIEALMGIIPG
3gkbB           ------------------ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXLGQIEALMGIIPG
3gkbA           ------------------ELIRHQPQVTIVKLAGKARGGGXXXXXXXXXXXXXXXXXLGQIEALMGIIPG
3he2C           --------------------------PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALD
3he2A           --------------------------PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALD
3h02F           --------------------IRTCPKPVVA-VAGYSIGGGH--VLHCDLTIAAENAIFGQTGPKVGSFDG
1nzyC           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
1nzyB           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
1nzyA           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
1jxzC           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
1jxzB           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
1jxzA           --------------------IIRVKRPXXXXXXXXXXXXXXXXXXXXDMAICADSAKFVCAWHTIGIGND
3i47A           --------------------------------------------------------RFCFSEVKLGLIP-
1rjnA           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1rjnC           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1rjmB           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1rjmA           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGSFDG
1uiyA           -------------------------------------------------------ARLGYTEVKIGFV-A
1szoF           -----------------------IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
1szoD           -----------------------IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
1szoB           -----------------------IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
1szoA           -----------------------IEVPVIAAVNGPVTNAP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
3g64A           -----------------------------------------------DFRVADPSTRFAFLFTRVGLSGG
1o8uF           -----------------------IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
1o8uC           -----------------------IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
1o8uA           -----------------------IEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFQDPHFPSGIVPG
3fduF           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
3fduE           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
3fduD           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
3fduC           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
3fduB           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
3fduA           ----------------------RLSKPLXXXXXXXXXXXXXXXLLQADLVFADNTALFQIPFVSLGLSPE
1wz8A           --------------------------------------------------------------LRLGVAAG
2j5sA           -----------------------IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQMPHLNAGIVPG
2j5gE           -----------------------IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQMPHLNAGIVPG
2j5gD           -----------------------IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQMPHLNAGIVPG
2j5gB           -----------------------IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQMPHLNAGIVPG
2j5gA           -----------------------IEVPVISAVNGAALLHS-EYILTTDIILASENTVFQMPHLNAGIVPG
3isaF           ----------------------------LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG
3isaD           ----------------------------LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG
3isaC           ----------------------------LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG
3isaB           ----------------------------LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG
3isaA           ----------------------------LALAHGRNFGAGVDLFAACKWRYCTPEAGFRMPGLKFGLVLG
1rjmC           --------------------IRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDAD---FDG
3hp0B           ----------------------------ISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYP-
3hp0A           ----------------------------ISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYP-
1xx4A           ---------------------------LISAINGASPAGGCLMALTCDYRIMADNSKYGLNESLLGIVAP
3bptA           ------------------------QKPYVALIHGIT-GGGVGLSVHGQFRVATEKCLFA-PETAIGLFPD
1sg4C           -----------------WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAP
1sg4B           -----------------WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAP
1sg4A           -----------------WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAP


                         +         .         .         .         .         *         .:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE
3h81A           MGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKE
3h81B           MGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKE
2hw5A           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKE
1ey3A           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1dubB           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1dubA           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2dubD           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
1mj3A           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2dubE           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2dubA           AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
2qq3I           AGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKE
2qq3C           AGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKE
2pbpA           AGGTQRLTKLIGPKRALEWLWTGARMSAKEAEQLGIVNRVVSPELLMEETMRLAGRLAEQPPLALRLIKE
2vx2F           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2E           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2A           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2I           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2H           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2G           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2vx2B           TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
2zqqF           GGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPAMRVAKL
1hzdB           GGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPAMRVAKL
1hzdA           GGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPAMRVAKL
2iexB           GYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKA
2iexA           GYGAGYLARIVGHKKAREIWYLCRQYTAQEALEMGLVNKVVPLEQLEEETVKWAQEILEKSPTAIRFLKA
2ppyE           TGGTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSNIKL
2ppyC           TGGTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSNIKL
2ppyB           TGGTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSNIKL
2ppyA           TGGTQRLARLIGYSRALDN-ITGETITPQEALEIGLVNRVFPQAXXXXXXXXYARKLANSATYAVSNIKL
3gowF           SGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKK
3hrxF           SGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKK
3gowA           SGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKK
1ef9A           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
1ef8C           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
1ef8B           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
1ef8A           LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
2vreA           VGTLQRLPKVIGNQSLVELAFTARKMMADEALGSGLVSRVFDKEVMLDAALALAAEISSKSPVAVQSTKV
2vreC           VGTLQRLPKVIGNQSLVELAFTARKMMADEALGSGLVSRVFDKEVMLDAALALAAEISSKSPVAVQSTKV
2vreB           VGTLQRLPKVIGNQSLVELAFTARKMMADEALGSGLVSRVFDKEVMLDAALALAAEISSKSPVAVQSTKV
2uzfB           GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
2uzfA           GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
3hinA           XXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQ
3hinB           XXXXXXLPRLIGVARMADMMLTGRVYSAAEGVVHGFSQYLIENGSAYDKALELGNRVAQNAPLTNFAVLQ
2vssE           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuE           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vssF           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vssC           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vssA           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iI           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iG           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iF           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iE           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iD           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iC           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iB           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2j5iA           NLVSKAMADTVGHRQSLMYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuF           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuD           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuC           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuB           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
2vsuA           NLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKH
3h0uC           XXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKS
3h0uB           XXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKS
3h0uA           XXXXQHLTRLLGRGRALEAVLTSSDFDADLAERYGWVNRAVPDAELDEFVAGIAARMSGFPRDALIAAKS
2pg8C           AANL-RLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLANRR
2pg8A           AANL-RLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLANRR
2np9C           AANL-RLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLANRR
2np9B           AANL-RLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLANRR
2np9A           AANL-RLGRFAGPRVSRQVILEGRRIWAKEPEARLLVDEVVEPDEL---DAAIERSLTRLDGDAVLANRR
2fw2F           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
2fw2E           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
2fw2A           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
2fw2D           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
2fw2C           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
3h02E           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA
3h02D           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA
3h02C           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA
3h02B           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA
3h02A           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQN--SPALRCLKA
2fw2B           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
2ej5A           AGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEEEVKQFAERLSAMPTKAIGLIKR
1rjnB           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1wdmB           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
1wdmA           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
1wdlB           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
1wdlA           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
1wdkB           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
1wdkA           FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
2ej5B           AGHLYYLPRLVGRAKALELAVLGEKVXXXXXXXXXXXXKVIPLSDWEEEVKQFAERLSAMPTKAIGLIKR
1q51A           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
2gtrB           GCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKA
1q52K           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1q52B           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1q52A           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1q51B           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
2gtrA           GCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKA
2fbmB           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECKA
2fbmA           GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECKA
2a7kC           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2gtrC           GCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCN-PVVLEESK
1dciA           VGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFDKDVMLNAAFALAADISSKSPVAVQGSKI
2a81A           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kI           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kH           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kG           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kF           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kE           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kD           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kB           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
2a7kA           VGAA-ILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKR
3gkbC           GGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKR
3gkbB           GGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKR
3gkbA           GGGTQYLRGRVGRNRALEVVLTADLFDAETAASYGWINRALPADELDEYVDRVARNIAALPDGVIEAAKR
3he2C           NWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKR
3he2A           NWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKR
3h02F           GWGAS-YARIVGQKKAREIWFLCRQYDAQQA-LDGLVNTVVPLADLEKETVRWCRELQ--NSPALRCLKA
1nzyC           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1nzyB           TATSYSLARIVGMRRAMELMLTDRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1nzyA           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1jxzC           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1jxzB           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
1jxzA           TATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKE
3i47A           AVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQ
1rjnA           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1rjnC           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1rjmB           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1rjmA           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
1uiyA           ALVSVILVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGXXXXXXXXXXXXVAK-NAPTSLRLTK
1szoF           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
1szoD           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
1szoB           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
1szoA           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
3g64A           DGAAYLLPRVVGLGHATRLLL-GDTVRAPEAERIGLISELTEEGRADEAARTLARRLADGPALAHAQTKA
1o8uF           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
1o8uC           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
1o8uA           DGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEARRYARKVLTR
3fduF           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
3fduE           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
3fduD           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
3fduC           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
3fduB           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
3fduA           GGASQLLVKQAGYHKAAELLFTAKKFNAETALQAGLVNEIVED---------------------------
1wz8A           DHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHHTKH
2j5sA           DGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRV
2j5gE           DGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRV
2j5gD           DGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRV
2j5gB           DGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRV
2j5gA           DGVHILWPLALGLYRGRYFLFTQEKLTAQQAYELNVVHEVLPQSKLMERAWEIARTLAKQPTLNLRYTRV
3isaF           ---TRRFRDIVGADQALSILGSARAFDADEARRIGFV---------------------------------
3isaD           ---TRRFRDIVGADQALSILGSARAFDADEARRIGFV---------------------------------
3isaC           ---TRRFRDIVGADQALSILGSARAFDADEARRIGFV---------------------------------
3isaB           ---TRRFRDIVGADQALSILGSARAFDADEARRIGFV---------------------------------
3isaA           ---TRRFRDIVGADQALSILGSARAFDADEARRIGFV---------------------------------
1rjmC           GYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKF
3hp0B           ACVLPFLIRRIGRQKA--HYTLTKPISVQEASEWGLI---------------------------------
3hp0A           ACVLPFLIRRIGRQKA--HYTLTKPISVQEASEWGLI---------------------------------
1xx4A           FWLKDNYVNTIGHRAAERALQLGTLFPPAEALKVGLVDEVVPEDQVHSKARSVMAKWFTIPDHSRQLTKS
3bptA           VGGGYFLPRLQGKL-GYFLALTGFRLKGRDVYRAGIATHFV-----------------------------
1sg4C           FWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL-------------------
1sg4B           FWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL-------------------
1sg4A           FWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL-------------------


                         .         .         .         +         .         .         .:280
query           SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR
3h81A           AVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTHR
3h81B           AVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTH-
2hw5A           SVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANF---
1ey3A           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1dubB           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1dubA           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2dubD           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
1mj3A           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2dubE           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2dubA           SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
2qq3I           AVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRF---
2qq3C           AVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRF---
2pbpA           AVQKAVDYPLYEGMQFERKNFYLLFASEDQKEGMAAFLEKRKPRF---
2vx2F           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH-
2vx2E           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH-
2vx2A           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH-
2vx2I           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP-----
2vx2H           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP-----
2vx2G           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP-----
2vx2B           TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKP-----
2zqqF           AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRY---
1hzdB           AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRY---
1hzdA           AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRY---
2iexB           AFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF---
2iexA           AFN-ADSDGLAGIQQLAGDATLLFYTTEEAKEGMRAFKEKRKPDF---
2ppyE           AING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW---
2ppyC           AING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW---
2ppyB           AING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW---
2ppyA           AING--KEPLNVAIRYEGELQNLLFRSEDAKEGLSAFLEKRQPNW---
3gowF           LLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR
3hrxF           LLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR
3gowA           LLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR
1ef9A           ELRVLGEAHTMNSDEFERIQRRAVYDSEDYQEGMNAFLEKRKPNFV--
1ef8C           ELRVLGEAHTMNSDEFERIQRRAVYDSEDYQEGMNAFLEKRKPNFV--
1ef8B           ELRVLGEAHTMNSDEFERIQRRAVYDSEDYQEGMNAFLEKRKPNFV--
1ef8A           ELRVLGEAHTMNSDEFERIQRRAVYDSEDYQEGMNAFLEKRKPNFV--
2vreA           NLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQA------------
2vreC           NLLYSRDHSVAESL----------------------------------
2vreB           NLLYSRDHSVAESL----------------------------------
2uzfB           AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
2uzfA           AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
3hinA           ALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLDHK-------
3hinB           ALPMIAEANPQTGLLMESLMATVAQSDQEAKTRIRAFLD---------
2vssE           GFKRCREL----------------------------------------
2vsuE           GFKRCREL----------------------------------------
2vssF           GFKRCREL----------------------------------------
2vssC           GFKRCREL----------------------------------------
2vssA           GFKRCREL----------------------------------------
2j5iI           GFKRCREL----------------------------------------
2j5iG           GFKRCREL----------------------------------------
2j5iF           GFKRCREL----------------------------------------
2j5iE           GFKRCREL----------------------------------------
2j5iD           GFKRCREL----------------------------------------
2j5iC           GFKRCREL----------------------------------------
2j5iB           GFKRCREL----------------------------------------
2j5iA           GFKRCREL----------------------------------------
2vsuF           GFKRCREL----------------------------------------
2vsuD           GFKRCREL----------------------------------------
2vsuC           GFKRCREL----------------------------------------
2vsuB           GFKRCREL----------------------------------------
2vsuA           GFKRCREL----------------------------------------
3h0uC           AIN-AISLPAADAALFQQ------------------------------
3h0uB           AIN-AISLPAADAALFQQ------------------------------
3h0uA           AIN-AISLPAADAALFQQ------------------------------
2pg8C           MLNLADESP---------------------------------------
2pg8A           MLNLADESP---------------------------------------
2np9C           MLNLADESP---------------------------------------
2np9B           MLNLADESP---------------------------------------
2np9A           MLNLADESP---------------------------------------
2fw2F           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF---
2fw2E           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF---
2fw2A           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF---
2fw2D           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENK-------
2fw2C           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENK-------
3h02E           ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF---
3h02D           ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF---
3h02C           ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF---
3h02B           ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF---
3h02A           ALNADCD---GQAGLQELAGNATLFYTEEGQEGRNAFNQKRQPDF---
2fw2B           LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVE---------
2ej5A           LLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLF---
1rjnB           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
1wdmB           ------------------------------------------------
1wdmA           ------------------------------------------------
1wdlB           ------------------------------------------------
1wdlA           ------------------------------------------------
1wdkB           ------------------------------------------------
1wdkA           ------------------------------------------------
2ej5B           LLRESEETTFDRYLEREAECQRIAGLTSDHREGVKAFFEKRKPLF---
1q51A           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
2gtrB           LVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF---
1q52K           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
1q52B           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
1q52A           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
1q51B           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDW---
2gtrA           LVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRK-------
2fbmB           LVRCNIKLELEQA---NERECEVLRKIWSSAQGIESMLK---------
2fbmA           LVRCNIKLELEQA---NERECEVLRKIWSSAQGIESMLK---------
2a7kC           AVNKPF-IHLLEQTRDASKAVHAAFQARDA------------------
2gtrC           ALVR--------------------------------------------
1dciA           NLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKK-------
2a81A           AVNKPF------------------------------------------
2a7kI           AVNKPF------------------------------------------
2a7kH           AVNKPF------------------------------------------
2a7kG           AVNKPF------------------------------------------
2a7kF           AVNKPF------------------------------------------
2a7kE           AVNKPF------------------------------------------
2a7kD           AVNKPF------------------------------------------
2a7kB           AVNKPF------------------------------------------
2a7kA           AVNKPF------------------------------------------
3gkbC           SLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK---------
3gkbB           SLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK---------
3gkbA           SLPAD---DLKEGLLGENDAWAATFSLPAAQQLISGGLK---------
3he2C           VLND--DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF---
3he2A           VLND--DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF---
3h02F           ALN---------------------------------------------
1nzyC           RFHAGWMQPVEECTEFE-------------------------------
1nzyB           RFHAGWMQPVEECTEFE-------------------------------
1nzyA           RFHAGWMQPVEECTEFE-------------------------------
1jxzC           RFHAGWMQPVEECTEFE-------------------------------
1jxzB           RFHAGWMQPVEECTEFE-------------------------------
1jxzA           RFHAGWMQPVEECTEFE-------------------------------
3i47A           LAQYVANKKIDEELVRYTASLIAHKRVSDGQEGLKAFLNKEIPNW---
1rjnA           AFN-LLDDGLVGQQLFAGEATRLAYMTDEAVEG---------------
1rjnC           AFN---------------------------------------------
1rjmB           AFN---------------------------------------------
1rjmA           AFN---------------------------------------------
1uiyA           ELLLALPGGLEDGFRLAALANAWVRETGDLAEGIRAFFEKRPPRF---
1szoF           QLRRVMEADLSLGLAHE-------------------------------
1szoD           QLRRVMEADLSLGLAHE-------------------------------
1szoB           QLRRVMEADLSLGLAHE-------------------------------
1szoA           QLRRVMEADLSLGLAHE-------------------------------
3g64A           LLTAELD-PLAAAVELD-ASTQALLTGEDYAEFHAAFTEKRPPKWQGR
1o8uF           QLRRVMEADLSLGLAHE-------------------------------
1o8uC           QLRRVMEADLSLGLAHE-------------------------------
1o8uA           QLRRVMEADLSLGLAHE-------------------------------
3fduF           ------------------------------------------------
3fduE           ------------------------------------------------
3fduD           ------------------------------------------------
3fduC           ------------------------------------------------
3fduB           ------------------------------------------------
3fduA           ------------------------------------------------
1wz8A           ALN---------------------------------------------
2j5sA           ALTQRLKRLVNEGI----------------------------------
2j5gE           ALTQRLKRLVNEGI----------------------------------
2j5gD           ALTQRLKRLVNEGI----------------------------------
2j5gB           ALTQRLKRLVNEGI----------------------------------
2j5gA           ALTQRLKRLVNEGI----------------------------------
3isaF           ------------------------------------------------
3isaD           ------------------------------------------------
3isaC           ------------------------------------------------
3isaB           ------------------------------------------------
3isaA           ------------------------------------------------
1rjmC           AFN---------------------------------------------
3hp0B           ------------------------------------------------
3hp0A           ------------------------------------------------
1xx4A           MMRKA----TADNLIKQREADIQNFTSFISRDSIQVYLEKLK------
3bptA           ------------------------------------------------
1sg4C           ------------------------------------------------
1sg4B           ------------------------------------------------
1sg4A           ------------------------------------------------