[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39200.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ywlA.bssp"
#ERROR : Can't open dsspfile "1zg2A.bssp"

## Summary of PDB Search
:95
    1e-05  31%  1ywlA  [x.x.x] HYPOTHETICAL UPF0213 PROTEIN EF2693
    3e-04  34%  1zg2A  [x.x.x] HYPOTHETICAL UPF0213 PROTEIN BH0048
:95

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLK
1ywlA           --KSHYFYVLLCQ-DGSFYGGYTTEPERRLTEHNSGTGAKYTRKRRPVIMIHTEKFETRSEATKAEAAFK
1zg2A           ------VYILECK-DGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVK


                         .         .         *         .         .         .         .:140
query           RWRRDWKIALIxxxxxxxxxxxxxx
1ywlA           KLTRKQK------------------
1zg2A           HLSRRKKEQLV--------------