[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39246.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2zleA.bssp"
#ERROR : Can't open dsspfile "3cs0A.bssp"
#ERROR : Can't open dsspfile "1ky9B.bssp"
#ERROR : Can't open dsspfile "1ky9A.bssp"
#ERROR : Can't open dsspfile "1te0A.bssp"
#ERROR : Can't open dsspfile "2z9iB.bssp"
#ERROR : Can't open dsspfile "3gdvC.bssp"
#ERROR : Can't open dsspfile "3gduC.bssp"
#ERROR : Can't open dsspfile "3gdvA.bssp"
#ERROR : Can't open dsspfile "3gduA.bssp"
#ERROR : Can't open dsspfile "3gcoA.bssp"
#ERROR : Can't open dsspfile "1l1jA.bssp"
#ERROR : Can't open dsspfile "3gcnA.bssp"
#ERROR : Can't open dsspfile "1y8tA.bssp"
#ERROR : Can't open dsspfile "1vcwA.bssp"
#ERROR : Can't open dsspfile "3gdsA.bssp"
#ERROR : Can't open dsspfile "1sozB.bssp"
#ERROR : Can't open dsspfile "1sozA.bssp"
#ERROR : Can't open dsspfile "1y8tB.bssp"
#ERROR : Can't open dsspfile "2r3yC.bssp"
#ERROR : Can't open dsspfile "2r3yB.bssp"
#ERROR : Can't open dsspfile "2r3yA.bssp"
#ERROR : Can't open dsspfile "2z9iA.bssp"
#ERROR : Can't open dsspfile "1sozC.bssp"
#ERROR : Can't open dsspfile "1sotB.bssp"
#ERROR : Can't open dsspfile "2qf3B.bssp"
#ERROR : Can't open dsspfile "2r3uB.bssp"
#ERROR : Can't open dsspfile "1sotC.bssp"
#ERROR : Can't open dsspfile "2qf3C.bssp"
#ERROR : Can't open dsspfile "3gdvB.bssp"
#ERROR : Can't open dsspfile "1sotA.bssp"
#ERROR : Can't open dsspfile "1y8tC.bssp"
#ERROR : Can't open dsspfile "2z9iC.bssp"
#ERROR : Can't open dsspfile "2r3uA.bssp"
#ERROR : Can't open dsspfile "2qf3A.bssp"
#ERROR : Can't open dsspfile "2rceC.bssp"
#ERROR : Can't open dsspfile "2qf0F.bssp"
#ERROR : Can't open dsspfile "2qf0C.bssp"
#ERROR : Can't open dsspfile "2qf0B.bssp"
#ERROR : Can't open dsspfile "2qf0H.bssp"
#ERROR : Can't open dsspfile "2qf0E.bssp"
#ERROR : Can't open dsspfile "2rceG.bssp"
#ERROR : Can't open dsspfile "3gduB.bssp"
#ERROR : Can't open dsspfile "2rceD.bssp"
#ERROR : Can't open dsspfile "2rceB.bssp"
#ERROR : Can't open dsspfile "2r3uC.bssp"
#ERROR : Can't open dsspfile "1lcyA.bssp"
#ERROR : Can't open dsspfile "3b8jA.bssp"
#ERROR : Can't open dsspfile "2rceF.bssp"
#ERROR : Can't open dsspfile "2qf0D.bssp"
#ERROR : Can't open dsspfile "2rceH.bssp"
#ERROR : Can't open dsspfile "2qf0G.bssp"
#ERROR : Can't open dsspfile "2qf0A.bssp"
#ERROR : Can't open dsspfile "2rceI.bssp"
#ERROR : Can't open dsspfile "2rceA.bssp"
#ERROR : Can't open dsspfile "2rceE.bssp"
#ERROR : Can't open dsspfile "2qf0I.bssp"
#ERROR : Can't open dsspfile "2qgrA.bssp"
#ERROR : Can't open dsspfile "2p3wA.bssp"
#ERROR : Can't open dsspfile "2p3wB.bssp"
#ERROR : Can't open dsspfile "2v90C.bssp"
#ERROR : Can't open dsspfile "2v90A.bssp"
#ERROR : Can't open dsspfile "2ytwA.bssp"
#ERROR : Can't open dsspfile "2kl1A.bssp"
#ERROR : Can't open dsspfile "2pzdA.bssp"
#ERROR : Can't open dsspfile "2joaA.bssp"
#ERROR : Can't open dsspfile "3id4A.bssp"
#ERROR : Can't open dsspfile "3id3A.bssp"
#ERROR : Can't open dsspfile "3id2A.bssp"
#ERROR : Can't open dsspfile "2kjkA.bssp"
#ERROR : Can't open dsspfile "3i1eA.bssp"
#ERROR : Can't open dsspfile "2vspB.bssp"
#ERROR : Can't open dsspfile "2vspA.bssp"
#ERROR : Can't open dsspfile "2eejA.bssp"
#ERROR : Can't open dsspfile "2dlsA.bssp"
#ERROR : Can't open dsspfile "3ch8A.bssp"
#ERROR : Can't open dsspfile "2as9B.bssp"
#ERROR : Can't open dsspfile "1uf1A.bssp"
#ERROR : Can't open dsspfile "2kjpA.bssp"
#ERROR : Can't open dsspfile "1ky9A.bssp"
#ERROR : Can't open dsspfile "2p3wA.bssp"
#ERROR : Can't open dsspfile "2p3wB.bssp"
#ERROR : Can't open dsspfile "2ytwA.bssp"
#ERROR : Can't open dsspfile "2joaA.bssp"

## Summary of PDB Search
:526
    8e-63  39%  2zleA  [x.x.x] PROTEASE DO
    9e-57  43%  3cs0A  [x.x.x] PROTEASE DO
    3e-48  41%  1ky9B  [b.47.1 - b.36.1 - b.36.1] PROTEASE DO
    1e-45  44%  1ky9A  [b.47.1 - b.36.1] PROTEASE DO
    2e-41  35%  1te0A  [b.47.1 - b.36.1] PROTEASE DEGS
    3e-40  42%  2z9iB  [x.x.x] PROBABLE SERINE PROTEASE PEPD
    2e-38  36%  3gdvC  [x.x.x] DEGS PROTEASE
    9e-38  36%  3gduC  [x.x.x] DEGS PROTEASE
    6e-37  36%  3gdvA  [x.x.x] DEGS PROTEASE
    5e-36  36%  3gduA  [x.x.x] DEGS PROTEASE
    5e-36  36%  3gcoA  [x.x.x] PROTEASE DEGS
    2e-35  48%  1l1jA  [b.47.1] HEAT SHOCK PROTEASE HTRA
    2e-35  36%  3gcnA  [x.x.x] PROTEASE DEGS
    7e-35  37%  1y8tA  [x.x.x] HYPOTHETICAL PROTEIN RV0983
    7e-35  38%  1vcwA  [b.47.1 - b.36.1] PROTEASE DEGS
    2e-34  37%  3gdsA  [x.x.x] PROTEASE DEGS
    6e-34  38%  1sozB  [b.47.1 - b.36.1] PROTEASE DEGS
    6e-34  37%  1sozA  [b.47.1 - b.36.1] PROTEASE DEGS
    2e-33  42%  1y8tB  [x.x.x] HYPOTHETICAL PROTEIN RV0983
    2e-33  37%  2r3yC  [x.x.x] PROTEASE DEGS
    2e-33  37%  2r3yB  [x.x.x] PROTEASE DEGS
    2e-33  37%  2r3yA  [x.x.x] PROTEASE DEGS
    3e-33  36%  2z9iA  [x.x.x] PROBABLE SERINE PROTEASE PEPD
    1e-32  43%  1sozC  [b.47.1 - b.36.1] PROTEASE DEGS
    6e-32  40%  1sotB  [b.47.1 - b.36.1] PROTEASE DEGS
    1e-31  44%  2qf3B  [x.x.x] PROTEASE DEGS
    2e-31  43%  2r3uB  [x.x.x] PROTEASE DEGS
    3e-31  38%  1sotC  [b.47.1 - b.36.1] PROTEASE DEGS
    4e-31  44%  2qf3C  [x.x.x] PROTEASE DEGS
    4e-31  37%  3gdvB  [x.x.x] DEGS PROTEASE
    6e-31  40%  1sotA  [b.47.1 - b.36.1] PROTEASE DEGS
    1e-30  40%  1y8tC  [x.x.x] HYPOTHETICAL PROTEIN RV0983
    1e-30  40%  2z9iC  [x.x.x] PROBABLE SERINE PROTEASE PEPD
    1e-30  42%  2r3uA  [x.x.x] PROTEASE DEGS
    2e-30  43%  2qf3A  [x.x.x] PROTEASE DEGS
    3e-30  42%  2rceC  [x.x.x] PROTEASE DEGS
    4e-30  42%  2qf0F  [x.x.x] PROTEASE DEGS
    4e-30  42%  2qf0C  [x.x.x] PROTEASE DEGS
    4e-30  42%  2qf0B  [x.x.x] PROTEASE DEGS
    7e-30  41%  2qf0H  [x.x.x] PROTEASE DEGS
    1e-29  41%  2qf0E  [x.x.x] PROTEASE DEGS
    2e-29  42%  2rceG  [x.x.x] PROTEASE DEGS
    2e-29  38%  3gduB  [x.x.x] DEGS PROTEASE
    3e-29  42%  2rceD  [x.x.x] PROTEASE DEGS
    4e-29  42%  2rceB  [x.x.x] PROTEASE DEGS
    4e-29  43%  2r3uC  [x.x.x] PROTEASE DEGS
    4e-29  36%  1lcyA  [b.47.1 - b.36.1] HTRA2 SERINE PROTEASE
    6e-29  44%  3b8jA  [x.x.x] PROTEASE DEGS
    8e-29  42%  2rceF  [x.x.x] PROTEASE DEGS
    1e-28  41%  2qf0D  [x.x.x] PROTEASE DEGS
    1e-28  43%  2rceH  [x.x.x] PROTEASE DEGS
    2e-28  44%  2qf0G  [x.x.x] PROTEASE DEGS
    2e-28  41%  2qf0A  [x.x.x] PROTEASE DEGS
    2e-28  43%  2rceI  [x.x.x] PROTEASE DEGS
    3e-28  41%  2rceA  [x.x.x] PROTEASE DEGS
    4e-28  42%  2rceE  [x.x.x] PROTEASE DEGS
    4e-27  41%  2qf0I  [x.x.x] PROTEASE DEGS
    7e-19  39%  2qgrA  [x.x.x] PROTEASE DEGS
    2e-11  39%  2p3wA  [x.x.x] PROBABLE SERINE PROTEASE HTRA3
    1e-09  36%  2p3wB  [x.x.x] PROBABLE SERINE PROTEASE HTRA3
    9e-06  39%  2v90C  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 3
    9e-06  39%  2v90A  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 3
    1e-05  31%  2ytwA  [x.x.x] SERINE PROTEASE HTRA1
    5e-05  27%  2kl1A  [x.x.x] YLBL PROTEIN
    6e-05  33%  2pzdA  [x.x.x] SERINE PROTEASE HTRA2
    6e-05  32%  2joaA  [x.x.x] SERINE PROTEASE HTRA1
    4e-04  30%  3id4A  [x.x.x] REGULATOR OF SIGMA E PROTEASE
    4e-04  30%  3id3A  [x.x.x] REGULATOR OF SIGMA E PROTEASE
    4e-04  30%  3id2A  [x.x.x] REGULATOR OF SIGMA E PROTEASE
    5e-04  31%  2kjkA  [x.x.x] LIN2157 PROTEIN
    5e-04  31%  3i1eA  [x.x.x] LIN2157 PROTEIN
    7e-04  50%  2vspB  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    7e-04  50%  2vspA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    7e-04  50%  2eejA  [x.x.x] PDZ DOMAIN-CONTAINING PROTEIN 1
    7e-04  47%  2dlsA  [x.x.x] RHO GUANINE NUCLEOTIDE EXCHANGE FACTOR 11
    7e-04  41%  3ch8A  [x.x.x] FUSION PROTEIN PDZ-FIBRONECTIN
    7e-04  47%  2as9B  [x.x.x] SERINE PROTEASE
    9e-04  52%  1uf1A  [b.36.1] KIAA1526 PROTEIN
    9e-04  31%  2kjpA  [x.x.x] UNCHARACTERIZED PROTEIN YLBL
    2e-04  36%  1ky9A  [b.47.1 - b.36.1] PROTEASE DO(query 436->508)
    1e-04  29%  2p3wA  [x.x.x] PROBABLE SERINE PROTEASE HTRA3(query 453->520)
    8e-05  26%  2p3wB  [x.x.x] PROBABLE SERINE PROTEASE HTRA3(query 439->520)
    5e-04  32%  2ytwA  [x.x.x] SERINE PROTEASE HTRA1(query 453->520)
    5e-04  32%  2joaA  [x.x.x] SERINE PROTEASE HTRA1(query 453->520)
:526

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2zleA           ----------------------------------------------------------------------
3cs0A           ----------------------------------------------------------------------
1ky9B           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
1te0A           ----------------------------------------------------------------------
2z9iB           ----------------------------------------------------------------------
3gdvC           ----------------------------------------------------------------------
3gduC           ----------------------------------------------------------------------
3gdvA           ----------------------------------------------------------------------
3gduA           ----------------------------------------------------------------------
3gcoA           ----------------------------------------------------------------------
1l1jA           ----------------------------------------------------------------------
3gcnA           ----------------------------------------------------------------------
1y8tA           ----------------------------------------------------------------------
1vcwA           ----------------------------------------------------------------------
3gdsA           ----------------------------------------------------------------------
1sozB           ----------------------------------------------------------------------
1sozA           ----------------------------------------------------------------------
1y8tB           ----------------------------------------------------------------------
2r3yC           ----------------------------------------------------------------------
2r3yB           ----------------------------------------------------------------------
2r3yA           ----------------------------------------------------------------------
2z9iA           ----------------------------------------------------------------------
1sozC           ----------------------------------------------------------------------
1sotB           ----------------------------------------------------------------------
2qf3B           ----------------------------------------------------------------------
2r3uB           ----------------------------------------------------------------------
1sotC           ----------------------------------------------------------------------
2qf3C           ----------------------------------------------------------------------
3gdvB           ----------------------------------------------------------------------
1sotA           ----------------------------------------------------------------------
1y8tC           ----------------------------------------------------------------------
2z9iC           ----------------------------------------------------------------------
2r3uA           ----------------------------------------------------------------------
2qf3A           ----------------------------------------------------------------------
2rceC           ----------------------------------------------------------------------
2qf0F           ----------------------------------------------------------------------
2qf0C           ----------------------------------------------------------------------
2qf0B           ----------------------------------------------------------------------
2qf0H           ----------------------------------------------------------------------
2qf0E           ----------------------------------------------------------------------
2rceG           ----------------------------------------------------------------------
3gduB           ----------------------------------------------------------------------
2rceD           ----------------------------------------------------------------------
2rceB           ----------------------------------------------------------------------
2r3uC           ----------------------------------------------------------------------
1lcyA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2rceF           ----------------------------------------------------------------------
2qf0D           ----------------------------------------------------------------------
2rceH           ----------------------------------------------------------------------
2qf0G           ----------------------------------------------------------------------
2qf0A           ----------------------------------------------------------------------
2rceI           ----------------------------------------------------------------------
2rceA           ----------------------------------------------------------------------
2rceE           ----------------------------------------------------------------------
2qf0I           ----------------------------------------------------------------------
2qgrA           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2v90C           ----------------------------------------------------------------------
2v90A           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2kl1A           ----------------------------------------------------------------------
2pzdA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------
3id4A           ----------------------------------------------------------------------
3id3A           ----------------------------------------------------------------------
3id2A           ----------------------------------------------------------------------
2kjkA           ----------------------------------------------------------------------
3i1eA           ----------------------------------------------------------------------
2vspB           ----------------------------------------------------------------------
2vspA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3ch8A           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
1uf1A           ----------------------------------------------------------------------
2kjpA           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFXXXXXXXXXXXXXXXXXX
2zleA           QMPSLAPMLEKVMPSVVSI--NVEGSTTVNTPRMPRNXXXXXXXXXXKFMALGSGV--------------
3cs0A           ----------------------------------------------------------------------
1ky9B           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
1te0A           ----------------------------------------------------------------------
2z9iB           ----------------------------------------------------------------------
3gdvC           ----------------------------------------------------------------------
3gduC           ----------------------------------------------------------------------
3gdvA           ----------------------------------------------------------------------
3gduA           ----------------------------------------------------------------------
3gcoA           ----------------------------------------------------------------------
1l1jA           ----------------------------------------------------------------------
3gcnA           ----------------------------------------------------------------------
1y8tA           ----------------------------------------------------------------------
1vcwA           ----------------------------------------------------------------------
3gdsA           ----------------------------------------------------------------------
1sozB           ----------------------------------------------------------------------
1sozA           ----------------------------------------------------------------------
1y8tB           ----------------------------------------------------------------------
2r3yC           ----------------------------------------------------------------------
2r3yB           ----------------------------------------------------------------------
2r3yA           ----------------------------------------------------------------------
2z9iA           ----------------------------------------------------------------------
1sozC           ----------------------------------------------------------------------
1sotB           ----------------------------------------------------------------------
2qf3B           ----------------------------------------------------------------------
2r3uB           ----------------------------------------------------------------------
1sotC           ----------------------------------------------------------------------
2qf3C           ----------------------------------------------------------------------
3gdvB           ----------------------------------------------------------------------
1sotA           ----------------------------------------------------------------------
1y8tC           ----------------------------------------------------------------------
2z9iC           ----------------------------------------------------------------------
2r3uA           ----------------------------------------------------------------------
2qf3A           ----------------------------------------------------------------------
2rceC           ----------------------------------------------------------------------
2qf0F           ----------------------------------------------------------------------
2qf0C           ----------------------------------------------------------------------
2qf0B           ----------------------------------------------------------------------
2qf0H           ----------------------------------------------------------------------
2qf0E           ----------------------------------------------------------------------
2rceG           ----------------------------------------------------------------------
3gduB           ----------------------------------------------------------------------
2rceD           ----------------------------------------------------------------------
2rceB           ----------------------------------------------------------------------
2r3uC           ----------------------------------------------------------------------
1lcyA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2rceF           ----------------------------------------------------------------------
2qf0D           ----------------------------------------------------------------------
2rceH           ----------------------------------------------------------------------
2qf0G           ----------------------------------------------------------------------
2qf0A           ----------------------------------------------------------------------
2rceI           ----------------------------------------------------------------------
2rceA           ----------------------------------------------------------------------
2rceE           ----------------------------------------------------------------------
2qf0I           ----------------------------------------------------------------------
2qgrA           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2v90C           ----------------------------------------------------------------------
2v90A           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2kl1A           ----------------------------------------------------------------------
2pzdA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------
3id4A           ----------------------------------------------------------------------
3id3A           ----------------------------------------------------------------------
3id2A           ----------------------------------------------------------------------
2kjkA           ----------------------------------------------------------------------
3i1eA           ----------------------------------------------------------------------
2vspB           ----------------------------------------------------------------------
2vspA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3ch8A           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
1uf1A           ----------------------------------------------------------------------
2kjpA           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
2zleA           ------IIDADGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSD
3cs0A           -------IDADGYVVTNNHVVDNATVIKVQLSDGRKFDAKV-GKDPRSDIALIQIQNPKNLTAIKADSDA
1ky9B           -------IDADGYVVTNNHVVDNATVIKVQLSDGRKFDAKV-GKDPRSDIALIQIQNPKNLTAIKADSDA
1ky9A           -------IDADGYVVTNNHVVDNATVIKVQLSDGRKFDAKV-GKDPRSDIALIQIQNPKNLTAIKADSDA
1te0A           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLIIKATGGLPTIPINARR
2z9iB           -------LSAEGLILTNNHVIAAAPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
3gdvC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gduC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gdvA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gduA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gcoA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1l1jA           -----FIFDPEGYILTNYHVVGGADNITVTMLDGSKYDAEYIGGDEELDIAVIKIKASKKFPYLEFGDSK
3gcnA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1y8tA           -------LSAEGLILTNNHVIAAAPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
1vcwA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gdsA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1sozB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1sozA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1y8tB           -------LSAEGLILTNNHVIAAAPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
2r3yC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2r3yB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2r3yA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2z9iA           -------LSAEGLILTNNHVIXXXXXXXVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
1sozC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1sotB           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf3B           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2r3uB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1sotC           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf3C           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gdvB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1sotA           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1y8tC           -------LSAEGLILTNNHVIXXXXXTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
2z9iC           -------LSAEGLILTNNHVIXXXXXTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLPISLGSSSD
2r3uA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf3A           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0F           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0C           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0B           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0H           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0E           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceG           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
3gduB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceD           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceB           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2r3uC           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
1lcyA           -----FVVAADGLIVTNAHXXXXXXXXXXXLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSA
3b8jA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceF           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0D           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceH           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0G           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0A           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceI           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2rceE           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qf0I           -------IDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2qgrA           -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2v90C           ----------------------------------------------------------------------
2v90A           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2kl1A           ----------------------------------------------------------------------
2pzdA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------
3id4A           ----------------------------------------------------------------------
3id3A           ----------------------------------------------------------------------
3id2A           ----------------------------------------------------------------------
2kjkA           ----------------------------------------------------------------------
3i1eA           ----------------------------------------------------------------------
2vspB           ----------------------------------------------------------------------
2vspA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3ch8A           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
1uf1A           ----------------------------------------------------------------------
2kjpA           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
2zleA           ARVGDYTVAIGNPFGLGETVTSGIVSALGRE-------NFIQTDAAINRGNSGGALVNLNGELIGINTAI
3cs0A           LRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAEYENFIQTDAAINRGNSGGALVNLNGELIGINTAI
1ky9B           LRVGDYTVAIGNPFGLGETVTSGIVSALGR-------ENFIQTDAAIXXXXXXXXXXXXXXELIGINTAI
1ky9A           LRVGDYTVAIGNPFGLGETVTSGIVSALGR----SGYENFIQTDAAIXXXXXXXXXXXXXXELIGINTAI
1te0A           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPTQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2z9iB           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
3gdvC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGNPTRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
3gduC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGPTGRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
3gdvA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
3gduA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
3gcoA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
1l1jA           VKIGEWAIAIGNPLGFQHTVTVGVVSATNRRIGSGYYVGLIQTDAAINPGNSGGPLLNIHGEVIGINTAI
3gcnA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
1y8tA           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
1vcwA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
3gdsA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
1sozB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
1sozA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
1y8tB           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
2r3yC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2r3yB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2r3yA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2z9iA           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
1sozC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
1sotB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf3B           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2r3uB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
1sotC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf3C           PHIGDVVLAIGNPYNLGQTITQGIISATGR-------QNFLQTDASINHGNSGGALVNSLGELMGINTLS
3gdvB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINPGN-GGALVNSLGELMGINTLS
1sotA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
1y8tC           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSQNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
2z9iC           LRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSQNTVLDAIQTDAAINPGNSGG-ALVNNAQLVGVNSAI
2r3uA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
2qf3A           PHIGDVVLAIGNPYNLGQTITQGIISATGR--------NFLQTDASINHGNSGGALVNSLGELMGINTLS
2rceC           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
2qf0F           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf0C           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf0B           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf0H           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf0E           PHIGDVVLAIGNPYNLGQTITQGIISATGR--------NFLQTDASINHGNSGGALVNSLGE-LGINTLS
2rceG           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
3gduB           PHIGDVVLAIGNPYNLGQTITQGIISATGRITGR---QNFLQTDASINPGN-GGALVNSLGELMGINTLS
2rceD           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IG---LNNFLQTDASINHGN-GGALVNSLGELMGINTLS
2rceB           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
2r3uC           PHIGDVVLAIGNPYNLGQTITQGIISATG---------NFLQTDASINHGNSGGALVNSLGELMGINTLS
1lcyA           DRQGEFVVAMGSPFALQNTITSGIVSSAQR-----PNVEYIQTDAAIDFGNAGGPLVNLDGEVIGVNTMK
3b8jA           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IG---LNNFLATDASINHGNSGGALVNSLGELMGINTL-
2rceF           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
2qf0D           PHIGDVVLAIGNPYNLGQTITQGIISATGR------IQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2rceH           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
2qf0G           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGE-LGINTLS
2qf0A           PHIGDVVLAIGNPYNLGQTITQGIISATGR--------NFLQTDASINHGNSGGALVNSLGE-LGINTLS
2rceI           PHIGDVVLAIGNPYNLGQTITQGIISATGR-IG----QNFLQTDASINHGN-GGALVNSLGELMGINTLS
2rceA           PHIGDVVLAIGNPYNLGQTITQGIISATGRT----GRQNFLQTDASINHGN-GGALVNSLGELMGINTLS
2rceE           PHIGDVVLAIGNPYNLGQTITQGIISATGR-------INFLQTDASINHGN-GGALVNSLGELMGINTLS
2qf0I           PHIGDVVLAIGNPYNLGQTITQGIISATG----------FLQTDASINHGNSGGALVNSLGE-LGINTLS
2qgrA           PHIGDVVLA----XXXXXXXXXXXXSATG----------FLQTDASINHGNSGGALVNSLGELMGINT--
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2v90C           ----------------------------------------------------------------------
2v90A           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2kl1A           ----------------------------------------------------------------------
2pzdA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------
3id4A           ----------------------------------------------------------------------
3id3A           ----------------------------------------------------------------------
3id2A           ----------------------------------------------------------------------
2kjkA           ----------------------------------------------------------------------
3i1eA           ----------------------------------------------------------------------
2vspB           ----------------------------------------------------------------------
2vspA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3ch8A           ----------------------------------------------------------------------
2as9B           -------------------------------------DNILNFDAYIEPGNSGSPVLNSNNEVIGVNGAV
1uf1A           ----------------------------------------------------------------------
2kjpA           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
2zleA           LAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSS
3cs0A           LAPDGGNIGIGFAIP-SNVKNLTSQV-EYGQVKRGELGIGT-----ELNSELAKAKVDGAFVSQVLPNSS
1ky9B           LAPDGGNIGIGFAIP-SNVKNLTSQV-EYGQVKRGELG-----IGTELNSELAKAKVDGAFVSQVLPNSS
1ky9A           LAPDGGNIGIGFAIP-SNVKNLTSQV-EYGQVKRGELG-----IGTELNSELAKAKVDGAFVSQVLPNSS
1te0A           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXAPLHAQGGGIDQLQGIVVNEVSPDGP
2z9iB           ATLQSGSIGLGFAIPVDQAKRIADELISTGKASHASLGVQV--------------TNDGAKIVEVV---A
3gdvC           FDKETPE-GIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXAPQL---------QGIVVNEVSPDGP
3gduC           FDKSNETEGIGFAIPFQLATKIMDKL------------XXXXXXXXXXXXXXXXEQLQGIVVNEVSPDGP
3gdvA           FDKSGETEGIGFAIPFQLATKIMDKL--------------XXXXXXXXXXXXXXXXXXXXVVNEVSPDGP
3gduA           FDKSNDGEGIGFAIPFQLATKIMDKL--------------XXXXXXXXXXXXXXXXXXXXVVNEVSPDGP
3gcoA           FDKSNDGEGIGFAIPFQLATKIMDKL--------------XXXXXXXXXXXXXXXXXXXXVVNEVSPDGP
1l1jA           VNPQ-EAVNLGFAIPINTVK--------------------------------------------------
3gcnA           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXXXN----------------EVSPDGP
1y8tA           ATLQSGSIGLGFAIPVDQAKRIADELISTGKASHASLGVQV----TNDKDTL------XXXXXXXXXXXX
1vcwA           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXXXN----------------EVSPDGP
3gdsA           FDKSNDGEGIGFAIPFQLATKIMDKL--------------XXXXXXXXXXXXXXXXXXXXVVNEVSPDGP
1sozB           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXXNE---------------------GP
1sozA           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXXNEVS-----------------PDGP
1y8tB           LGAQSGSIGLGFAIPVDQAKRIADELISTGKASHASLGVQV-----------------------------
2r3yC           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXN------------------EVSPDGP
2r3yB           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXN------------------EVSPDGP
2r3yA           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXN------------------EVSPDGP
2z9iA           ATLQSGSIGLGFAIPVDQAKRIADELISTGKASHASLGVQVTN-----------DKTLXXXXXXXXXXXX
1sozC           FDKSNDGEGIGFAIPFQLATKIMDKLIRDGRVIRGGIVV-------------------------------
1sotB           FDPE----GIGFAIPFQLATKI-----DK-----------LXXXXXXXXXXXXXXXXXXXXXNEVSPDGP
2qf3B           FTPE----GIGFAIPFQLATKIMDKL--------------------------------------------
2r3uB           FDKDGETEGIGFAIPFQLATKIMDKL--------------------------------------------
1sotC           FDE-----GIGFAIPFQ-LATKIDKLXXXXXXXXXXXXXXXXXXXXN----------------EVSPDGP
2qf3C           FTPE----GIGFAIPFQLATKIMDKL--------------------------------------------
3gdvB           FDGETPE-GIGFAIPFQLATKIMDKL--------------------XXXXXXXXXXXXXXXXNEVSPDGP
1sotA           FDE-----GIGFAIPFQ-LATKIDKLXXXXXXXXXXXXXXXXXXXXN----------------EVSPDGP
1y8tC           ATLS-GSIGLGFAIPVDQAKRIADELISTGKASHASLGVQVTNLGAKIVE-VGAAVPKGVVVTK------
2z9iC           ATLS-GSIGLGFAIPVDQAKRIADELISTGKASHASLGVQVTNL--------------GAKIVE------
2r3uA           FDKETPE-GIGFAIPFQLATKIMDKL--------------------------------------------
2qf3A           FPE-----GIGFAIPFQLATKIMDKLIRDGRVIR------------------------------------
2rceC           FDKSETPEGIGFAIPFQLATKIMDKL--------------------------------------------
2qf0F           FDKSGETEGIGFAIPFQLATKIDKLIRD------------------------------------------
2qf0C           FDKSGETEGIGFAIPFQLATKIDKLIRD------------------------------------------
2qf0B           FDKSGETEGIGFAIPFQLATKIDKLIRD------------------------------------------
2qf0H           FDKGETPEGIGFAIPFQLATKIDKLIRD------------------------------------------
2qf0E           FDKSETPEGIGFAIPFQLATKIDKLIRD------------------------------------------
2rceG           FDKDGETEGIGFAIPFQLATKIMDKL--------------------------------------------
3gduB           FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXNEVSP----------------------GP
2rceD           FDET--PEGIGFAIPFQLATKIMDKLIRDGRVIR------------------------------------
2rceB           FDKSNDGEGIGFAIPFQLATKIMDKL--------------------------------------------
2r3uC           FDT---PEGIGFAIPFQLATKIMDKL--------------------------------------------
1lcyA           V-----TAGISFAIPSDRLREFLH---------RRYIGVMMLTLSPSILAELQLREPSGVLIHKVILGSP
3b8jA           -------SGIGFAIPFQLATKIMDKL--------------------------------------------
2rceF           FDET--PEGIGFAIPFQLATKIMDKL--------------------------------------------
2qf0D           FDKSTPE-GIGFAIPFQLATKIDKLIRD------------------------------------------
2rceH           FDT---PEGIGFAIPFQLATKIMDKL--------------------------------------------
2qf0G           FDKT--PEGIGFAIP-------------------------------------------------------
2qf0A           FDKSNDGEGIGFAIPFQLATKIDKLIRD------------------------------------------
2rceI           FDET--PEGIGFAIPFQLATKIMDKL--------------------------------------------
2rceA           FDKSNDGEGIGFAIPFQLATKIMDKL--------------------------------------------
2rceE           FDKSNDGEGIGFAIPFQLATKIMDKL--------------------------------------------
2qf0I           FDGETPE-GIGFAIPFQLATKIDKLIRD------------------------------------------
2qgrA           -------LGIGFAIPFQLATKIMDKL--------------------------------------------
2p3wA           -----------------------------GSHMKRFIGIRMRTITPSLVDELKASNPDGIYVQEVAPNSP
2p3wB           -----------------------------GSHMKRFIGIRMRTITPSLVDEPEVSS--GIYVQEVAPNSP
2v90C           -----------------------------------------------LREEKGLDGRPGQFLWEVDPGLP
2v90A           -----------------------------------------------LREEKGLDGRPGQFLWEVDPGLP
2ytwA           -----------------------RQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDGAYIIEVIPDTP
2kl1A           -----------------------------------------------------MNEAKGVYVMSVLPNMP
2pzdA           ---------------------------------RRYIGVMMLTLSPSILAELQLREPSGVLIHKVILGSP
2joaA           -----------------------------GSHMKKYIGIRMMSLTSSKAKELKDRHRDGAYIIEVIPDTP
3id4A           -----------------------------------------------------------------QPNSA
3id3A           -----------------------------------------------------------------QPNSA
3id2A           -----------------------------------------------------------------QPNSA
2kjkA           ---------------------------------------------------------DGVYVLSVKEDVP
3i1eA           ---------------------------------------------------------DGVYVLSVKEDVP
2vspB           ----------------------------------------------------------GSFIKEVQKGGP
2vspA           ----------------------------------------------------------GSFIKEVQKGGP
2eejA           ----------------------------------------------------------GSFIKEVQKGGP
2dlsA           ------------------------------------------------------------LVQSVRPGGA
3ch8A           ---------------------------------------------------------DGIFVTRVQPEGP
2as9B           Y---------------------------------------------------------------------
1uf1A           ----------------------------------------------------------------------
2kjpA           ----------------------------------------------------------------------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVXXX
2zleA           AAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELXXXXXXXXXXXXIF
3cs0A           AAKAGIKAGDVITSLNGKPISSFAALRAQVGT-PVGSKLTLGLLRDGKQVNVNLELXXXXXXXXXXXXIF
1ky9B           AAKAGIKAGDVITSLNGKPISSFAALRAQV-GTPVGSKLTLGLLRDGKQVNVNLELXXXXXXXXXXXXIF
1ky9A           AAKAGIKAGDVITSLNGKPISSFAALRAQV-GTPVGSKLTLGLLRDGKQVNVNL----------------
1te0A           AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
2z9iB           AANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTV---------------------------
3gdvC           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
3gduC           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
3gdvA           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
3gduA           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
3gcoA           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
1l1jA           ----------------------------------------------------------------------
3gcnA           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
1y8tA           XXXXXXXXXXXXTKVDDRPINSADALVAAVRSKAPGATVALTFQDSGGSRTVQVTLGK------------
1vcwA           AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGS---------------------------------
3gdsA           AANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVV---------------------------
1sozB           AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVLQV--------------------------
1sozA           AANAGIQVNDLIISVDNKPA-----TMDQVAEIRPGSVIPVVVL--------------------------
1y8tB           ----------------------------------------------------------------------
2r3yC           AANAGIQVNDLIISVDNKPA-----TMDQVAEIRPGSVIPVVVL--------------------------
2r3yB           AANAGIQVNDLIISVDNKPA-----TMDQVAEIRPGSVIPVVVL--------------------------
2r3yA           AANAGIQVNDLIISVDNKPA-----TMDQVAEIRPGSVIPVVVL--------------------------
2z9iA           XXXXXXXXXXXXTKVDDRPINSADALVAAVRSKAPGATVALTFQDSGGSRTVQVTLGK------------
1sozC           ----------------------------------------------------------------------
1sotB           AANAGIQVNDLIISVDNKPAISALE---------------------------------------------
2qf3B           ----------------------------------------------------------------------
2r3uB           ----------------------------------------------------------------------
1sotC           AANAGIQVNDLIISVDNKPAISALETDQ-VAEIRPGSVI-------------------------------
2qf3C           ----------------------------------------------------------------------
3gdvB           AANAGIQVNDLIISVDNKPA--ILETMAQVAEIRPGSVIPVVTL--------------------------
1sotA           AANAGIQVNDLIISVDNKPAISALE---------------------------------------------
1y8tC           ----------------------------------------------------------------------
2z9iC           -VGAAVPKGVVVTKVD-RPINSADALVAAVRSKAPGATL-------------------------------
2r3uA           ----------------------------------------------------------------------
2qf3A           ----------------------------------------------------------------------
2rceC           ----------------------------------------------------------------------
2qf0F           ----------------------------------------------------------------------
2qf0C           ----------------------------------------------------------------------
2qf0B           ----------------------------------------------------------------------
2qf0H           ----------------------------------------------------------------------
2qf0E           ----------------------------------------------------------------------
2rceG           ----------------------------------------------------------------------
3gduB           AANAGIQVNDLI-SVDNKPLETMAQVAE----IRPGSVI-------------------------------
2rceD           ----------------------------------------------------------------------
2rceB           ----------------------------------------------------------------------
2r3uC           ----------------------------------------------------------------------
1lcyA           AHRAGLRPGDVILAIGEQMVQNAEDVYEAV----------------------------------------
3b8jA           ----------------------------------------------------------------------
2rceF           ----------------------------------------------------------------------
2qf0D           ----------------------------------------------------------------------
2rceH           ----------------------------------------------------------------------
2qf0G           ----------------------------------------------------------------------
2qf0A           ----------------------------------------------------------------------
2rceI           ----------------------------------------------------------------------
2rceA           ----------------------------------------------------------------------
2rceE           ----------------------------------------------------------------------
2qf0I           ----------------------------------------------------------------------
2qgrA           ----------------------------------------------------------------------
2p3wA           SQRGGIQDGDIIVKVNGRPLVDSSELQEAV----------------------------------------
2p3wB           SQRGGIQDGDIIVKVNGRPLVDSSELQEAV----------------------------------------
2v90C           AKKAGMQAGDRLVAVAGESVEGLEETVSRIQG--QGSCVSLTVVDPEADRETSV----------------
2v90A           AKKAGMQAGDRLVAVAGESVEGLEETVSRIQG--QGSCVSLTVVDPEADRETSV----------------
2ytwA           AEAGGLKENDVIISINGQSVVSANDVSDVI----------------------------------------
2kl1A           AA-GRLEAGDRIAAIDGQPINTSEQIVSYVREKQAGDRVRVTFIRDRKQHEAELVLKPFPH---------
2pzdA           AHRAGLRPGDVILAIGEQMVQNAEDVYEAV----------------------------------------
2joaA           AEAGGLKENDVIISINGQSVVSANDVSDVI----------------------------------------
3id4A           ASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRD-NPGKSLALEIERQGSPLSLTLIPESKPGNGKA-----
3id3A           ASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRD-NPGKSLALEIERQGSPLSLTLIPESKPGNGKA-----
3id2A           ASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRD-NPGKSLALEIERQGSPLSLTLIPESKPGNGKA-----
2kjkA           AAGI-LHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKL--------------
3i1eA           AAGI-LHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKL--------------
2vspB           ADLAGLEDEDVIIEVNGVNVLD------------------------------------------------
2vspA           ADLAGLEDEDVIIEVNGVNVLD------------------------------------------------
2eejA           ADLAGLEDEDVIIEVNGVNVLD------------------------------------------------
2dlsA           AMKAGVKEGDRIIKVNGTMVTNSSHL--------------------------------------------
3ch8A           ASKL-LQPGDKIIQANGYSFGQAVSLLKTF-----QNTVELIIVREGAKQEIRV----------------
2as9B           ----------------------------------------------------------------------
1uf1A           ----------------------------------------------------------------------
2kjpA           -AKGKIEVGDKIISADGKNYQSAEKLIDYISSKKAGDKVTLKIEREEKEKRVTLTLKQFPDE--------
1ky9A           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
2zleA           -----------------------NEMSNKGKDGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
3cs0A           --------NGIE-----------GAESNKGKDGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
1ky9B           ------------------------NESNKGKDGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
1ky9A           ----------------------------------------------------------------------
1te0A           ----------------------------------------------------------------------
2z9iB           ----------------------------------------------------------------------
3gdvC           ----------------------------------------------------------------------
3gduC           ----------------------------------------------------------------------
3gdvA           ----------------------------------------------------------------------
3gduA           ----------------------------------------------------------------------
3gcoA           ----------------------------------------------------------------------
1l1jA           ----------------------------------------------------------------------
3gcnA           ----------------------------------------------------------------------
1y8tA           ----------------------------------------------------------------------
1vcwA           ----------------------------------------------------------------------
3gdsA           ----------------------------------------------------------------------
1sozB           ----------------------------------------------------------------------
1sozA           ----------------------------------------------------------------------
1y8tB           ----------------------------------------------------------------------
2r3yC           ----------------------------------------------------------------------
2r3yB           ----------------------------------------------------------------------
2r3yA           ----------------------------------------------------------------------
2z9iA           ----------------------------------------------------------------------
1sozC           ----------------------------------------------------------------------
1sotB           ----------------------------------------------------------------------
2qf3B           ----------------------------------------------------------------------
2r3uB           ----------------------------------------------------------------------
1sotC           ----------------------------------------------------------------------
2qf3C           ----------------------------------------------------------------------
3gdvB           ----------------------------------------------------------------------
1sotA           ----------------------------------------------------------------------
1y8tC           ----------------------------------------------------------------------
2z9iC           ----------------------------------------------------------------------
2r3uA           ----------------------------------------------------------------------
2qf3A           ----------------------------------------------------------------------
2rceC           ----------------------------------------------------------------------
2qf0F           ----------------------------------------------------------------------
2qf0C           ----------------------------------------------------------------------
2qf0B           ----------------------------------------------------------------------
2qf0H           ----------------------------------------------------------------------
2qf0E           ----------------------------------------------------------------------
2rceG           ----------------------------------------------------------------------
3gduB           ----------------------------------------------------------------------
2rceD           ----------------------------------------------------------------------
2rceB           ----------------------------------------------------------------------
2r3uC           ----------------------------------------------------------------------
1lcyA           ----------------------------------------------------------------------
3b8jA           ----------------------------------------------------------------------
2rceF           ----------------------------------------------------------------------
2qf0D           ----------------------------------------------------------------------
2rceH           ----------------------------------------------------------------------
2qf0G           ----------------------------------------------------------------------
2qf0A           ----------------------------------------------------------------------
2rceI           ----------------------------------------------------------------------
2rceA           ----------------------------------------------------------------------
2rceE           ----------------------------------------------------------------------
2qf0I           ----------------------------------------------------------------------
2qgrA           ----------------------------------------------------------------------
2p3wA           ----------------------------------------------------------------------
2p3wB           ----------------------------------------------------------------------
2v90C           ----------------------------------------------------------------------
2v90A           ----------------------------------------------------------------------
2ytwA           ----------------------------------------------------------------------
2kl1A           ----------------------------------------------------------------------
2pzdA           ----------------------------------------------------------------------
2joaA           ----------------------------------------------------------------------
3id4A           ----------------------------------------------------------------------
3id3A           ----------------------------------------------------------------------
3id2A           ----------------------------------------------------------------------
2kjkA           ----------------------------------------------------------------------
3i1eA           ----------------------------------------------------------------------
2vspB           ----------------------------------------------------------------------
2vspA           ----------------------------------------------------------------------
2eejA           ----------------------------------------------------------------------
2dlsA           ----------------------------------------------------------------------
3ch8A           ----------------------------------------------------------------------
2as9B           ----------------------------------------------------------------------
1uf1A           --------------------------------GIYITGVDPGSEAEGSGLKVGDQILEVNGRS-------
2kjpA           ----------------------------------------------------------------------
1ky9A           ---------------LGIGTELNSELAKAKVDGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAAL
2p3wA           --------------------------------GIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSEL
2p3wB           ------------------TITPSLVDEPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSEL
2ytwA           --------------------------------GAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDV
2joaA           --------------------------------GAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDV


                         *         .         .         .         .         +         .:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVxxxxxx
2zleA           RKVL-----DSKPSVLLNIQRGDSTIYL--------
3cs0A           RKVL-----DSKPSVLLNIQRGDSTIYL--------
1ky9B           RKVL-----DSKPSVLLNIQRGDSTIYL--------
1ky9A           ------------------------------------
1te0A           ------------------------------------
2z9iB           ------------------------------------
3gdvC           ------------------------------------
3gduC           ------------------------------------
3gdvA           ------------------------------------
3gduA           ------------------------------------
3gcoA           ------------------------------------
1l1jA           ------------------------------------
3gcnA           ------------------------------------
1y8tA           ------------------------------------
1vcwA           ------------------------------------
3gdsA           ------------------------------------
1sozB           ------------------------------------
1sozA           ------------------------------------
1y8tB           ------------------------------------
2r3yC           ------------------------------------
2r3yB           ------------------------------------
2r3yA           ------------------------------------
2z9iA           ------------------------------------
1sozC           ------------------------------------
1sotB           ------------------------------------
2qf3B           ------------------------------------
2r3uB           ------------------------------------
1sotC           ------------------------------------
2qf3C           ------------------------------------
3gdvB           ------------------------------------
1sotA           ------------------------------------
1y8tC           ------------------------------------
2z9iC           ------------------------------------
2r3uA           ------------------------------------
2qf3A           ------------------------------------
2rceC           ------------------------------------
2qf0F           ------------------------------------
2qf0C           ------------------------------------
2qf0B           ------------------------------------
2qf0H           ------------------------------------
2qf0E           ------------------------------------
2rceG           ------------------------------------
3gduB           ------------------------------------
2rceD           ------------------------------------
2rceB           ------------------------------------
2r3uC           ------------------------------------
1lcyA           ------------------------------------
3b8jA           ------------------------------------
2rceF           ------------------------------------
2qf0D           ------------------------------------
2rceH           ------------------------------------
2qf0G           ------------------------------------
2qf0A           ------------------------------------
2rceI           ------------------------------------
2rceA           ------------------------------------
2rceE           ------------------------------------
2qf0I           ------------------------------------
2qgrA           ------------------------------------
2p3wA           ------------------------------------
2p3wB           ------------------------------------
2v90C           ------------------------------------
2v90A           ------------------------------------
2ytwA           ------------------------------------
2kl1A           ------------------------------------
2pzdA           ------------------------------------
2joaA           ------------------------------------
3id4A           ------------------------------------
3id3A           ------------------------------------
3id2A           ------------------------------------
2kjkA           ------------------------------------
3i1eA           ------------------------------------
2vspB           ------------------------------------
2vspA           ------------------------------------
2eejA           ------------------------------------
2dlsA           ------------------------------------
3ch8A           ------------------------------------
2as9B           ------------------------------------
1uf1A           ------------------------------------
2kjpA           ------------------------------------
1ky9A           RAQVGTPVGSKLTLGLLR------------------
2p3wA           QEAVLT-----ESPLLLEVRRGNDDLLFSI------
2p3wB           QEAVLT-----ESPLLLEVRRGNDDLLFSI------
2ytwA           SDVIK-----RESTLNMVVRRGNEDIMITV------
2joaA           SDVIK-----RESTLNMVVRRGNEDIMITV------