[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39379.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2v50A.bssp"
#ERROR : Can't open dsspfile "2v50B.bssp"
#ERROR : Can't open dsspfile "2v50D.bssp"
#ERROR : Can't open dsspfile "2v50E.bssp"
#ERROR : Can't open dsspfile "1iwgA.bssp"
#ERROR : Can't open dsspfile "2rddA.bssp"
#ERROR : Can't open dsspfile "1t9uA.bssp"
#ERROR : Can't open dsspfile "2hqgA.bssp"
#ERROR : Can't open dsspfile "2hqfA.bssp"
#ERROR : Can't open dsspfile "2hqdA.bssp"
#ERROR : Can't open dsspfile "2hqcA.bssp"
#ERROR : Can't open dsspfile "2dhhA.bssp"
#ERROR : Can't open dsspfile "2i6wA.bssp"
#ERROR : Can't open dsspfile "2j8sC.bssp"
#ERROR : Can't open dsspfile "2j8sB.bssp"
#ERROR : Can't open dsspfile "2j8sA.bssp"
#ERROR : Can't open dsspfile "2gifB.bssp"
#ERROR : Can't open dsspfile "2gifA.bssp"
#ERROR : Can't open dsspfile "3d9bA.bssp"
#ERROR : Can't open dsspfile "1t9wA.bssp"
#ERROR : Can't open dsspfile "1t9tA.bssp"

## Summary of PDB Search
:1070
    5e-43  23%  2v50A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    7e-42  23%  2v50B  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    2e-41  23%  2v50D  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    5e-38  23%  2v50E  [x.x.x] MULTIDRUG RESISTANCE PROTEIN MEXB
    4e-32  22%  1iwgA  [f.35.1 - d.58.44 - d.58.44 - d.225.1 - f.35.1 - d.58.44 -
    9e-32  22%  2rddA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    3e-29  21%  1t9uA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-20  22%  2hqgA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-20  22%  2hqfA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-20  22%  2hqdA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-20  22%  2hqcA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-20  22%  2dhhA  [x.x.x] ACRB
    1e-19  22%  2i6wA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  2j8sC  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  2j8sB  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  2j8sA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  2gifB  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  2gifA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    2e-19  23%  3d9bA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    9e-18  22%  1t9wA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
    8e-17  23%  1t9tA  [x.x.x] ACRIFLAVINE RESISTANCE PROTEIN B
:1070

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
2v50A           -------------WVIAL-VIMLA--GGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIE
2v50B           -------------WVIAL-VIMLA--GGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIE
2v50D           -------------WVIAL-VIMLA--GGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIE
2v50E           -------------WVIAL-VIMLA--GGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIE
1iwgA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2rddA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
1t9uA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2hqgA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2hqfA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2hqdA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2hqcA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2dhhA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2i6wA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2j8sC           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2j8sB           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2j8sA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2gifB           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
2gifA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
3d9bA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
1t9wA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
1t9tA           --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE


                         .         .         *         .         .         .         .:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
2v50A           QQMNGIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFL
2v50B           QQMNGIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFL
2v50D           QQMNGIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFL
2v50E           QQMNGIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFL
1iwgA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2rddA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
1t9uA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFL
2hqgA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2hqfA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2hqdA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2hqcA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2dhhA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2i6wA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2j8sC           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2j8sB           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2j8sA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2gifB           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
2gifA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
3d9bA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
1t9wA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFL
1t9tA           QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIXXXXXXXXXXXXMPLLPQEVQQQGVSVEKSSSSFL


                         +         .         .         .         .         *         .:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
2v50A           MVV-----GVVSTDGS-MTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QYSMRIWLDPAKLNSYQLTP
2v50B           MVV-----GVVSTDGS-MTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QYSMRIWLDPAKLNSYQLTP
2v50D           MVV-----GVVSTDGS-MTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QYSMRIWLDPAKLNSYQLTP
2v50E           MVV-----GVVSTDGS-MTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QYSMRIWLDPAKLNSYQLTP
1iwgA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2rddA           MVV-----GVINTDG-TMTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
1t9uA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2hqgA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2hqfA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2hqdA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2hqcA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2dhhA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2i6wA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2j8sC           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2j8sB           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2j8sA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2gifB           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
2gifA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
3d9bA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
1t9wA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
1t9tA           MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP


                         .         .         .         +         .         .         .:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
2v50A           GDVSSAIQAQNVQISSGQLAVKGQQLNATIIGKLQTAEQFENILLKNPDGSQVRLKDVADVGLGGQDYSI
2v50B           GDVSSAIQAQNVQISSGQLAVKGQQLNATIIGKLQTAEQFENILLKNPDGSQVRLKDVADVGLGGQDYSI
2v50D           GDVSSAIQAQNVQISSGQLGG-----LPAVKGQQLNATIIGKTRLQTAENILLKLKDVADVGLGGQDYSI
2v50E           GDVSSAIQAQNVQISSGQLAVKGQQLNATIIGKLQTAEQFENILLKNPDGSQVRLKDVADVGLGGQDYSI
1iwgA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2rddA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
1t9uA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2hqgA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2hqfA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2hqdA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2hqcA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2dhhA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2i6wA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2j8sC           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2j8sB           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2j8sA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2gifB           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
2gifA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
3d9bA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
1t9wA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
1t9tA           VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI


                         .         *         .         .         .         .         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
2v50A           NAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEA
2v50B           NAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEA
2v50D           NAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEA
2v50E           NAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEA
1iwgA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2rddA           IAEFNGQPASLGIKLXXXXXXXXXXXXXELAKMEPF---FPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
1t9uA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2hqgA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2hqfA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2hqdA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2hqcA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2dhhA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2i6wA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2j8sC           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2j8sB           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2j8sA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2gifB           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
2gifA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
3d9bA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
1t9wA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
1t9tA           IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA


                         .         .         .         .         *         .         .:420
query           XXXXXXXXXXXXGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGXXXXXXXXXXXXXXXENCLRL
2v50A           ILLVFLVMYLFLQNFRATLIPTIAVPVVLLFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2v50B           ILLVFLVMYLFLQNFRATLIPTIAVPVVLLFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2v50D           ILLVFLVMYLFLQNFRATLIPTIAVPVVLLFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2v50E           ILLVFLVMYLFLQNFRATLIPTIAVPVVLLFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
1iwgA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2rddA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
1t9uA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2hqgA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2hqfA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2hqdA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDAAIVVVENVERV
2hqcA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVADAIVVVENVERV
2dhhA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2i6wA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
2j8sC           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
2j8sB           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
2j8sA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
2gifB           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
2gifA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
3d9bA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
1t9wA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
1t9tA           IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------


                         .         .         +         .         .         .         .:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMAXXXXXXXXX
2v50A           MAEE-----GLSPREAARKSM-----GQIQGALVGAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
2v50B           MAEEG-----LSPREAARKSM-----GQIQGALVGAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
2v50D           MAEEG-----LSPREAARKSM-----GQIQGALVGAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
2v50E           MAEE-----GLSPREAARKSM-----GQIQGALVGAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
1iwgA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2rddA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
1t9uA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYR-QSITIVSAMAL
2hqgA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2hqfA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2hqdA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2hqcA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2dhhA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2i6wA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
2j8sC           ----------------------------------------------------------------------
2j8sB           ----------------------------------------------------------------------
2j8sA           ----------------------------------------------------------------------
2gifB           ----------------------------------------------------------------------
2gifA           ----------------------------------------------------------------------
3d9bA           ----------------------------------------------------------------------
1t9wA           MA-EEGLPPKEATRKSMGQ---------IQGALVGAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMAL
1t9tA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           XXXXXXXFVPAAVALMVTGKVSEKENWFMRLAHRTYXXXXXXXXXXXXXXXXXXXXXXXXSGYAATRMGG
2v50A           SVIVALILTPALCATMLKPFFGWFNRMFLSTTH-GYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPT
2v50B           SVIVALILTPALCATMLKGDHGEHKGWFNRMFLSTYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPT
2v50D           SVIVALILTPALCATMLKPFFGWFNRMFLSTTHG-YERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPT
2v50E           SVIVALILTPALCATMLKGDHGEHKGWFNRMFLSTYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPT
1iwgA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2rddA           SVLVALILTPALCATMLK-PIAKKGGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
1t9uA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2hqgA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2hqfA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2hqdA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2hqcA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2dhhA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2i6wA           SVLVALILTPALCATMLKPGFF---GWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
2j8sC           ----------------------------------------------------------------------
2j8sB           ----------------------------------------------------------------------
2j8sA           ----------------------------------------------------------------------
2gifB           ----------------------------------------------------------------------
2gifA           ----------------------------------------------------------------------
3d9bA           ----------------------------------------------------------------------
1t9wA           SVLVALILTPALCATML------KFGWFNRMFEKSYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPS
1t9tA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EFIPSLDEGDVAIQAMRIPGTSLTQSLEMQMALEKRLLAIPEVKEAFARTGTAEVATDPMPPSISDGYVM
2v50A           AFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEXXXXXXXFTVTGFNFAGRG---QSSGMAFIM
2v50B           AFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEXXXXXXXFTVTGFNFAGRGQ---SSGMAFIM
2v50D           AFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEXXXXXXXFTVTGFNFAGRGQ---SSGMAFIM
2v50E           AFLPDEDQGVLFAQVQTPPGSSAERTQVVVDSMREYLLEXXXXXXXFTVTGFNFAGRG---QSSGMAFIM
1iwgA           SFLPDEDQG-VFMTMVQLPAGATQERTQKVLNEVTHYYLTKEVESVFAVNGFGFAGRG---QNTGIAFVS
2rddA           SFLPDEDQG-VFMTMVQLPAGATQERTQKVLNEVTHYYLTKEVESVFAVNGFGFAGRG---QNTGIAFVS
1t9uA           SFLPDEDQG-VFMTMVQLPAGATQERTQKVLNEVTHYYLTKEVESVFAVNGFGFAGRGQ---NTGIAFVS
2hqgA           SFLPDEDQG-------------------------------------------------------------
2hqfA           SFLPDEDQG-------------------------------------------------------------
2hqdA           SFLPDEDQG-------------------------------------------------------------
2hqcA           SFLPDEDQG-------------------------------------------------------------
2dhhA           SFLPDEDQG-------------------------------------------------------------
2i6wA           SFLPDEDQG-------------------------------------------------------------
2j8sC           ----------------------------------------------------------------------
2j8sB           ----------------------------------------------------------------------
2j8sA           ----------------------------------------------------------------------
2gifB           ----------------------------------------------------------------------
2gifA           ----------------------------------------------------------------------
3d9bA           ----------------------------------------------------------------------
1t9wA           SFLPDEDQG-------------------------------------------------------------
1t9tA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LKPRDQWPDPKKPKLEVMKEIETASEEVAGNLYELSQPIQLRFNELISGVRSDVGVKIFGXXXXXXXXXX
2v50A           LKPWEERPGGENSVFELAKRAQMHFFSFKAMVFAFAPPSVLTGFDLFLQDQAGVGHEVL-------LQAR
2v50B           LKPWEERPGGENSVFELAKRAQM-------HFFSFKDAMVFAFAPSVLELGNATGFDLFLQDQAGVGHEV
2v50D           LKPWEERPGGENSVFELAKRAQMHFFSFKDAMVFAFAPPNATGFDLFLQDQAGVGHEVL-------LQAR
2v50E           LKPWEERPGGENSVFELAKRAQM-------HFFSFKDAMVFAFPDLFLQDQAGVGHEVL-------LQAR
1iwgA           LK---DWAD--RPGEE--NKVEAITMRATRAFSQIKDAMVFAFNELGTATGFDFEIDQAGLGHEKLTQAR
2rddA           LKDADRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVEFDELID--QAGLG---------HEKLTQ
1t9uA           LK---DWAD--RPGEE--NKVEAITMRATRAFSQIKDAMVFAFNELGTATGFDFEIDQAGLGHEKLTQAR
2hqgA           ----------------------------------------------------------------------
2hqfA           ----------------------------------------------------------------------
2hqdA           ----------------------------------------------------------------------
2hqcA           ----------------------------------------------------------------------
2dhhA           ----------------------------------------------------------------------
2i6wA           ----------------------------------------------------------------------
2j8sC           ----------------------------------------------------------------------
2j8sB           ----------------------------------------------------------------------
2j8sA           ----------------------------------------------------------------------
2gifB           ----------------------------------------------------------------------
2gifA           ----------------------------------------------------------------------
3d9bA           ----------------------------------------------------------------------
1t9wA           ----------------------------------------------------------------------
1t9tA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           XXXXXXXXTIKGAADVKTEQVAGLPVLTVKLDRQALARFGINVADVQSLVEIAVGGKSAGLVFEGDRRFD
2v50A           NKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGR---
2v50B           LLQARNKFLMLAAQNVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGR---
2v50D           NKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGR---
2v50E           NKFLMLAAQNPALQRVRPNGMSDEPQYKLEIDDEKASALGVSLADINSTVSIAWGSSYVNDFIDRGR---
1iwgA           NQLLAEAAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2rddA           ARNQLLAEAAKHPDMVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
1t9uA           NQLLAEAAKHPMLTSVRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2hqgA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2hqfA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2hqdA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2hqcA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2dhhA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2i6wA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2j8sC           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2j8sB           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2j8sA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2gifB           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
2gifA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
3d9bA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
1t9wA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK
1t9tA           ---------------VRPNGLEDTPQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKK


                         .         .         *         .         .         .         .:840
query           LVVRLPDHLRTDVEAIKRLPIPLPPADGQAKATPAVFGNSPLAQMRYAPLAELAEISVSPGPNQISREDG
2v50A           ---------------VKRVYLQGRP---DARMNPDDLSKWYVRNDKMVPFNAFATGKWEYGSPKLERYNG
2v50B           ---------------VKRVYLQGRP---DARMNPDDLSKWYVRNDKMVPFNAFATGKWEYGSPKLERYNG
2v50D           ---------------VKRVYLQGRP---DARMNPDDLSKWYVRNDKMVPFNAFATGKWEYGSPKLERYNG
2v50E           ---------------VKRVYLQGRP---DARMNPDDLSKWYVRNDKMVPFNAFATGKWEYGSPKLERYNG
1iwgA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2rddA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
1t9uA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2hqgA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2hqfA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2hqdA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2hqcA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2dhhA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2i6wA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2j8sC           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2j8sB           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2j8sA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2gifB           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
2gifA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
3d9bA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
1t9wA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG
1t9tA           VYV---------MSEAKYRMLPDDIGDWYVRA----------ADGQMVPFSAFSSSRWEYGSPRLERYNG


                         +         .         .         .         .         *         .:910
query           KRRIVVSANVRGRDLGSFVGEAQQLVAGKVKLPAGYWIGWGGQFEQLVSATERLTIVVPXXXXXXXXXXX
2v50A           VPAMILGEPAPGLSSGDAMAAVEEIVK---QLPKGVGYSWTGSYEERLSGSQALYALSLLVVFLCLAALY
2v50B           VPAMILGEPAPGLSSGDAMAAVEEIVK---QLPKGVGYSWTGSYEERLSGSQALSLLV---VFLCLAALY
2v50D           VPAMILGEPAPGLSSGDAMAAVEEIVK---QLPKGVGYSWTGSYEERLSGSQALSLLV---VFLCLAALY
2v50E           VPAMILGEPAPGLSSGDAMAAVEEIVK---QLPKGVGYSWTGSYEERLSGSQALYALSLLVVFLCLAALY
1iwgA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWSGNQAPSLYAISLIVVFL------CLAALY
2rddA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
1t9uA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGSYQERLSGNQALYAISLIVVFLCLAALY
2hqgA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2hqfA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2hqdA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2hqcA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2dhhA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2i6wA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2j8sC           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2j8sB           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2j8sA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2gifB           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
2gifA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
3d9bA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
1t9wA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGMSYQERLSGNQAPSLYAISLIVVFLCLA
1t9tA           ----LPSMEILGQAAGKSTGEAMELMEQLAKLPTGVGYDWTGSYQERLSGNQALYAISLIVVFLCLAALY


                         .         .         .         +         .         .         .:980
query           XXXXXXXDALLVFSGVPLALTGGIFALLLRGIPLSISAGIGFIALSGVAVLNGLVIITFIERLRGDGRKI
2v50A           ESWSIPFSVMLV---VPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGI
2v50B           ESWSIPFSVMLV---VPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGI
2v50D           ESWSIPFSVMLV---VPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGI
2v50E           ESWSIPFSVMLV---VPLGVIGALLATSMRGLSNDVFFQVGLLTTIGLSAKNAILIVEFAKELHEQGKGI
1iwgA           ESWSIPFSVMLV---VPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2rddA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
1t9uA           ESWSIPFSVMLV---VPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2hqgA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2hqfA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAANAILIVEFAKDLMDEGKGL
2hqdA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2hqcA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2dhhA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2i6wA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2j8sC           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2j8sB           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2j8sA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2gifB           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
2gifA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
3d9bA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
1t9wA           ALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL
1t9tA           ESWSIPFSVMLV---VPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDEGKGL


                         .         *         .         .         .         .         +:1050
query           VDAVREGALTRLRPVLMTALVASLGFVPMALATGAGAEVQRPLATVVIGGIVSSTILTLLVLPALYIxxx
2v50A           VEAAIEACRMRLRPIVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYV---
2v50B           VEAAIEACRMRLRPIVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYV---
2v50D           VEAAIEACRMRLRPIVMTSLAFILGVVPLAISTGAGSGSQHAIGTGVIGGMVTATVLAIFWVPLFYV---
2v50E           VEAAIEACRMRLRPIVMTSLAFILGVVPLAIGS------QHAIGTGVIGGMVTATVLAIFWVPLFYV---
1iwgA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2rddA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
1t9uA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2hqgA           IEATLDAVRMRLRPILMASLAFILGVMPLVISTGAGSGAQ------------------------------
2hqfA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2hqdA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2hqcA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2dhhA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2i6wA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2j8sC           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2j8sB           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2j8sA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2gifB           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
2gifA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
3d9bA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
1t9wA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------
1t9tA           IEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGAQ------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxx
2v50A           --------------------
2v50B           --------------------
2v50D           --------------------
2v50E           --------------------
1iwgA           --------------------
2rddA           --------------------
1t9uA           --------------------
2hqgA           --------------------
2hqfA           --------------------
2hqdA           --------------------
2hqcA           --------------------
2dhhA           --------------------
2i6wA           --------------------
2j8sC           --------------------
2j8sB           --------------------
2j8sA           --------------------
2gifB           --------------------
2gifA           --------------------
3d9bA           --------------------
1t9wA           --------------------
1t9tA           --------------------