[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39396.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vs0A.bssp"
#ERROR : Can't open dsspfile "1vs0B.bssp"
#ERROR : Can't open dsspfile "2cfmA.bssp"
#ERROR : Can't open dsspfile "1x9nA.bssp"

## Summary of PDB Search
:313
    1e-14  31%  1vs0A  [x.x.x] PUTATIVE DNA LIGASE-LIKE PROTEIN RV0938/MT0965
    1e-14  30%  1vs0B  [x.x.x] PUTATIVE DNA LIGASE-LIKE PROTEIN RV0938/MT0965
    4e-09  33%  2cfmA  [x.x.x] THERMOSTABLE DNA LIGASE
    3e-07  36%  1x9nA  [a.235.1 - d.142.2 - b.40.4] DNA LIGASE I
:313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1vs0A           ----------------------------------------------------------------------
1vs0B           ----------------------------------------------------------------------
2cfmA           ----------------------------------------------------------------------
1x9nA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFYAFDLLHLDGYDLGPVP
1vs0A           ----------------------------------------------------FWAFDLLYLDGRALLGTR
1vs0B           ----------------------------------------------------FWAFDLLYLDGRALLGTR
2cfmA           -------------------------------------------------------FDVLYVDGQSLIDTK
1x9nA           -----------------------------------------------------YAFDLIYLNGESLVREP


                         +         .         .         .         .         *         .:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
1vs0A           YQDRRKLLETLANASLTVPELLPG---DGAQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNT
1vs0B           YQDRRKLLETLANASLTVPELLPG---DGAQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNT
2cfmA           FIDRRRTLEEIIKQNEKIKVLITKKVEEAEAFYKRALE-GHEGL-AKRLDAVYEPGNRGKKWLKIKPTEN
1x9nA           LSRRRQLLRENFVE-TEGEFVFATSLDTKDEFLEQSVKDSCEGLVTLDVDATYEIAKRSHNWLKLKKDYL


                         .         .         .         +         .         .         .:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETXXXXXXXXXXXXXXX
1vs0A           QEVVIGGWRAVXXXXXXXXXXXXQ-----FAGRVGTGLSERELANLKEPLHTDESPFDVPLPARDAKGIT
1vs0B           QEVVIGGWAXXXXXXXXXXXXXXXXXXXQFAGRVGTGLSERELANLKEPLHTDESPFDVPLPARDAKGIT
2cfmA           LDLVIIGAEWGEGGSFILGAYDPETGEFLEVGKVGSGFT-------------------------------
1x9nA           DDLVVIGAYLGRGKRAGRYLASYDEDSLQAICKLGTGFS-------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXMSADVEYRDITASGHLRHASFKGLxxxx
1vs0A           YVKPALVAEVRYSEWTPEGRLRQSSWRGL----
1vs0B           YVKPALVAEVRYSEWTPEGRLRQSSWRGL----
2cfmA           ---------------------------------
1x9nA           ---------------------------------