[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vbjB.bssp"
#ERROR : Can't open dsspfile "1vbjA.bssp"
#ERROR : Can't open dsspfile "1zuaX.bssp"
#ERROR : Can't open dsspfile "3f7jA.bssp"
#ERROR : Can't open dsspfile "3d3fA.bssp"
#ERROR : Can't open dsspfile "3h4gA.bssp"
#ERROR : Can't open dsspfile "3cv7A.bssp"
#ERROR : Can't open dsspfile "2ao0A.bssp"
#ERROR : Can't open dsspfile "1hqtA.bssp"
#ERROR : Can't open dsspfile "2ipwA.bssp"
#ERROR : Can't open dsspfile "2i16A.bssp"
#ERROR : Can't open dsspfile "1z8aA.bssp"
#ERROR : Can't open dsspfile "1xgdA.bssp"
#ERROR : Can't open dsspfile "1us0A.bssp"
#ERROR : Can't open dsspfile "1pwmA.bssp"
#ERROR : Can't open dsspfile "2pdyA.bssp"
#ERROR : Can't open dsspfile "2pdxA.bssp"
#ERROR : Can't open dsspfile "2pdqA.bssp"
#ERROR : Can't open dsspfile "2pdmA.bssp"
#ERROR : Can't open dsspfile "2pdkA.bssp"
#ERROR : Can't open dsspfile "2pdiA.bssp"
#ERROR : Can't open dsspfile "2pdhA.bssp"
#ERROR : Can't open dsspfile "2pdfA.bssp"
#ERROR : Can't open dsspfile "2pdbA.bssp"
#ERROR : Can't open dsspfile "2pd5A.bssp"
#ERROR : Can't open dsspfile "2ikiA.bssp"
#ERROR : Can't open dsspfile "3h7uA.bssp"
#ERROR : Can't open dsspfile "1el3A.bssp"
#ERROR : Can't open dsspfile "2dv0A.bssp"
#ERROR : Can't open dsspfile "1az1A.bssp"
#ERROR : Can't open dsspfile "2agtA.bssp"
#ERROR : Can't open dsspfile "1adsA.bssp"
#ERROR : Can't open dsspfile "2acsA.bssp"
#ERROR : Can't open dsspfile "2is7A.bssp"
#ERROR : Can't open dsspfile "1j96B.bssp"
#ERROR : Can't open dsspfile "2acuA.bssp"
#ERROR : Can't open dsspfile "1zgdA.bssp"
#ERROR : Can't open dsspfile "1ah3A.bssp"
#ERROR : Can't open dsspfile "1ah0A.bssp"
#ERROR : Can't open dsspfile "1xjbB.bssp"
#ERROR : Can't open dsspfile "1xjbA.bssp"
#ERROR : Can't open dsspfile "1mrqA.bssp"
#ERROR : Can't open dsspfile "1j96A.bssp"
#ERROR : Can't open dsspfile "1ihiA.bssp"
#ERROR : Can't open dsspfile "3c3uA.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "2ipjA.bssp"
#ERROR : Can't open dsspfile "1c9wA.bssp"
#ERROR : Can't open dsspfile "3h7rA.bssp"
#ERROR : Can't open dsspfile "1frbA.bssp"
#ERROR : Can't open dsspfile "1ynqA.bssp"
#ERROR : Can't open dsspfile "3erpB.bssp"
#ERROR : Can't open dsspfile "3b3dB.bssp"
#ERROR : Can't open dsspfile "3b3dA.bssp"
#ERROR : Can't open dsspfile "2alrA.bssp"
#ERROR : Can't open dsspfile "1q13B.bssp"
#ERROR : Can't open dsspfile "1mzrB.bssp"
#ERROR : Can't open dsspfile "1mzrA.bssp"
#ERROR : Can't open dsspfile "3erpA.bssp"
#ERROR : Can't open dsspfile "1ynpA.bssp"
#ERROR : Can't open dsspfile "1q5mA.bssp"
#ERROR : Can't open dsspfile "2fgbA.bssp"
#ERROR : Can't open dsspfile "1z9aA.bssp"
#ERROR : Can't open dsspfile "1mi3A.bssp"
#ERROR : Can't open dsspfile "1zq5A.bssp"
#ERROR : Can't open dsspfile "1ye4A.bssp"
#ERROR : Can't open dsspfile "1sm9A.bssp"
#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "1k8cA.bssp"
#ERROR : Can't open dsspfile "2fvlA.bssp"
#ERROR : Can't open dsspfile "1s1rA.bssp"
#ERROR : Can't open dsspfile "1s1pA.bssp"
#ERROR : Can't open dsspfile "1ry0A.bssp"
#ERROR : Can't open dsspfile "2bgqA.bssp"
#ERROR : Can't open dsspfile "1ynpB.bssp"
#ERROR : Can't open dsspfile "3caqB.bssp"
#ERROR : Can't open dsspfile "3burA.bssp"
#ERROR : Can't open dsspfile "1m9hA.bssp"
#ERROR : Can't open dsspfile "3cv6A.bssp"
#ERROR : Can't open dsspfile "1r38A.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "2bgsA.bssp"
#ERROR : Can't open dsspfile "1jezA.bssp"
#ERROR : Can't open dsspfile "1ralA.bssp"
#ERROR : Can't open dsspfile "1jezB.bssp"
#ERROR : Can't open dsspfile "1afsA.bssp"
#ERROR : Can't open dsspfile "1qwkA.bssp"
#ERROR : Can't open dsspfile "1hw6A.bssp"
#ERROR : Can't open dsspfile "1lwiA.bssp"
#ERROR : Can't open dsspfile "2he8A.bssp"
#ERROR : Can't open dsspfile "1vp5B.bssp"
#ERROR : Can't open dsspfile "1vp5A.bssp"
#ERROR : Can't open dsspfile "2p5nA.bssp"
#ERROR : Can't open dsspfile "2hejA.bssp"
#ERROR : Can't open dsspfile "2he8B.bssp"
#ERROR : Can't open dsspfile "1xf0A.bssp"
#ERROR : Can't open dsspfile "2he5C.bssp"
#ERROR : Can't open dsspfile "2ipgA.bssp"
#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1og6C.bssp"
#ERROR : Can't open dsspfile "1og6B.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1ur3M.bssp"
#ERROR : Can't open dsspfile "1zsxA.bssp"
#ERROR : Can't open dsspfile "3eb3A.bssp"
#ERROR : Can't open dsspfile "1qrqA.bssp"
#ERROR : Can't open dsspfile "1exbA.bssp"
#ERROR : Can't open dsspfile "3eb4A.bssp"
#ERROR : Can't open dsspfile "3eauA.bssp"
#ERROR : Can't open dsspfile "2bp1B.bssp"
#ERROR : Can't open dsspfile "2bp1A.bssp"
#ERROR : Can't open dsspfile "2c91B.bssp"
#ERROR : Can't open dsspfile "2c91A.bssp"
#ERROR : Can't open dsspfile "1gveB.bssp"
#ERROR : Can't open dsspfile "2clpI.bssp"
#ERROR : Can't open dsspfile "2clpA.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"

## Summary of PDB Search
:281
    1e-26  33%  1vbjB  [x.x.x] PROSTAGLANDIN F SYNTHASE
    1e-26  33%  1vbjA  [x.x.x] PROSTAGLANDIN F SYNTHASE
    7e-26  37%  1zuaX  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER B10
    3e-25  33%  3f7jA  [x.x.x] YVGN PROTEIN
    3e-25  33%  3d3fA  [x.x.x] YVGN PROTEIN
    1e-22  34%  3h4gA  [x.x.x] ALCOHOL DEHYDROGENASE [NADP+]
    1e-22  34%  3cv7A  [x.x.x] ALCOHOL DEHYDROGENASE
    1e-22  34%  2ao0A  [x.x.x] ALDEHYDE DEHYDROGENASE
    4e-22  34%  1hqtA  [c.1.7] ALDEHYDE REDUCTASE
    2e-20  31%  2ipwA  [x.x.x] ALDOSE REDUCTASE
    5e-20  31%  2i16A  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  1z8aA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  1xgdA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  1us0A  [c.1.7] ALDOSE REDUCTASE
    6e-20  31%  1pwmA  [c.1.7] ALDOSE REDUCTASE
    6e-20  31%  2pdyA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdxA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdqA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdmA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdkA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdiA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdhA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdfA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pdbA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2pd5A  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2ikiA  [x.x.x] ALDOSE REDUCTASE
    6e-20  35%  3h7uA  [x.x.x] ALDO-KETO REDUCTASE
    6e-20  31%  1el3A  [c.1.7] ALDOSE REDUCTASE
    6e-20  31%  2dv0A  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  1az1A  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  2agtA  [x.x.x] ALDOSE REDUCTASE
    6e-20  31%  1adsA  [c.1.7 (1ef3A)] ALDOSE REDUCTASE
    6e-20  31%  2acsA  [x.x.x] ALDOSE REDUCTASE
    8e-20  31%  2is7A  [x.x.x] ALDOSE REDUCTASE
    2e-19  34%  1j96B  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    2e-19  31%  2acuA  [x.x.x] ALDOSE REDUCTASE
    5e-19  37%  1zgdA  [x.x.x] CHALCONE REDUCTASE
    7e-19  29%  1ah3A  [c.1.7 (1ekoA)] ALDOSE REDUCTASE
    7e-19  29%  1ah0A  [x.x.x] ALDOSE REDUCTASE
    9e-19  34%  1xjbB  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    9e-19  34%  1xjbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    9e-19  33%  1mrqA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    9e-19  34%  1j96A  [c.1.7] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 3
    9e-19  34%  1ihiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    9e-19  33%  3c3uA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    2e-18  38%  1pz1A  [c.1.7] GENERAL STRESS PROTEIN 69
    3e-18  34%  2ipjA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C2
    3e-18  32%  1c9wA  [c.1.7] CHO REDUCTASE
    7e-18  34%  3h7rA  [x.x.x] ALDO-KETO REDUCTASE
    9e-18  31%  1frbA  [x.x.x] FR-1 PROTEIN
    1e-17  33%  1ynqA  [x.x.x] OXIDOREDUCTASE
    2e-17  32%  3erpB  [x.x.x] PUTATIVE OXIDOREDUCTASE
    2e-17  26%  3b3dB  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    2e-17  26%  3b3dA  [x.x.x] PUTATIVE MORPHINE DEHYDROGENASE
    2e-17  38%  2alrA  [x.x.x] ALDEHYDE REDUCTASE
    4e-17  30%  1q13B  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    4e-17  30%  1mzrB  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    4e-17  30%  1mzrA  [c.1.7] 2,5-DIKETO-D-GLUCONATE REDUCTASE A
    6e-17  32%  3erpA  [x.x.x] PUTATIVE OXIDOREDUCTASE
    8e-17  34%  1ynpA  [x.x.x] OXIDOREDUCTASE
    8e-17  30%  1q5mA  [c.1.7] PROSTAGLANDIN-E2 9-REDUCTASE
    2e-16  29%  2fgbA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-16  37%  1z9aA  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    2e-16  37%  1mi3A  [c.1.7] XYLOSE REDUCTASE
    5e-16  30%  1zq5A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    5e-16  37%  1ye4A  [x.x.x] NAD(P)H-DEPENDENT D-XYLOSE REDUCTASE
    5e-16  37%  1sm9A  [c.1.7] XYLOSE REDUCTASE
    5e-16  31%  1a80A  [x.x.x] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    7e-16  36%  1k8cA  [c.1.7] XYLOSE REDUCTASE
    7e-16  30%  2fvlA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C4
    1e-15  30%  1s1rA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    1e-15  30%  1s1pA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    1e-15  30%  1ry0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    2e-15  32%  2bgqA  [x.x.x] ALDOSE REDUCTASE
    2e-15  33%  1ynpB  [x.x.x] OXIDOREDUCTASE
    2e-15  31%  3caqB  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    2e-15  31%  3burA  [x.x.x] 3-OXO-5-BETA-STEROID 4-DEHYDROGENASE
    3e-15  31%  1m9hA  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    3e-15  33%  3cv6A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C21
    3e-15  37%  1r38A  [c.1.7] XYLOSE REDUCTASE
    3e-15  39%  1lqaA  [c.1.7] TAS PROTEIN
    3e-15  30%  2bgsA  [x.x.x] ALDOSE REDUCTASE
    4e-15  37%  1jezA  [c.1.7] XYLOSE REDUCTASE
    6e-15  33%  1ralA  [x.x.x] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    6e-15  37%  1jezB  [c.1.7] XYLOSE REDUCTASE
    6e-15  33%  1afsA  [c.1.7] 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-15  27%  1qwkA  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C1
    7e-15  32%  1hw6A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    2e-14  35%  1lwiA  [c.1.7] 3-ALPHA-HYDROXYSTEROID/DIHYDRODIOL DEHYDROGENASE
    2e-14  33%  2he8A  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    3e-14  33%  1vp5B  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    3e-14  33%  1vp5A  [c.1.7] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE
    3e-14  33%  2p5nA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    3e-14  33%  2hejA  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    3e-14  33%  2he8B  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    4e-14  30%  1xf0A  [c.1.7] ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
    4e-14  33%  2he5C  [x.x.x] ALDO-KETO REDUCTASE FAMILY 1, MEMBER C21
    5e-14  35%  2ipgA  [x.x.x] 3(17)ALPHA-HYDROXYSTEROID DEHYDROGENASE
    7e-13  30%  1pyfA  [c.1.7] IOLS PROTEIN
    7e-13  37%  1og6C  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    7e-13  37%  1og6B  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    7e-13  37%  1og6A  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    6e-12  35%  1ur3M  [c.1.7] HYPOTHETICAL OXIDOREDUCTASE YDHF
    9e-11  30%  1zsxA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL BETA-2 SUBUNIT
    9e-11  30%  3eb3A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    1e-10  30%  1qrqA  [c.1.7] PROTEIN (KV BETA2 PROTEIN)
    1e-10  30%  1exbA  [c.1.7] KV BETA2 PROTEIN
    1e-10  30%  3eb4A  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    1e-10  30%  3eauA  [x.x.x] VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT BETA-2
    2e-09  29%  2bp1B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    1e-08  30%  2bp1A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    2e-08  28%  2c91B  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    2e-08  28%  2c91A  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 2
    1e-07  29%  1gveB  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
    2e-07  30%  2clpI  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    2e-07  30%  2clpA  [x.x.x] AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
    4e-07  28%  1gveA  [c.1.7] AFLATOXIN B1 ALDEHYDE REDUCTASE
:281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
1vbjB           -----------------LGFGMWKLQDGNE--AETATMWAIKSGYRHIDTAAIYKNEESAAIASCGVPRE
1vbjA           -----------------LGFGMWKLQDGNE--AETATMWAIKSGYRHIDTAAIYKNEESAAIASCGVPRE
1zuaX           -----------------VGLGTWKSPLGKVKEAVKV---AIDAGYRHIDCAYVYQN-EHEVGEAIQEKRE
3f7jA           -----------GVEMPWFGLGVFKVENGNE--ATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESARE
3d3fA           -----------GVEMPWFGLGVFKVENGNE--ATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESARE
3h4gA           -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALTVGYRHIDCAAIYGN-ELEIGEALQETRE
3cv7A           -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALTVGYRHIDCAAIYGN-ELEIGEALQETRE
2ao0A           -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALTVGYRHIDCAAIYGN-ELEIGEALQETRE
1hqtA           -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALTVGYRHIDCAAIFGN-ELEIGEALQETRE
2ipwA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2i16A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1z8aA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1xgdA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1us0A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1pwmA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdyA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdxA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdqA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdmA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdkA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdiA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdhA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdfA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pdbA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2pd5A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHIYQN-ENEVGVAIQEKRE
2ikiA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
3h7uA           -----------GAKFPSVGLGTWQASPGLVGDAVAA---AVKIGYRHIDCAQIYGNEKEIGAEDRVVKRE
1el3A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2dv0A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1az1A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2agtA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1adsA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2acsA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
2is7A           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
1j96B           -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
2acuA           -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVHQN-ENEVGVAIQEKRE
1zgdA           -----------------------------------AIIEAIKQGYRHFDTAAAYGSEQALLKEAIEVTRD
1ah3A           -----------GAKMPILGLGTWKSPPGKVTEAVKV---AIDLGYRHIDCAHVYQNENEVLQEKLQGKRE
1ah0A           -----------GAKMPILGLGTWKSPPGKVTEAVKV---AIDLGYRHIDCAHVYQNENEVLQEKLQGKRE
1xjbB           -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
1xjbA           -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
1mrqA           -----------------LGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQIRSKIADGKRE
1j96A           -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
1ihiA           -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
3c3uA           -----------------LGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQIRSKIADGKRE
1pz1A           ----------------------------DEKTSIETIRAALDQGITLIDTAPAYGQSEEIVGKAIEYKRD
2ipjA           -----------------LGFGTAAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
1c9wA           -----------------VGLGTWQSPPGQVKEAVKV---AIDAGYRHIDCAYAYYN-EHEVGEAIQERRE
3h7rA           -----------GAKLPCVGLGTYAM-------VATAIEQAIKIGYRHIDCASIYGNEKEIVLKKLIGKRE
1frbA           -----------------VGLGTW---KSPPNQVKEAVKAAIDAGYRHIDCAYAYCN-ENEVGEAIQEKRE
1ynqA           -----RQLGTSDLHVSELGFGCMSLGT-DETKARRIMDEVLELGINYLDTADLYNQGEQFVGKALKGRRQ
3erpB           -----RRCGRSGVKLPAISLGLWH-NFGDTTRSRALLQRAFDLGITHFDLANNYG-PPPGSAECNFGRRD
3b3dB           -----------GVEMPWFGLGVFQVEEGSEL--VNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXX
3b3dA           -----------GVEMPWFGLGVFQVEEGSEL--VNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXX
2alrA           -----------GQKMPLIGLGTWKSEPGQVKAAV---KYALSVGYRHIDCAAIYGN-EPEIGEALKGKRE
1q13B           -----------GHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKAIRSKIADGKRE
1mzrB           -----------GNVMPQLGLGVW---QASNEEVITAIQKALEVGYRSIDTAAAYKNEEG-VGKALKNNRE
1mzrA           -----------GNVMPQLGLGVW---QASNEEVITAIQKALEVGYRSIDTAAAYKNEEG-VGKALKNNRE
3erpA           -----RRCGRSGVKLPAISLGLWH-NFGDTTRSRALLQRAFDLGITHFDLANNYG-PPPGSAECNFGRRD
1ynpA           -----RQLGTSDLHVSELGFGCMSLGT-DETKARRIMDEVLELGINYLDTADLYNQGEQFVGKALKGRRQ
1q5mA           -----------GHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKAIRSKIADGKRE
2fgbA           -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
1z9aA           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1mi3A           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1zq5A           -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
1ye4A           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1sm9A           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1a80A           -----------GNSIPQLGYGVFKVPPADTQRAV---EEALEVGYRHIDTAAIYGNEEGVXXXXXXXXRD
1k8cA           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
2fvlA           -----------------LGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQIRSKIADGKRE
1s1rA           -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
1s1pA           -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
1ry0A           -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
2bgqA           ---------KSGHAMPAVGLGTWDTAHSVRTAITEA-------GYRHVDTAAEYG-VEKEVGKGLKAARK
1ynpB           -----RQLGTSDLHVSELGFGCMSLGT-DETKARRIMDEVLELGINYLDTADLYNQGEQFVGKALKGRRQ
3caqB           -----------GNSIPIIGLGTYSEPKSTPKGACASVKVAIDTGYRHIDGAYIYQN-EHEVGEAIEGRRE
3burA           -----------GNSIPIIGLGTYSEPKSTPKGACASVKVAIDTGYRHIDGAYIYQN-EHEVGEAIEGRRE
1m9hA           -----------GNSIPQLGYGVYKVPPADTQRAV---EEALEVGYRHIDTAAIYGNEEGVXXXXXXXXRD
3cv6A           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
1r38A           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1lqaA           -------------EVSTLGLGTMFGEQNSEADAHAQLDYAVAQGINLIDVAEMYGLTETYVGNAKHGSRE
2bgsA           ---------KSGHAMPAVGLGTW---RAGSDTAHSVRTAITEAGYRHVDTAAEYG-VEKEVGKGLKAARK
1jezA           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1ralA           -----------GNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLY-EVEEEVGQAIDGKRE
1jezB           -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
1afsA           -----------GNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLY-EVEEEVGQAIDGKRE
1qwkA           -----------GVEMPVIGLGTW---QSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIIKELLEEKRE
1hw6A           -----------GNSIPQLGYGVFKVPPADTQRAV---EEALEVGYRHIDTAAIYGNEEGVXXXXXXXXRD
1lwiA           ---------------------------------IKATKIAIDNGFRHFDSAYLY-EVEEEVGQAIDGKRE
2he8A           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
1vp5B           -----------GVEMPILGYGVFQIPPEKTEECVY---EAIKVGYRLIDTAASYMNEEGVIKRAIDERRE
1vp5A           -----------GVEMPILGYGVFQIPPEKTEECVY---EAIKVGYRLIDTAASYMNEEGVIKRAIDERRE
2p5nA           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
2hejA           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
2he8B           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
1xf0A           --------------------------------ALEVTKLAIEAGFRHIDSAHLYNNEEQIRSKIADGKRE
2he5C           -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
2ipgA           ----------------------------------------IDAGFHHFDSASVY-NTEDHVGEAIDGRRE
1pyfA           ------KLGKSDLQVFPIGLGTLYPNLNEETGK-ELVREAIRNGVT-LDTAYIYGRSEELIGEVLEFNRE
1og6C           -----------GPEFSRFVMGYWRLMDWNMSARVSFIEEHLDLGVTTVDHADIYGQCEAAFGEALKHLRE
1og6B           -----------GPEFSRFVMGYWRLMDWNMSARVSFIEEHLDLGVTTVDHADIYGQCEAAFGEALKHLRE
1og6A           -----------GPEFSRFVMGYWRLMDWNMSARVSFIEEHLDLGVTTVDHADIYGQCEAAFGEALKHLRE
1ur3M           -----------GPEFSRF-VGYWRLDWNSARQLVSFIEEHLDLGVTTVDHADIYGQCEAAFGEALKPHLR
1zsxA           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
3eb3A           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
1qrqA           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
1exbA           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
3eb4A           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
3eauA           -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
2bp1B           --------------------------RMDAPASAAAVRAFLERGHTELDTAFMYGQSETIXXXXXXXXXC
2bp1A           --------------------------RMDAPASAAAVRAFLERGHTELDTAFMYSDGQ---SETIXXXXX
2c91B           --------------------------RMDASASAASVRAFLERGHSELDTAFMYGQSENIXXXXXXXXXX
2c91A           --------------------------RMDASASAASVRAFLERGHSELDTAFMYGQSENIXXXXXXXXXX
1gveB           --------------------------RMDVTSSSASVRAFLQRGHTEIDTAFVYANGQ---SETIXXXXX
2clpI           --------------------------RMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQ---SETIXXXXX
2clpA           --------------------------RMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQ---SETIXXXXX
1gveA           --------------------------RMDVTSSSRSVRAFLQRGHTEIDTAFVYANGQ---SETIXXXXX


                         .         .         *         .         .         .         .:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
1vbjB           ELFVTTKLWNSDQGYESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFIDTWKAFEKLYADKKVRAIGVSN
1vbjA           ELFVTTKLWNSDQGYESTLSAFEKSIKKLGLEYVDLYLIHWPGKDKFIDTWKAFEKLYADKKVRAIGVSN
1zuaX           DLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWGGKATFLDAWEAMEELVDEGLVKALGVSN
3f7jA           ELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSN
3d3fA           ELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSN
3h4gA           ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGTIRYKDTWKALEALVAKGLVRALGLSN
3cv7A           ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGTIRYKDTWKALEALVAKGLVRALGLSN
2ao0A           ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGTIRYKDTWKALEALVAKGLVRALGLSN
1hqtA           ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGTIRYKDTWKALEALVAKGLVRALGLSN
2ipwA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2i16A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1z8aA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1xgdA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1us0A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1pwmA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdyA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdxA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdqA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdmA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdkA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdiA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdhA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdfA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pdbA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2pd5A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2ikiA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
3h7uA           DLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLIHWPARIKIPSTWKAMEALYDSGKARAIGVSN
1el3A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2dv0A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1az1A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2agtA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1adsA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2acsA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
2is7A           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1j96B           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFPVSVKLFDTVEAMEKCKDAGLAKSIGVSN
2acuA           ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
1zgdA           DLFVTSKLWVTENHPHLVIPALQKSLKTLQLDYLDLYLIHWPGKFSFPIDVASMEESLKLGLTKAIGVSN
1ah3A           DLFIVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPTGFKFVETWEAMEELVDEGLVKAIGVSN
1ah0A           DLFIVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPTGFKFVETWEAMEELVDEGLVKAIGVSN
1xjbB           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
1xjbA           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
1mrqA           DIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAVEKCKDAGLAKSIGVSN
1j96A           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
1ihiA           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
3c3uA           DIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAVEKCKDAGLAKSIGVSN
1pz1A           QVILATKTLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVPIEETAEVKELYDAGKIRAIGVSN
2ipjA           DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
1c9wA           DLFIVSKLWPTCFERKLLKEAFQXXXXXXXXXXXXXXXIHWTSKITFLDAWEVMEELVDEGLVKALGVSN
3h7rA           ELFITSKLWSNDHLPEDVPKALEKTLQDLQIDYVDLYLIHWPASLKITSTWKAMEALYDSGKARAIGVSN
1frbA           DLFIVSKLWPTCFEKKLLKEAFQXXXXXXXXXXXXXXXIHWQGRILTSKTTEGMEELVDQGLVKALGVSN
1ynqA           DIILATKVWWWDPSKAYIKEAVKDSLRRLQTDYIDLYQLH-GGTIPIDETIEAFEELKQEGVIRYYGISS
3erpB           ELIISTKAYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDETPLKETMKALDHLVRHGKALYVGISN
3b3dB           DLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSN
3b3dA           DLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSN
2alrA           ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWRGSTHYKETWKALEALVAKGLVQALGLSN
1q13B           DIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFHGKVDICATWEAMEKCKDAGLAKSIGVSN
1mzrB           ELFITTKLWNDDHKRPRE--ALLDSLKKLQLDYIDLYLMHWPVPAHYVEAWKGMIELQKEGLIKSIGVCN
1mzrA           ELFITTKLWNDDHKRPRE--ALLDSLKKLQLDYIDLYLMHWPVPAHYVEAWKGMIELQKEGLIKSIGVCN
3erpA           ELIISTKAYGDWGSRKYLIASLDQSLKRMGLEYVDIFYHHRPDETPLKETMKALDHLVRHGKALYVGISN
1ynpA           DIILATKV-----SKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDIDETIEAFEELKQEGVIRYYGISS
1q5mA           DIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFHGKVDICATWEAMEKCKDAGLAKSIGVSN
2fgbA           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKLCTTWEAMEKCKDAGLAKSIGVSN
1z9aA           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1mi3A           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1zq5A           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSNGKVDLCTTWEAMEKCKDAGLAKSIGVSN
1ye4A           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1sm9A           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1a80A           DLFITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHW--PTPAADNVHAWEELRAAGLTRSIGVSN
1k8cA           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
2fvlA           DIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFNGKVDLSATWEVMEKCKDAGLAKSIGVSN
1s1rA           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEKCKDAGLAKSIGVSN
1s1pA           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEKCKDAGLAKSIGVSN
1ry0A           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEKCKDAGLAKSIGVSN
2bgqA           DLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWAGEVLEFDMEGVWKELVKDGLVKDIGVCN
1ynpB           DIILATKVGNRDPSKAYIKEAVKDSLRRLQTDYIDLYQLHG-GTIDIDETIEAFEELKQEGVIRYYGISS
3caqB           DIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEWLHKSNLCATWEAMEACKDAGLVKSLGVSN
3burA           DIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEWLHKSNLCATWEAMEACKDAGLVKSLGVSN
1m9hA           DLFITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHW--PTPAADNVHAWEELRAAGLTRSIGVSN
3cv6A           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
1r38A           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIAFPEDVPILETWKALEKLVAAGKIKSIGVSN
1lqaA           KLIIASKVSPDQADRKNIREALHDSLKRLQTDYLDLYQVHWPQRVSLLDTLDALAEYQRAGKIRYIGVSN
2bgsA           DLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWAGEVLEFDMEGVWKELVKDGLVKDIGVCN
1jezA           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1ralA           DIFYTSK-LWSTFHRPELVRTCEKTLKSTQLDYVDLYIIHFHGKVDICDTWEAMEKCKDAGLAKSIGVSN
1jezB           EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
1afsA           DIFYTSK-LWSTFHRPELVRTCEKTLKSTQLDYVDLYIIHFHGKVDICDTWEAMEKCKDAGLAKSIGVSN
1qwkA           ELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNVEDVWRQFDAVYKAGLAKAVGVSN
1hw6A           DLFITTKLW-----NDEPXXXXXXXXXXXXXDQVDLYLVHW--PTPAADNVHAWEELRAAGLTRSIGVSN
1lwiA           DIFYTSK-LWSTFHRPELVRTCEKTLKSTQLDYVDLYIIHFHGKVDICDTWEAMEKCKDAGLAKSIGVSN
2he8A           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
1vp5B           ELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPGDVHCA--WKAMEEMYKDGLVRAIGVSN
1vp5A           ELFVTTKLWVSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPGDVHCA--WKAMEEMYKDGLVRAIGVSN
2p5nA           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
2hejA           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
2he8B           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
1xf0A           DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEKCKDAGLAKSIGVSN
2he5C           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
2ipgA           DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
1pyfA           DVVIATKAAHRKQGNDFVFKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEKKAGKIRSIGVSN
1og6C           RMEIVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVAAFKHLHQSGKVRHFGVSN
1og6B           RMEIVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVAAFKHLHQSGKVRHFGVSN
1og6A           RMEIVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVAAFKHLHQSGKVRHFGVSN
1ur3M           EREIVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIHRPDPLDADEVADAFKHLHQSGKVRHFGVSN
1zsxA           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
3eb3A           SLVITTKIFAGGKSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
1qrqA           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
1exbA           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
3eb4A           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
3eauA           SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
2bp1B           RVKIATKANPKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHTPVEETLHACQRLHQEGKFVELGLSN
2bp1A           RVKIATKANPKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHTPVEETLHACQRLHQEGKFVELGLSN
2c91B           XDCTVKIATKANPWEGKSLSQLETSLKRLQCPRVDLFYLHAPDSTPVEETLCACHQLHQEGKFVELGLSN
2c91A           XDCTVKIATKANPWEGKSLSQLETSLKRLQCPRVDLFYLHAPDSTPVEETLCACHQLHQEGKFVELGLSN
1gveB           KVKIATKAAPKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHTPIEETLQACHQLHQEGKFVELGLSN
2clpI           RVKIDTKAIPGNSLKPDSLRQLETSLKRLQCPRVDLFYLHMPDSTPVEETLRACHQLHQEGKFVELGLSN
2clpA           RVKIDTKAIPGNSLKPDSLRQLETSLKRLQCPRVDLFYLHMPDSTPVEETLRACHQLHQEGKFVELGLSN
1gveA           KVKIATKAAPKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHTPIEETLQACHQLHQEGKFVELGLSN


                         +         .         .         .         .         *         .:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
1vbjB           FHEHHIEELLKHCKVAPMV-NQI--ELHPLLNQKALCEYCKSKNIAVTAWSPLGQGHL-----VEDARLK
1vbjA           FHEHHIEELLKHCKVAPMV-NQI--ELHPLLNQKALCEYCKSKNIAVTAWSPLGQGHL-----VEDARLK
1zuaX           FSHFQIEKLLNKPGKYKPVTNQVECH--PYLTQEKLIQYCHSKGITVTAYSPLGSPDRPDPSLLEDPKIK
3f7jA           FQVHHLEELLKDA-EIKPMVNQVEFH--PRLTQKELRDYCKGQGIQLEAWSPLMQGQL-----LDNEVLT
3d3fA           FQVHHLEELLKDA-EIKPMVNQVEFH--PRLTQKELRDYCKGQGIQLEAWSPLMQGQL-----LDNEVLT
3h4gA           FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDRAEPVLLEEPVVQ
3cv7A           FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDRAEPVLLEEPVVQ
2ao0A           FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDRAEPVLLEEPVVQ
1hqtA           FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDRAEPVLLEEPVVQ
2ipwA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2i16A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDKPDPSLLEDPRIK
1z8aA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1xgdA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1us0A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1pwmA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdyA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdxA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdqA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdmA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdkA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdiA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdhA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdfA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pdbA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2pd5A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2ikiA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
3h7uA           FSTKKLADLLELA---RVAVNQVECHPSWR--QTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSLKNPILN
1el3A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2dv0A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1az1A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2agtA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1adsA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2acsA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
2is7A           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1j96B           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
2acuA           FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1zgdA           FSVKKLENLLSVA-TVLPAVNQVEMNLAWQ--QKKLREFCNAHGIVLTAFSPVRKGASRGPNEVENDMLK
1ah3A           FNHLQVEKILNKPGKYKPAVNQIEVH--PYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1ah0A           FNHLQVEKILNKPGKYKPAVNQIEVH--PYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
1xjbB           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1xjbA           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1mrqA           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1j96A           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1ihiA           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
3c3uA           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1pz1A           FSIEQ--DTFRAVAP--LHTIQPPYNLFERE-EESVLPYAKDNKITTLLY--------------------
2ipjA           FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
1c9wA           FNHFQIERILNKPGKHKPVTNQVECH--PYLTQEKLIEYCHSKGITVTAYSPLGSPNRPDPSLLEDPKIK
3h7rA           FSSKKLTDLLNVA---RVAVNQVECHPVWQ--QQGLHELCKSKGVHLSGYSPLGSQSKGEVRVLQNPIVT
1frbA           FNHFQIERLLNKPGKHKPVTNQVECH--PYLTQEKLIQYCHSKGISVTAYSPLGSPDRPDPSLLEDPKIK
1ynqA           IRPNVIKEYLK---RSNIVSIMMQYSILDRRPEE-WFPLIQEHGVSVVVRGP------------------
3erpB           YPADLARQAIDILEDLGTPCHQPKYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDDKLEKVRRLN
3b3dB           FQIHHLEDLM-TAAEIKPMINQVEFH--PRLTQKELIRYCQNQGIQMEAWSPLMQGQL-----LDHPVLA
3b3dA           FQIHHLEDLM-TAAEIKPMINQVEFH--PRLTQKELIRYCQNQGIQMEAWSPLMQGQL-----LDHPVLA
2alrA           FNSRQIDDILSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYS-------------------
1q13B           FNRRQLEMILNKPGKYKPVCNQVECH--PYLNQGKLLEFCKSKGIVLVAYSALGHREPSAPVLLEDPLIG
1mzrB           FQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGKGVFDQ------KVIR
1mzrA           FQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGKGVFDQ------KVIR
3erpA           YPADLARQAIDILEDLGTPCHQPKYSLFERWVEDGLLALLQEKGVGSIAFSPLAGGQLTDDKLEKVRRLN
1ynpA           IRPNVIKEYLK---RSNIVSIMMQYSILDRRPEE-WFPLIQEHGVSVVVRGP------------------
1q5mA           FNRRQLEMILNKPGKYKPVCNQVECH--PYLNQGKLLEFCKSKGIVLVAYSALGSHREPEPVLLEDPLIG
2fgbA           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
1z9aA           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
1mi3A           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
1zq5A           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
1ye4A           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
1sm9A           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
1a80A           HLVPHLERI--VAATGVVAVNQIELHPAYQ--QREITDWAAAHDVKIESWGPLGQGKYAEP-------VT
1k8cA           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVNPTLFAHDTIK
2fvlA           FNYRQLEMILNKPGKYKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAHSALGHKLWVDPNSLEDPVLC
1s1rA           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
1s1pA           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
1ry0A           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
2bgqA           YTVTKLNRLLRSAKIPPAVCQMEMHPGWK---NDKIFEACKKHGIHITAYSPLGKNLAHDP------VVE
1ynpB           IRPNVIKEYLK---RSNIVSIMMQYSILDRRPEE-WFPLIQEHGVSVVVRGP------------------
3caqB           FNRRQLELILNKPGKHKPVSNQVECH--PYFTQPKLLKFCQQHDIVITAYSPLGTSRNPSPPLLKDALLN
3burA           FNRRQLELILNKPGKHKPVSNQVECH--PYFTQPKLLKFCQQHDIVITAYSPLGTSRNPSPPLLKDALLN
1m9hA           HLVPHLERI--VAATGVVAVNQIELHPAYQ--QREITDWAAAHDVKIESWGPLGQGKYAEP-------VT
3cv6A           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYPSPVLLDEPVLG
1r38A           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
1lqaA           ETAFGVMRYLHLADKPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLAKPAGARNTLFS
2bgsA           YTVTKLNRLLRSAKIPPAVCQMEMHPGWK---NDKIFEACKKHGIHITAYSPLGSS---EKNLAHDPVVE
1jezA           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSTFAHD-----------TIK
1ralA           FNCRQLERILNKPGKYKPVCNQVECHLYLN--QSKMLDYCKSKDIILVSYCTLGSSDQKSPVLLDDPVLC
1jezB           FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFAHD-----------TIK
1afsA           FNCRQLERILNKPGKYKPVCNQVECHLYLN--QSKMLDYCKSKDIILVSYCTLGSSDQKSPVLLDDPVLC
1qwkA           WNNDQISRALAL-GLTPVHNSQVELHLYFPQHDH--VDFCKKHNISVTSYATLGSDWAPAPSDLQDQNVL
1hw6A           HLVPHLERI--VAATGVVAVNQIELHPAYQ--QREITDWAAAHDVKIESWGPLGQGKYAEP-------VT
1lwiA           FNCRQLERILNKPGKYKPVCNQVECHLYLN--QSKMLDYCKSKDIILVSYCTLGSKTWVDQKSLDDPVLC
2he8A           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTGGWVDQNSLDEPVLG
1vp5B           FYPDRLMDLM-VHHEIVPAVNQIEIHPFYQRQEE--IEFMRNYNIQPEAWGPF----------AEGRVLR
1vp5A           FYPDRLMDLM-VHHEIVPAVNQIEIHPFYQRQEE--IEFMRNYNIQPEAWGPF----------AEGRVLR
2p5nA           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYNSPVLLDEPVLG
2hejA           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYNSPVLLDEPVLG
2he8B           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYNSPVLLDEPVLG
1xf0A           FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
2he5C           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTGDQNSPVLLDEPVLG
2ipgA           FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYNSPVLLDEPVLG
1pyfA           FSLEQLKEANK---DGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLEQEHFKGERFKENNKLA
1og6C           FTPAQ-FALLQSRLPFTLATNQV-----------------------------------------------
1og6B           FTPAQ-FALLQSRLPFTLATNQV-----------------------------------------------
1og6A           FTPAQ-FALLQSRLPFTLATNQV-----------------------------------------------
1ur3M           FTPAQ-FALLQSRLPFTLATNQV-----------------------------------------------
1zsxA           WSSMEIMEAYSVARQFNLTCEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
3eb3A           WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
1qrqA           WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
1exbA           WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
3eb4A           WSSMEIMEAYSVARQFNLRCEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
3eauA           WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
2bp1B           YEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNP------------------
2bp1A           YEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNP------------------
2c91B           YEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNP------------------
2c91A           YEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNP------------------
1gveB           YEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------
2clpI           YAAWEVAELCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------
2clpA           YAAWEVAELCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------
1gveA           YEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------


                         .         .         .         +         .         .         .:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKXXXXXXXXXXXXXXSLRLSDEEIAAIDQAFPLGPEPASLxx
1vbjB           AIGGKYGKTAAQVMLRW-EIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVIDAGHRYGPDP-----
1vbjA           AIGGKYGKTAAQVMLRW-EIQAGVITIPKSGNEARIKENGNIFDFELTAEDIQVIDAGHRYGPDP-----
1zuaX           EIAAKHKKTAAQVLIRFHIQR-NVIVIPKSVTPARIVENIQVFDFKLSDEEMATI---------------
3f7jA           QIAEKHNKSVAQVILRW-DLQHGVVTIPKSIKEHRIIENADIFDFELSQEDIDALNKDERVGPNPDEL--
3d3fA           QIAEKHNKSVAQVILRW-DLQHGVVTIPKSIKEHRIIENADIFDFELSQEDIDALNKDERVGPNPDEL--
3h4gA           ALAEKYNRSPAQILLRWQVQR-KVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLD--------------
3cv7A           ALAEKYNRSPAQILLRWQVQR-KVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLD--------------
2ao0A           ALAEKYNRSPAQILLRWQVQR-KVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLD--------------
1hqtA           ALAEKYNRSPAQILLRWQVQR-KVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLD--------------
2ipwA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2i16A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1z8aA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1xgdA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPEAIAENFKVFDFELSSQDMTTL---------------
1us0A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1pwmA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdyA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdxA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdqA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdmA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdkA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdiA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdhA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdfA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pdbA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2pd5A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2ikiA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
3h7uA           MVAEKLGKSPAQVAL-------------------------------------------------------
1el3A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2dv0A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1az1A           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2agtA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1adsA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2acsA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
2is7A           AIAAKHDKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1j96B           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
2acuA           AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
1zgdA           EIADAHGKSVAQISLRWLYEQGVTF-VPK-----------------------------------------
1ah3A           AIAAKYNKTTAQVLIRFPMQR-NLIVIPKSVTPERIAENFQVFDFELSPEDM------------------
1ah0A           AIAAKYNKTTAQVLIRFPMQR-NLIVIPKSVTPERIAENFQVFDFELSPEDM------------------
1xjbB           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1xjbA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1mrqA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1j96A           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1ihiA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
3c3uA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1pz1A           ----------------------------------------------------------------------
2ipjA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
1c9wA           EIAAKHKKTSAQVLIRFHIQR-NVVVIPKSVTPARIHENFQVFDFQLSDQEMATI---------------
3h7rA           EVAEKLGKTTAQVAL-------------------------------------------------------
1frbA           EIAAKHEKTSAQVLIRFHIQR-NVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI---------------
1ynqA           ----------------------------------------------------------------------
3erpB           ELAARRGQKLSQMALAWVLRNDNVTSV-------------------------------------------
3b3dB           DIAQTYNKSVAQIILRW-DLQHGIITIPKSTKEHRIKENASVFDFELTQDDIDALNENLRVGPDP-----
3b3dA           DIAQTYNKSVAQIILRW-DLQHGIITIPKSTKEHRIKENASVFDFELTQDDIDALNENLRVGPDP-----
2alrA           ----------------------------------------------------------------------
1q13B           ALAKKHQQTPALIALRYQLQR-GIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVID--------------
1mzrB           DLADKYGKTPAQIVIRW-HLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDEIAKLDQGKRLGPDP-----
1mzrA           DLADKYGKTPAQIVIRW-HLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDEIAKLDQGKRLGPDP-----
3erpA           ELAARRGQKLSQMALAWVLRNDNVTSV-------------------------------------------
1ynpA           ----------------------------------------------------------------------
1q5mA           ALAKKHQQTPALIALRYQLQR-GIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVID--------------
2fgbA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
1z9aA           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
1mi3A           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
1zq5A           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
1ye4A           AIAAKYNKTPAEVLLRWAAQR-GIAVIPR-----------------------------------------
1sm9A           AIAAKYNKTPAEVLLRWAAQR-GIAVIPR-----------------------------------------
1a80A           XXXXXHGKTPAQAVLRWHLQK-GFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP----------
1k8cA           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
2fvlA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLD--------------
1s1rA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
1s1pA           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
1ry0A           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
2bgqA           KVANKLNKTPGQVLIKWALQR-GTSVIPK-----------------------------------------
1ynpB           ----------------------------------------------------------------------
3caqB           SLGKRYNKTAAQIVLRFNIQR-GVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE--------------
3burA           SLGKRYNKTAAQIVLRFNIQR-GVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE--------------
1m9hA           XXXXXHGKTPAQAVLRWHLQK-GFVVFPGSVRREHLEENLDVFDFDLTDTEIAAIDAMDP----------
3cv6A           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
1r38A           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
1lqaA           RIARRHGLDPAQMALAFVRRQP------------------------------------------------
2bgsA           KVANKLNKTPGQVLIKWALQR-GTSVIPK-----------------------------------------
1jezA           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
1ralA           AIAKKYKQTPALVALRYQLQR-------------------------------------------------
1jezB           AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
1afsA           AIAKKYKQTPALVALRYQLQR-------------------------------------------------
1qwkA           ALAEKTHKTPAQVLLRYALDR-GCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEES------------
1hw6A           XXXXXHGKTPAQAVLRWHLQK-GFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP----------
1lwiA           AIAKKYKQTPALVALRYQLQR-------------------------------------------------
2he8A           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
1vp5B           SIAEKYGKTVAQVILRWLTQK-GIVAIPKTVRRERMKENISIFDFELTQEDIATLDE-------------
1vp5A           SIAEKYGKTVAQVILRWLTQK-GIVAIPKTVRRERMKENISIFDFELTQEDIATLDE-------------
2p5nA           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
2hejA           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
2he8B           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
1xf0A           ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
2he5C           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
2ipgA           SMAKKYNRTPALIALRYQLQR-------------------------------------------------
1pyfA           PIAEKHNVDIPHIVLAWYLARPEIILIPGAKRADQLIDNIKTADVTLSQEDISFIDKLFAPG--------
1og6C           ----------------------------------------------------------------------
1og6B           ----------------------------------------------------------------------
1og6A           ----------------------------------------------------------------------
1ur3M           ----------------------------------------------------------------------
1zsxA           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
3eb3A           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
1qrqA           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
1exbA           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
3eb4A           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
3eauA           AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
2bp1B           ----------------------------------------------------------------------
2bp1A           ----------------------------------------------------------------------
2c91B           ----------------------------------------------------------------------
2c91A           ----------------------------------------------------------------------
1gveB           ----------------------------------------------------------------------
2clpI           ----------------------------------------------------------------------
2clpA           ----------------------------------------------------------------------
1gveA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           x
1vbjB           -
1vbjA           -
1zuaX           -
3f7jA           -
3d3fA           -
3h4gA           -
3cv7A           -
2ao0A           -
1hqtA           -
2ipwA           -
2i16A           -
1z8aA           -
1xgdA           -
1us0A           -
1pwmA           -
2pdyA           -
2pdxA           -
2pdqA           -
2pdmA           -
2pdkA           -
2pdiA           -
2pdhA           -
2pdfA           -
2pdbA           -
2pd5A           -
2ikiA           -
3h7uA           -
1el3A           -
2dv0A           -
1az1A           -
2agtA           -
1adsA           -
2acsA           -
2is7A           -
1j96B           -
2acuA           -
1zgdA           -
1ah3A           -
1ah0A           -
1xjbB           -
1xjbA           -
1mrqA           -
1j96A           -
1ihiA           -
3c3uA           -
1pz1A           -
2ipjA           -
1c9wA           -
3h7rA           -
1frbA           -
1ynqA           -
3erpB           -
3b3dB           -
3b3dA           -
2alrA           -
1q13B           -
1mzrB           -
1mzrA           -
3erpA           -
1ynpA           -
1q5mA           -
2fgbA           -
1z9aA           -
1mi3A           -
1zq5A           -
1ye4A           -
1sm9A           -
1a80A           -
1k8cA           -
2fvlA           -
1s1rA           -
1s1pA           -
1ry0A           -
2bgqA           -
1ynpB           -
3caqB           -
3burA           -
1m9hA           -
3cv6A           -
1r38A           -
1lqaA           -
2bgsA           -
1jezA           -
1ralA           -
1jezB           -
1afsA           -
1qwkA           -
1hw6A           -
1lwiA           -
2he8A           -
1vp5B           -
1vp5A           -
2p5nA           -
2hejA           -
2he8B           -
1xf0A           -
2he5C           -
2ipgA           -
1pyfA           -
1og6C           -
1og6B           -
1og6A           -
1ur3M           -
1zsxA           -
3eb3A           -
1qrqA           -
1exbA           -
3eb4A           -
3eauA           -
2bp1B           -
2bp1A           -
2c91B           -
2c91A           -
1gveB           -
2clpI           -
2clpA           -
1gveA           -