[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39477.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2pimA.bssp"
#ERROR : Can't open dsspfile "3e29D.bssp"
#ERROR : Can't open dsspfile "3e29B.bssp"
#ERROR : Can't open dsspfile "3e29A.bssp"
#ERROR : Can't open dsspfile "1wluA.bssp"
#ERROR : Can't open dsspfile "1j1yB.bssp"
#ERROR : Can't open dsspfile "1j1yA.bssp"
#ERROR : Can't open dsspfile "3bbjB.bssp"
#ERROR : Can't open dsspfile "3bbjA.bssp"
#ERROR : Can't open dsspfile "2h4uD.bssp"
#ERROR : Can't open dsspfile "2h4uA.bssp"
#ERROR : Can't open dsspfile "3f5oC.bssp"
#ERROR : Can't open dsspfile "3f5oB.bssp"
#ERROR : Can't open dsspfile "3f5oA.bssp"

## Summary of PDB Search
:152
    3e-15  41%  2pimA  [x.x.x] PHENYLACETIC ACID DEGRADATION-RELATED PROTEIN
    4e-06  38%  3e29D  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    4e-06  38%  3e29B  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    4e-06  38%  3e29A  [x.x.x] UNCHARACTERIZED PROTEIN Q7WE92_BORBR
    4e-05  40%  1wluA  [x.x.x] PHENYLACETIC ACID DEGRADATION PROTEIN PAAI
    4e-05  40%  1j1yB  [d.38.1] PAAI PROTEIN
    4e-05  40%  1j1yA  [d.38.1] PAAI PROTEIN
    3e-04  34%  3bbjB  [x.x.x] PUTATIVE THIOESTERASE II
    3e-04  34%  3bbjA  [x.x.x] PUTATIVE THIOESTERASE II
    0.001  25%  2h4uD  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    0.001  25%  2h4uA  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    0.001  25%  3f5oC  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    0.001  25%  3f5oB  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
    0.001  25%  3f5oA  [x.x.x] THIOESTERASE SUPERFAMILY MEMBER 2
:152

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxGRLPPPPCAETLGIEFLRVTPESGSIEVKFEATSAFLNLAGNVQGGFLAAMLDDTMGP
2pimA           ------------GEAPVPAVAGTLGGVIRAVDLEAGSLESDYVATDAFLNPVGQVQGGLGA--LDDVTA-
3e29D           -----------------------------------------------------STHGGILATLVD-AAGD
3e29B           -----------------------------------------------------STHGGILATLVD-AAGD
3e29A           -----------------------------------------------------STHGGILATLVD-AAGD
1wluA           ------------------PFMEALGLKVLHLAP--GEAVVAGEVRADHLNLHGTAHGGFLYALADNTRGP
1j1yB           ------------------PFMEALGLKVLHLAP--GEAVVAGEVRADHLNLHGTAHGGFLYALADNTRGP
1j1yA           ------------------PFMEALGLKVLHLAP--GEAVVAGEVRADHLNLHGTAHGGFLYALADNTRGP
3bbjB           --------------------------------------------------LIGTANGGYLTVLQR-----
3bbjA           --------------------------------------------------LIGTANGGYLTVLQR-----
2h4uD           ------------------------------VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM
2h4uA           ------------------------------VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM
3f5oC           ------------------------------VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM
3f5oB           ------------------------------VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM
3f5oA           ------------------------------VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM


                         .         .         *         .         .         .         .:140
query           ALVATLGAGEFAPTVSLNVQFHRPARVGALKGIGRVLLRGKEVCQLSGELLQDDRVVATGTATAVIRxxx
2pimA           LVTATLEDGASCSTLNLNLSFXXXXXXXXXXXXXXXXXXXXNVCNVVGELSQDGKLVATATATCV-----
3e29D           YAVA-LKTGHPVPTD--HVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDDGNLVASGRALYLIR---
3e29B           YAVA-LKTGHPVPTD--HVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDDGNLVASGRALYLIR---
3e29A           YAVA-LKTGHPVPTD--HVDYHRVATPGDLRAEGQVIHFGKRFATAHARVLDDGNLVASGRALYLIR---
1wluA           AVALSCRMDYFRP---------------------------------------------------------
1j1yB           AVALSCRMDYFRP---------------------------------------------------------
1j1yA           AVALSCRMDYFRP---------------------------------------------------------
3bbjB           ---SALAESDHLHAVSSSYHFHRPASSGPAEIETRVLKRGRTVTTVQTTLFQEGR---------------
3bbjA           ---SALAESDHLHAVSSSYHFHRPASSGPAEIETRVLKRGRTVTTVQTTLFQEGR---------------
2h4uD           ALLCT-ERGAPGVSVDMNITYMSPAKLGEIVITAHVLKQGKTLAFTSVDLTNTGKLIAQGRHT-------
2h4uA           ALLCT-ERGAPGVSVDMNITYMSPAKLGEIVITAHVLKQGKTLAFTSVDLTNTGKLIAQGRHT-------
3f5oC           ALLCT-ERGAPGVSVDMNITYMSPAKLGEIVITAHVLKQGKTLAFTSVDLTNTGKLIAQGRHT-------
3f5oB           ALLCT-ERGAPGVSVDMNITYMSPAKLGEIVITAHVLKQGKTLAFTSVDLTNTGKLIAQGRHT-------
3f5oA           ALLCT-ERGAPGVSVDMNITYMSPAKLGEIVITAHVLKQGKTLAFTSVDLTNTGKLIAQGRHT-------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxx
2pimA           ------------
3e29D           ------------
3e29B           ------------
3e29A           ------------
1wluA           ------------
1j1yB           ------------
1j1yA           ------------
3bbjB           ------------
3bbjA           ------------
2h4uD           ------------
2h4uA           ------------
3f5oC           ------------
3f5oB           ------------
3f5oA           ------------