[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2fa9A.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"

## Summary of PDB Search
:235
    1e-57  60%  1ji0A  [c.37.1] ABC TRANSPORTER
    3e-31  31%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    5e-31  32%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-30  31%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    2e-26  32%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-26  32%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    8e-26  30%  2oukB  [x.x.x] PROTEIN ARTP
    8e-26  30%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-23  33%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-23  33%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-23  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-23  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-23  32%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-23  32%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-23  33%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-22  32%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-21  39%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-21  39%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-21  33%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-20  35%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-20  31%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    9e-19  32%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    9e-19  28%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    2e-18  34%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  32%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-17  28%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-17  28%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-17  29%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    2e-17  28%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    7e-17  28%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    7e-17  28%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    9e-17  29%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    9e-17  29%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-16  30%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-16  30%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-16  31%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-16  31%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    6e-16  29%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    1e-15  35%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-15  33%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-15  28%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    3e-15  28%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-15  28%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-15  28%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-15  33%  2d2fA  [x.x.x] SUFC PROTEIN
    5e-15  27%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    6e-15  27%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-15  27%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    6e-15  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-14  34%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    1e-14  33%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-14  30%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-14  30%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-14  34%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-14  29%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    7e-14  27%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-14  27%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    7e-14  28%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-14  29%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-13  30%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-13  29%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-13  29%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-13  30%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-12  33%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    1e-12  27%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    1e-12  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-12  29%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-12  26%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    3e-12  31%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-12  31%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-12  31%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-12  24%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    2e-11  25%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    2e-11  31%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  30%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-11  31%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  30%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  30%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-11  30%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-11  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  29%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  29%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  29%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-11  29%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  30%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  31%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-10  23%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    6e-10  34%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-10  29%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    8e-10  24%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    8e-10  29%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  26%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-09  26%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-09  36%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-08  33%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-08  32%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    6e-08  32%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-07  34%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-07  26%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    5e-07  33%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    5e-07  33%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    5e-07  38%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-07  37%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-06  35%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-06  35%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-05  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-05  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    2e-05  26%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-05  26%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    5e-04  38%  2fa9A  [x.x.x] GTP-BINDING PROTEIN SAR1B
    6e-04  33%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    6e-04  33%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    6e-04  33%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
:235

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLTCNDLVVAHGDILALQGVTLKVATGETVALIGANGAGKTTLLHTISGLNRASSGDIQLEGVSISEWST
1ji0A           VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITN-KP
1g9xA           ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEP
1g6hA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEP
1gajA           ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEP
2it1B           -----NIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPP
2it1A           -----NIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELPP
2oukB           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT
2oljA           MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDT
1q12A           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3fh6A           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2awoA           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2awnB           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2r6gB           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2r6gA           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
3d31A           ---------------SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVTDLSP
2yyzA           -----------GKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPP
1oxvA           -------VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD---------
1oxsC           -------VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD---------
2awoC           ------------NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
1vplA           -----------------------------------NGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE--E
1g291           -----DVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVAD---
2onkA           -------------------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPP
3dhwC           -------------IQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLSE
2awnC           ------------NVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGL--------------------
2pcjA           ----------------LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV-DYTN
1l2tB           -------------IYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDD
1l2tA           -------------IYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLDD
2hydA           ----------------LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLT
3gfoA           ---------------ALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPIDKGIM
1z47B           -----------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPP
1z47A           -----------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDLPP
3fvqB           ----------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNT
3fvqA           ----------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNT
2yz2B           ---------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEI
2yz2A           ---------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERKKGYEI
3g60A           -------------IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNV
3g5uA           -------------IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNV
1jj7A           ------------DVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYE-
1oxxK           -------VFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFD---------
1f3oA           -------------IYALKNVNLNIKEGEFVS-IGPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKTNDLDD
1mt0A           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
2ff7A           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
1xefA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
2ffaA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
2d2fA           ----------------LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILELSP
1b0uA           -----DLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGLKVADKNQ
2fgkA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
2ffbA           ----------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
3b5jA           ----------------LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGLALADPNW
2d62A           -----------GDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLVAD---
2d2eA           ----------------LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGEYTVERGEILLDGENILELSP
2zu0C           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLALSP
2d3wA           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLALSP
2awnA           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPP
2ixeA           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH
1mv5D           ----------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISL
1mv5A           ----------------LRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNISL
2ixeD           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH
2d3wB           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLALSP
2ixfD           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQY--
2ixfC           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH
2ixfA           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH
2d3wD           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLALSP
2pjzA           ---------------SLENINLEV-NGEKVIILGPNGSGKTTLLRAISGL-LPYSGNIFINGMEVRKIRN
1pf4A           ---------------ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKL
2ixgA           ----------HPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDH
2d3wC           MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREEVTGGTVEFKGKDLLALSP
1v43A           -----NLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRI---------YFG
2bbtB           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2bbtA           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2bbsB           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2ghiA           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNR
2ghiB           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNR
2bbsA           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2pzgB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xmiB           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xmiE           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xmiC           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xmiA           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2pzfB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2pzfA           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xf9D           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1xf9C           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1xf9B           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1xf9A           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1xmjA           -------VTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1xfaA           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1xmiD           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
1r10A           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0zD           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0zC           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0zB           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0zA           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0xD           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0xC           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0xB           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0xA           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0wC           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0wB           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1r0wA           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1q3hD           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1q3hC           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1q3hB           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
1q3hA           ----------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG--------
2pzgA           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2pzeB           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2pzeA           -----------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2ghiC           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNR
3bk7A           ----------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKV--------EWDL
1sgwA           -LEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPIT----
2ghiD           ----------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNVNKYNR
2bboA           ----------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------
2nq2D           ---------------AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE-----------
2nq2C           -----------------QQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE-----------
2ihyA           ----------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGYSAET
2ihyB           ----------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGVGYSAETV
2qi9C           ----------------------EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSA
1l7vC           ----------------------EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPLEAWSA
1yqtA           ----------------------EIKKGEVIGIVGPNGIGKTTFVK-LAGVEEPTEGKI--------EWDL
2cbzA           ---------ARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG--------
1z2rA           ------------EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT-
3b60A           ------------EVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT-
2awoD           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL------------
2awnD           ---------AWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2ix3A           ---CNEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDGFPTQEECR
2iwhB           ---CNEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDGFPTQEECR
2fa9A           ----------------LQFLGLYKKTGKLVFL-GLDNAGKTTLLHML----KPTSEELTIAGMTFTTFDL
2ix8A           -------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV------------
2iw3B           -------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV------------
2iw3A           -------------------INFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV------------


                         .         .         *         .         .         .         .:140
query           DRRVAKGISQAPEGRRIFPGLTVEENLSLASVSWRRWGESIAADLDRTFELFPRLKERRKQLGWSLSGGE
1ji0A           AHVINRGIALVPEGRRIFPELTVYENLGAYN---RKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGE
1g9xA           AELYHYGIVRTFQTPQPLKEMTVLENLLIGEINYKKWIPKEEEMVEKAFKIFLKLSHLYDRKAGELSGGQ
1g6hA           AELYHYGIVRTFQTPQPLKEMTVLENLPLNSLFYKKWIPKEEEMVEKAFKIFLKLSHLYDRKAGELSGGQ
1gajA           AELYHYGIVRTFQTPQPLKEMTVLENLLIGEINYKKWIPKEEEMVEKAFKIFLKLSHLYDRKAGELSGGQ
2it1B           KDR---NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKML-HIDKLLNRYPWQLSGGQ
2it1A           KDR---NVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKML-HIDKLLNRYPWQLSGGQ
2oukB           NNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEA--KAMELLDKLKDKAHAYPDSLSGGQ
2oljA           NNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEA--KAMELLDKLKDKAHAYPDSLSGGQ
1q12A           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
3fh6A           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
2awoA           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
2awnB           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
2r6gB           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
2r6gA           AER---GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
3d31A           EKH---DIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKI-EHLLDRNPL---TLSGGE
2yyzA           KYR---EVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVVVEIARKL-LIDNLLDRKPT---QLSGGQ
1oxvA           DRLVASNLIVPPEDRKIYPNLTAFENIAFPLTNMKMSKEEIILDIHHVLNHFPR----------ELSGGQ
1oxsC           DRLVASNLIVPPEDRKIYPNLTAFENIAFPLTNMKMSKEEIILDIHHVLNHFPR----------ELSGGQ
2awoC           AER---GVGMV----ALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLAHLLDRKPK---ALSGGQ
1vplA           PHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEI-AGLGEKIKDRVSTYSKGM
1g291           ---PEKGIFVPPKDRDIYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELL-GLTELLNRKPRELSGGQ
2onkA           ERR---GIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXXMAEKLGIAHLLDRKPA---RLSGGE
3dhwC           SEKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLV-GLGDKHDSYPSNLSGGQ
2awnC           ------GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQHLLDRKPK---ALSGGQ
2pcjA           EKELSRKLGFVFQFHYLIPELTALENVIVPMLKMKERGEYLLSELG--------LGDKLSRKPYELSGGE
1l2tB           DELTKDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKELEERANHKPNQLSGGQ
1l2tA           DELTKDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEERRKRALECLKELEERANHKPNQLSGGQ
2hydA           G-SLRNQIGLVQQDNILFSD-TVKENILLGRPTATDEEVVEAAKMANAHDFIMNLPQEVGERGVKLSGGQ
3gfoA           KLRESIGIVFQDPDNQLF-SASVYQDVSFGAVNMKLPEDEIRKRVDNALKRIEHLKDKPTH---CLSFGQ
1z47B           QKR---NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARV-RELLRFMRLESYANRFPHELSGGX
1z47A           QKR---NVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARV-RELLRFMRLESYANRFPHELSGGX
3fvqB           NLPVERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-TGISELAGRYPHELSGGX
3fvqA           NLPVERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLEL-TGISELAGRYPHELSGGX
2yz2B           RRNI--GIAQYPEDQ--FFAERVFDEVAFAVKNFYPDRDPVPL-VKKAMEFFDSFKDR---VPFFLSGGE
2yz2A           RRNI--GIAQYPEDQ--FFAERVFDEVAFAVKNFYPDRDPVPL-VKKAMEFFDSFKDR---VPFFLSGGE
3g60A           QLRAQLGISQEP----ILFDCSIAENIAYGDNSRVVSYEEIVANIHQFIDSLPKYNTRVGDKGTQLSGGQ
3g5uA           QLRAQLGISQEP----ILFDCSIAENIAYGDNSRVVSYEEIVANIHQFIDSLPKYNTRVGDKGTQLSGGQ
1jj7A           HRYLHRQVAAVGQEPQVF-GRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFPQGYDTEDEAGSQLSGGQ
1oxxK           DRLVASNLIVPPEDRKIYPNLTAFENIAFPLTNMKMSKEEIILDIHHVLNHFPR----------ELSGXX
1f3oA           DELTKDKIGFVFQQFNLIPLLTALENVELPLIFKYR-GASGEERRKRALELKAELEERANHKPNQLSGGQ
1mt0A           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
2ff7A           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
1xefA           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
2ffaA           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
2d2fA           DERARKGLFLAFQYPVEVPGVTIANFLRLALQA--KLGREVG-----VAEFWTKVKKALELLDWGFSGGE
1b0uA           LRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQKYPVHLSGGQ
2fgkA           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
2ffbA           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
3b5jA           LRRQVGVVLQD----NVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIGAGLSGGQ
2d62A           ---PEKGVFVPPKERALYPH-TVYDNIAFPLKLRKVPKQEIDKRVREVAEL--GLTELLNRKPRELSGGQ
2d2eA           DERARKGLFLAFQ-YPVVPGVTIANFLRLALQA--KLGREVG-----VAEFWTKVKKALELLDWDLNEGE
2zu0C           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR-FDFQDLMEEKTRSVNVGFSGGE
2d3wA           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR-FDFQDLMEEKTRSVNVGFSGGE
2awnA           AER---GVGM------VFQSYALEV-----------------------------INQRVNQVA-------
2ixeA           HHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESFISGFPQGYDTEGETGNQLSGGQ
1mv5D           ENWRSQ-IGFVSQDSAIMAG-TIRENLTYG-LEGDYTDEDLWQVLDLAFENMPQLNTEVGERGVKISGGQ
1mv5A           ENWRSQ-IGFVSQDSAIMAG-TIRENLTYG-LEGDYTDEDLWQVLDLAFENMPQLNTEVGERGVKISGGQ
2ixeD           HYLHTQVAAVGP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVQLSGGQ
2d3wB           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR-FDFQDLMEEKTRSVNVGFSGGE
2ixfD           DHHYLH-TQVAAVGQLLF-GRSFRENIAYGLTRTPTMEEITAVAMESFISGFPQGYDTEGETGNQLSGGQ
2ixfC           HHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESFISGFPQGYDTEGETGNQLSGGQ
2ixfA           HHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESFISGFPQGYDTEGETGNQLSGGQ
2d3wD           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR-FDFQDLMEEKTRSVNVGFSGGE
2pjzA           YIRYSTNLPEAYE-----IGVTVNDIVYL-------YEELKGLDRDLFLEMLKALKEILRRKLYKLSAGQ
1pf4A           -TNLRRHFALVSQNVHLFND-TIANNIAYAAEEYTREQIEQAARQAHAMEFIENMPQGLDTVGTSLSGGQ
2ixgA           HHTQVAAVGQEP----LLFGRSFRENIAYGLTRTPTMEEITAVAMESFISGFPQGYDTEGETGNQLAVGQ
2d3wC           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQ--ETLDR-FDFQDLMEEKTRSVNVGFSGGE
1v43A           DRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPK--DEIDKRVRWAAELL-QIEELLNRYPAQLSGGX
2bbtB           ------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKF--AEKDNIVLGITLSGGQ
2bbtA           ------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKFAE-KDNIVLGGITLSGGQ
2bbsB           ------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKFAE-KDNIVLGGITLSGGQ
2ghiA           NS-IRSIIGIVPQDTILF-NETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTIGMKLSGGE
2ghiB           NS-IRSIIGIVPQDTILF-NETIKYNIKLDATDEEVIKATKSAQLYDFIEALPKKWDTIVGNKMKLSGGE
2bbsA           ------RISFCSQNSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKF---AEKDNIVLITLSGGQ
2pzgB           ------RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNVLGITLSGGQ
1xmiB           ------RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRY-------RSVIKACQLEEDISKIVLTLSGGQ
1xmiE           ------RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
1xmiC           ------RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
1xmiA           ------RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
2pzfB           ------RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKFAEKDNVLGEGGITLSGGQ
2pzfA           ------RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKFAEKDNVLGEGGITLSGGQ
1xf9D           ------RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1xf9C           ------RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1xf9B           ------RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1xf9A           ------RVSFCSQFSWIMPG-TIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1xmjA           ------RISFCSQFSWIMPG-TIKENIIGVSYDEYRYRSVIACQLEEDISKFAEKDNVLGEGGITLSEGQ
1xfaA           ------RVSFCSQFSWIMPG-TIKENI-IRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1xmiD           ------RISFCSQFSWIMPG-TIKENI-IAGVSYDEYRRSVACQLEEDISKFAE-KDNIVLGEITLSGGQ
1r10A           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0zD           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0zC           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0zB           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0zA           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0xD           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0xC           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0xB           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0xA           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0wC           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0wB           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1r0wA           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1q3hD           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1q3hC           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1q3hB           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
1q3hA           ------RVSFCSQFSWIMPG-TIKENI-IFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVGVTLSGGQ
2pzgA           ------RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
2pzeB           ------RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
2pzeA           ------RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSGGQ
2ghiC           NS-IRSIIGIVPQDTILF-NETIKYNILYGKLDATE--EVIKATKSQLYDFIEALPKKWDTIVGGMKLGE
3bk7A           T------VAYKPQYIKAEYEGTVYELLSKIDSS------KLNSNFYKTELLKPLLYDRNVE---DLSGGE
1sgwA           --KVKGKIFFLPEEIIVPRKISVEDYLAVASLYGVKVNKNEIMDALESVEVL----DLKKKLG-ELSQGT
2ghiD           NS-IRSIIGIVPQDTILF-NETIKYNILYGKLDATDEEVIKATKSAQLYDFIEALPKKWDTI--VLSGGE
2bboA           ------RISFCSQFSWIMPG-TIKENI-IFGVSYDEYRYRSVIKACQLEEDISKFAEKDNEGGITLSEGQ
2nq2D           ---VYQSIGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVYLNLTHLAKREFTSLSGGQ
2nq2C           ---VYQSIGFVPQ---FFSSPFAYSVLDIVLMGRSTHINTFAKPKSHDYQVYLNLTHLAKREFTSLSGGQ
2ihyA           VRQHIGFVSHSQEGERV-----IDVVISGAI------DDEIRNEAHQLLKLVGSAK-AQQYIGY-LSTGE
2ihyB           RQHIGSLLEKFQEGERV---IDVVISGAFKSIGYQDIDDEIRNEAHQLLKLVGSAK-AQQYIGY-LSTGE
2qi9C           TKRAYLSQQQTPPATPVWHYLTLHQH--------DKTRTELLNDVAGALALDDKLGRSTNQ----LSGGE
1l7vC           TKRAYLSQQQTPPATPVWHYLTLHQH--------DKTRTELLNDVAGALALDDKLGRSTNQ----LSGGE
1yqtA           T------VAYKPQYIKADYEGTVYELLSKIDAS------KLNSNFYKTELLKPLLYDREVN---ELSGGE
2cbzA           ------SVAYVPQQAWI-QNDSLRENILFGCQLEEPYYRSVACALLPDLEILPSGDRTEGEKGVNLSGGQ
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2r6fB           -------------------------------------GKNIAEVLDTVFASIPKIKRKLETLATTLSGGE
2r6fA           -------------------------------------GKNIAEVLDTVFASIPKIKRKLETLATTLSGGE
2vf8B           ------------------------------------------ADESAIFRALDTLRERLGQPATELSGGE
2vf8A           ------------------------------------------ADESAIFRALDTLRERLGQPATELSGGE
2vf7C           ------------------------------------------ADESAIFRALDTLRERLGQPATELSGGE
2vf7B           ------------------------------------------ADESAIFRALDTLRERLGQPATELSGGE
2vf7A           ------------------------------------------ADESAIFRALDTLRERLGQPATELSGGE
2ix3A           TVYVEHDIDGTHSDTSVLDGVGTKEAIKDKLIEFGFTDEMIAMPIS------------------ALSGGW
2iwhB           TVYVEHDIDGTHSDTSVLDGVGTKEAIKDKLIEFGFTDEMIAMPIS------------------ALSGGW
2fa9A           GRRVWKNYLPAING--------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QQMLAIGRALMARPKLLLLDEPSLGLAPRLAEEVYERVKLISESGLTILVVEQNTVLALSVADRAYVLET
1ji0A           QQ-LAIGRAL-SRPKLL--DEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLET
1g9xA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN
1g6hA           MKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN
1gajA           MKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFN
2it1B           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKLQKELGITTVYVTHDQAEALAMADRIAVIRE
2it1A           QQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKLQKELGITTVYVTHDQAEALAMADRIAVIRE
2oukB           AQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDG
2oljA           AQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFMDG
1q12A           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3fh6A           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2awoA           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2awnB           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2r6gB           RQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2r6gA           RQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
3d31A           QQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLKKNKLTVLHITHDQTEARIMADRIAVVMD
2yyzA           QQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKLQQELGITSVYVTHDQAEAMTMASRIAVFNQ
1oxvA           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADR------
1oxsC           QQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADR------
2awoC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
1vplA           VRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALIHN
1g291           RQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMAELKKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNR
2onkA           RQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQEFDVPILHVTHDLIEAAMLADEVAVMLN
3dhwC           KQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRGLTILLITHEMDVVKRICDCVAVISN
2awnC           RQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2pcjA           QQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELA-ELTHRTLEMKD
1l2tB           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKD
1l2tA           QQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKD
2hydA           KQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHR--LSTITHADKIVVIEN
3gfoA           KKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKE
1z47B           XXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADRVLVLHE
1z47A           XXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVDEMGVTSVFVTHDQEEALEVADRVLVLHE
3fvqB           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADRIAVMKQ
3fvqA           XXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADRIAVMKQ
2yz2B           KRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEK
2yz2A           KRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEK
3g60A           KQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREGRTCIVI-AHRLSTIQNADLIVVIQN
3g5uA           KQRIAIARALVRQPHILLLDEATSALDTE-SEKVVQEALDKAREGRTCIVI-AHRLSTIQNADLIVVIQN
1jj7A           RQAVALARALIRKPCVLILDDATSALDAQVEQLLYESPERYSRS---VLLITQHLSL-VEQADHILFLEG
1oxxK           XXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHDPADIFAIADR------
1f3oA           QQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHDINVA-RFGERIIYLKD
1mt0A           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIII-AHRLSTVKNADRIIVMEK
2ff7A           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIII-AHRLSTVKNADRIIVMEK
1xefA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAAR-LSTVKNADRIIVMEK
2ffaA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIIIAAR-LSTVKNADRIIVMEK
2d2fA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVIHYQRILNYIQPDKVHVMMD
1b0uA           QQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQ
2fgkA           RQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVIII-AHRLSTVKNADRIIVMEK
2ffbA           RQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK-GRTVIII-AHRLSTVKNADRIIVMEK
3b5jA           RQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK-GRTVIII-AHRLSTVKNADRIIVMEK
2d62A           RQRVALGRAIIRRPK-VFLDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQVEA------------
2d2eA           KKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVIHYQRILNYIQPDKVHVMMD
2zu0C           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSIIVTHYQRILDYIKPDYVHVLYQ
2d3wA           KKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSIIVTHYQRILDYIKPDYVHVLYQ
2awnA           -EVLAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2ixeA           RQAVALARALIRKPRLLILDNATSALDARVQRLLYESPEWASR---TVLLITQQ----LSLAERAHFLKE
1mv5D           RQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIV--DADKIYFIEK
1mv5A           RQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIV--DADKIYFIEK
2ixeD           RQAVALARALIRKPRLLILDNATSALDARVQRLLYESPEWASR---TVLLITQQ----LSLAERAHFLKE
2d3wB           KKRNDILQMAVLEPELCILDE-SDSLDIDALKVVADGVNSLRDGKRSFIIVTHYRILDYIKPDYVHVLYQ
2ixfD           RQAVALARALIRKPRLLILDQATSALDARVQRLLYESPEWASRT--VLLITHQ-----LSLAERAHFLKE
2ixfC           RQAVALARALIRKPRLLILDQATSALDARVQRLLYESPEWASRT--VLLITHQ-----LSLAERAHFLKE
2ixfA           RQAVALARALIRKPRLLILDQATSALDARVQRLLYESPEWASRT--VLLITHQ-----LSLAERAHFLKE
2d3wD           KKRNDILQMAVLEPELCILDE-SDGLDIDALKVVADGVNSLRDGKRSIIVTHYQRILDYIKPDYVHVLYQ
2pjzA           SVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG--ILVTHELDMLNLYKEYKAYFLVG
1pf4A           RQRVAIARALLRDAPVLILDEATSALDTE-SERAIQAALDELQKNKTVLVI-AHRLSTIEQADEILVVDE
2ixgA           RQAVALARALIRKPRLLILDNATSALDARVQRLLYESPEWASR---TVLLITQQ----LSLAERAHFLKE
2d3wC           KKRNDILQMAVLEPELCILDESDDIDALKVVADGVNSLRDGKRS--FIIVTHYQRILDYIKPDYVHVLYQ
1v43A           XXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKKVTTIYVTHDQVEAMTMGDRIAVMNR
2bbtB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2bbtA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2bbsB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2ghiA           RQRIAIARCLLKDPKIVIFDEATSSLDSK-TEYLFQKAVEDLRKNRTLIII-AHRLSTISSAESIILLNK
2ghiB           RQRIAIARCLLKDPKIVIFDEAT---SDSKTEYLFQKAVEDLRKNRTLIIIAHRTI---SSAESIILLNK
2bbsA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2pzgB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xmiB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xmiE           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xmiC           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xmiA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2pzfB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2pzfA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xf9D           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1xf9C           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1xf9B           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1xf9A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1xmjA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1xfaA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1xmiD           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
1r10A           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0zD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0zC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0zB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0zA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0xD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0xC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0xB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0xA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0wC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0wB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1r0wA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1q3hD           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1q3hC           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1q3hB           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
1q3hA           RARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILV-TSKMEHLRKADKILILHQ
2pzgA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2pzeB           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2pzeA           RARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2ghiC           RQRIAIARCLLKDPKIVIFDEATSSLDSK-TEYLFQKAVEDLRKNRTLIII-AHRLSTISSAESIILLNK
3bk7A           LQRVAIAATLLRDADIYLLDEPSLDVEQRLAVSRAIR-HLMEKNEKTALVVEHDVLMIDYVSDRLIVFE-
1sgwA           IRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSIEILKEKGIVII---------------------
2ghiD           RQRIAIARCLLKDPKIVIFDDSK-------TEYLFQKA---VEDNRTLIII-AHRLSTISSAESIILLNK
2bboA           QAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILV-TSKMEHLKKADKILILHE
2nq2D           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL--
2nq2C           RQLILIARAIASECKLILLDEPTSALDLANQDIVLSLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLL--
2ihyA           KQRV-IARAL-GQPQVLILDEPAAGL--------------------------------------------
2ihyB           KQRV-IARAL-GQPQVLILDEPAAGL--------------------------------------------
2qi9C           WQRVRLAAVVLANPQLLLLDEPSLDVAQQSALD--KILSALSQQGLAI-VSSHDLNHTLRHAHRAWLLKG
1l7vC           WQRVRLAAVVLANPQLLLLDEPSLDVAQQSALD--KILSALCQQGLAI-VSSHDLNHTLRHAHRAWLLKG
1yqtA           LQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHD-VLIDYVSDR------
2cbzA           KQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVKGMLKNKTRILVT--HSMSYLPQVDVIIVMSG
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2awoD           ----------MVEPSVFLLDEP-LDAALRVQMRI-EISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2awnD           ----------MVEPSVFLLDEPLSNLDAALRVQMIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDA
2r6fB           AQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN-LDVIKTAD--YIIDL
2r6fA           AQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHN-LDVIKTAD--YIIDL
2vf8B           AQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDI
2vf8A           AQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDI
2vf7C           AQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDI
2vf7B           AQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDI
2vf7A           AQRIKLATELRRSGRVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQV---VAASDWVLDI
2ix3A           KMKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHDSVFLDNVCE-------
2iwhB           KMKLALARAVLRNADILLLDEPTNHLD---TVNVAWLVNYLNTCGITSITISHDSVFLDNVCE-------
2fa9A           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GRIVLEGPASELKHNARVREAYLGR
1ji0A           GQIVLEGKASELLDN-EVRKAYLG-
1g9xA           GQIIAEGRGEEEIKNVKVVEIYIG-
1g6hA           GQIIAEGRGEEEIKNVKVVEIYIG-
1gajA           GQIIAEGRGEEEIKNVKVVEIYIG-
2it1B           GEILQVGTPDEVYYKPKYK------
2it1A           GEILQVGTPDEVYYKPKYK------
2oukB           GYIIEEGKPEDL-------------
2oljA           GYIIEEGKPEDL-------------
1q12A           GRVAQVGKPLELYH-----------
3fh6A           GRVAQVGKPLELYH-----------
2awoA           GRVAQVGKPLELYH-----------
2awnB           GRVAQVGKPLELYH-----------
2r6gB           GRVAQVGKPLELYH-----------
2r6gA           GRVAQVGKPLELYH-----------
3d31A           GKLIQVGKPEEI-------------
2yyzA           GKLVQYGTPDEV-------------
1oxvA           -------------------------
1oxsC           -------------------------
2awoC           GRVAQVGKPLELYH-----------
1vplA           GTIVETGTVEELKERYKAQ------
1g291           GVLQQVGSPDEV-------------
2onkA           GRIVEKGKLKEL-------------
3dhwC           GELIEQDTVSEV-------------
2awnC           GRVAQVGKPLELYH-----------
2pcjA           GKVVGE-------------------
1l2tB           GEVERE-------------------
1l2tA           GEVERE-------------------
2hydA           GHIVETGTHREL-------------
3gfoA           GRVILQGNPKEV-------------
1z47B           GNVEQFGTPEEV-------------
1z47A           GNVEQFGTPEEV-------------
3fvqB           GRILQTASPHEL-------------
3fvqA           GRILQTASPHEL-------------
2yz2B           GKKVFDGTRME--------------
2yz2A           GKKVFDGTRME--------------
3g60A           GKVKEHGTHQQL-------------
3g5uA           GKVKEHGTHQQL-------------
1jj7A           GAIREGGTHQQL-------------
1oxxK           -------------------------
1f3oA           GEVERE-------------------
1mt0A           GKIVEQG------------------
2ff7A           GKIVEQG------------------
1xefA           GKIVEQG------------------
2ffaA           GKIVEQG------------------
2d2fA           GRVVATG------------------
1b0uA           GKIEEEGDPEQVFGN----------
2fgkA           GKIVEQG------------------
2ffbA           GKIVEQG------------------
3b5jA           GKIVEQG------------------
2d62A           -------------------------
2d2eA           GRVVATG------------------
2zu0C           GRIVKSGDFTLVK------------
2d3wA           GRIVKSGDFTLVK------------
2awnA           GRVAQVGKPLELYH-----------
2ixeA           GSVCEQGTHLQL-------------
1mv5D           GQITGSGKHNEL-------------
1mv5A           GQITGSGKHNEL-------------
2ixeD           GSVCEQGTHLQL-------------
2d3wB           GRIVKSGDFTLVK------------
2ixfD           GSVCEQGTHLQL-------------
2ixfC           GSVCEQGTHLQL-------------
2ixfA           GSVCEQGTHLQL-------------
2d3wD           GRIVKSGDFTLVK------------
2pjzA           NR--LQGP-----------------
1pf4A           GEIIERG------------------
2ixgA           GSVCEQGTHLQL-------------
2d3wC           GRIVKSGDFTLVK------------
1v43A           GQLLQIGSPTEV-------------
2bbtB           GSSYFYGTFSELQN-----------
2bbtA           GSSYFYGTFSELQN-----------
2bbsB           GSSYFYGTFSELQN-----------
2ghiA           GKIVEKGTHKDL-------------
2ghiB           GKIVEKGTHKDL-------------
2bbsA           GSSYFYGTFSELQN-----------
2pzgB           GSSYFYGTFSELQN-----------
1xmiB           GSSYFYGTFSELQN-----------
1xmiE           GSSYFYGTFSELQN-----------
1xmiC           GSSYFYGTFSELQN-----------
1xmiA           GSSYFYGTFSELQN-----------
2pzfB           GSSYFYGTFSELQN-----------
2pzfA           GSSYFYGTFSELQN-----------
1xf9D           GSSYFYGTFSELQ------------
1xf9C           GSSYFYGTFSELQ------------
1xf9B           GSSYFYGTFSELQ------------
1xf9A           GSSYFYGTFSELQ------------
1xmjA           GSSYFYGTFSELQN-----------
1xfaA           GSSYFYGTFSELQ------------
1xmiD           GSSYFYGTFSELQN-----------
1r10A           GSSYFYGTFSELQ------------
1r0zD           GSSYFYGTFSELQ------------
1r0zC           GSSYFYGTFSELQ------------
1r0zB           GSSYFYGTFSELQ------------
1r0zA           GSSYFYGTFSELQ------------
1r0xD           GSSYFYGTFSELQ------------
1r0xC           GSSYFYGTFSELQ------------
1r0xB           GSSYFYGTFSELQ------------
1r0xA           GSSYFYGTFSELQ------------
1r0wC           GSSYFYGTFSELQ------------
1r0wB           GSSYFYGTFSELQ------------
1r0wA           GSSYFYGTFSELQ------------
1q3hD           GSSYFYGTFSELQ------------
1q3hC           GSSYFYGTFSELQ------------
1q3hB           GSSYFYGTFSELQ------------
1q3hA           GSSYFYGTFSELQ------------
2pzgA           GSSYFYGTFSELQN-----------
2pzeB           GSSYFYGTFSELQN-----------
2pzeA           GSSYFYGTFSELQN-----------
2ghiC           GKIVEKGTHKDL-------------
3bk7A           -------------------------
1sgwA           -------------------------
2ghiD           GKIVEKGTHKDL-------------
2bboA           GSSYFYGTFSELQN-----------
2nq2D           -------------------------
2nq2C           -------------------------
2ihyA           -------------------------
2ihyB           -------------------------
2qi9C           GKLA-SGRREEVLTPPNLAQAY---
1l7vC           GKLA-SGRREEVLTPPNLAQAY---
1yqtA           -------------------------
2cbzA           GKISEMGSYQEL-------------
1z2rA           -------------------------
3b60A           -------------------------
2awoD           GRVAQVGKPLELYH-----------
2awnD           GRVAQVGKPLELYH-----------
2r6fB           GQIVAVGTPEEV---AEVKESHTGR
2r6fA           GQIVAVGTPEEV---AEVKESHTGR
2vf8B           GRLVAQGTPAEVAQAA---------
2vf8A           GRLVAQGTPAEVAQAA---------
2vf7C           GRLVAQGTPAEVAQAA---------
2vf7B           GRLVAQGTPAEVAQAA---------
2vf7A           GRLVAQGTPAEVAQAA---------
2ix3A           -------------------------
2iwhB           -------------------------
2fa9A           -------------------------
2ix8A           -------------------------
2iw3B           -------------------------
2iw3A           -------------------------