[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39735.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3g1zB.bssp"
#ERROR : Can't open dsspfile "3g1zA.bssp"
#ERROR : Can't open dsspfile "3e9hA.bssp"
#ERROR : Can't open dsspfile "1bbuA.bssp"
#ERROR : Can't open dsspfile "1lylB.bssp"
#ERROR : Can't open dsspfile "1lylA.bssp"
#ERROR : Can't open dsspfile "1e1tA.bssp"
#ERROR : Can't open dsspfile "1e1oA.bssp"
#ERROR : Can't open dsspfile "1bbwA.bssp"
#ERROR : Can't open dsspfile "3bjuD.bssp"
#ERROR : Can't open dsspfile "3bjuC.bssp"
#ERROR : Can't open dsspfile "3bjuB.bssp"
#ERROR : Can't open dsspfile "3bjuA.bssp"
#ERROR : Can't open dsspfile "1eqrA.bssp"
#ERROR : Can't open dsspfile "1c0aA.bssp"
#ERROR : Can't open dsspfile "1g51A.bssp"
#ERROR : Can't open dsspfile "1eovA.bssp"
#ERROR : Can't open dsspfile "1asyA.bssp"

## Summary of PDB Search
:351
    2e-39  38%  3g1zB  [x.x.x] PUTATIVE LYSYL-TRNA SYNTHETASE
    1e-38  36%  3g1zA  [x.x.x] PUTATIVE LYSYL-TRNA SYNTHETASE
    3e-27  30%  3e9hA  [x.x.x] LYSYL-TRNA SYNTHETASE
    8e-25  30%  1bbuA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    4e-24  29%  1lylB  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE (LYSU)
    4e-24  29%  1lylA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE (LYSU)
    4e-24  29%  1e1tA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    8e-24  30%  1e1oA  [b.40.4 - d.104.1] LYSYL-TRNA SYNTHETASE
    6e-22  31%  1bbwA  [b.40.4 - d.104.1] PROTEIN (LYSYL-TRNA SYNTHETASE)
    2e-14  24%  3bjuD  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-14  24%  3bjuC  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-14  24%  3bjuB  [x.x.x] LYSYL-TRNA SYNTHETASE
    2e-14  24%  3bjuA  [x.x.x] LYSYL-TRNA SYNTHETASE
    1e-04  30%  1eqrA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL-TRNA SYNTHETASE
    1e-04  30%  1c0aA  [b.40.4 - d.104.1 - d.74.4] ASPARTYL TRNA SYNTHETASE
    4e-04  39%  1g51A  [b.40.4 - d.104.1 - d.74.4] ASPARTYL-TRNA SYNTHETASE
    4e-04  40%  1eovA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
    4e-04  40%  1asyA  [b.40.4 - d.104.1] ASPARTYL-TRNA SYNTHETASE
:351

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxWDPARYLDRKPFLRARSAVTXXXXXXXXXXXXXXVETAILQLSPGNETHLHAPRTEFKGP
3g1zB           ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGP
3g1zA           ----------WQPSASI---PNLLKRAAIMAEIRRFFADRGVLEVETPCMSQATVTDIHLFPFETRFVGS
3e9hA           ----------------------------------------------------------------------
1bbuA           --------------------------------------------VETPMMQVIPGGA----AARPFITHH
1lylB           --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
1lylA           --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
1e1tA           --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
1e1oA           --------------------------------------------VETPMMQVIPGGAS-ARPFITHHNAL
1bbwA           --------------------------------------------VETPMMQVIPAARPFI----THHNAL
3bjuD           --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
3bjuC           --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
3bjuB           --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
3bjuA           --------------------------------------------IETPMMNIIPGG-----AVAKPFITY
1eqrA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1g51A           ----------------------------------------------------------------------
1eovA           ----------------------------------------------------------------TYFKGK
1asyA           ----------------------------------------------------------------TYFKGK


                         .         .         *         .         .         .         .:140
query           DGELRTRFLRTSPEFACKKLLAAGEERIFEFARVFRDRERGRLHLPEFTMLEWYRAGEGYQTVXXXXXXX
3g1zB           QGI--NLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
3g1zA           QGI--NLYLMTSPEYHMKRLLAAGCGPVFQLCRSFRNEEMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDL
3e9hA           -----TLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMLELYEAYADFRDIMKLTENL
1bbuA           NALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESL
1lylB           DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
1lylA           DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
1e1tA           DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYHDIELTESLF
1e1oA           DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRN-EGISVHNPEFTMMELYMAYADYHDIELTESLF
1bbwA           DLDM---YLRIAPELYLKRLVVGGFERVFEINRNFRN-EGISVHNPEFTMMELYMAYADYKDLIELTESL
3bjuD           HNELDMNYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
3bjuC           HNELDMNYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
3bjuB           HNELDMNYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
3bjuA           HNELDMNYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKM
1eqrA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1g51A           --------LPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLD------------------
1eovA           ------AYLAQSPQFNKQQLIVADFERVYEIGPVFRENSNTHRHMTEFTGLDMEMAFE------------
1asyA           ------AYLAQSPQFNKQQLIVADFERVYEIGPVFRENSNTHRHMTEFTGLDMEMAFE------------


                         +         .         .         .         .         *         .:210
query           XXXXXRTTGIGQFSFRGRTADPQAEPEMLTVAAAFARFAGIDLLATIIGGEGXXXXXXXXXXXXXXXXXX
3g1zB           LQ---------------QVLDCQPA-ESLSYQQAFQRHLEIDPLSA---------DKTQLREAAAKLDLE
3g1zA           LQ---------------QVLDCQPA-ESLSYQQAFQRHLEIDPLSA---DKTQLREAAAKLDLSNIADTE
3e9hA           IAHIAEVLGTTKIQYGEHLVDLTPEWRRLHMVDAIKEYVGVDFWRQMSDEEARELAKEHGVEVAPHMTFG
1bbuA           FRTLAQDIGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGL
1lylB           RTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
1lylA           RTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
1e1tA           RTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
1e1oA           RTLAQEVLGTTKVTYGEHVFDFGKPFEKLTMREAIKKYRPETDMADLDNFDAAKALAESIGITVEKSWGL
1bbwA           FRTLAQDIGKTEVTYGDVTLDFGKPFEKLTMREAIKKYRPETDMADLDNFDSAKAIAESIGIHVEKSWGL
3bjuD           VSGMVKHI-TGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGEETRKILDDICVAKAVECPPP
3bjuC           VSGMVKHI-TGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGEETRKILDDICVAKAVECPPP
3bjuB           VSGMVKHI-TGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGEETRKILDDICVAKAVECPPP
3bjuA           VSGMVKHI-TGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGEETRKILDDICVAKAVECPPP
1eqrA           ----------------------------------------------------------------------
1c0aA           ----------------------------------------------------------------------
1g51A           ----------------------------------------------------------------------
1eovA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XNWSDIFSKVLVDHIEPRLGEGRLTVLCEYPAPEAALARTKADDPRVAERFEVYACGVELANGFGELTDA
3g1zB           EDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDA
3g1zA           EDRDTLLQLLFTMGVEPHIGKEKPTFIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDA
3e9hA           HIVNEFFEQKVEDKIQP-------TFIYGHPVEISPLAKKNPDDPRFTDRFELFIVGREHANAFTELNDP
1bbuA           GRITEIFEEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1lylB           GRITEIFDEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1lylA           GRITEIFDEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1e1tA           GRITEIFDEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1e1oA           GRITEIFDEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
1bbwA           GRITEIFEEVAEAHIQP-------TFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDA
3bjuD           RTTARLLDKLVGEFLEVTCINP--TFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
3bjuC           RTTARLLDKLVGEFLEVTCINP--TFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
3bjuB           RTTARLLDKLVGEFLEVTCINP--TFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
3bjuA           RTTARLLDKLVGEFLEVTCINP--TFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDP
1eqrA           -------------------GEGGLTAMHHSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNG
1c0aA           -------------------GEGGLTAMHHSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNG
1g51A           ----------------------------------------------------------------------
1eovA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEQRLRFTASMDEKERRYGERYPLDEDFLAAVGRMPEASGVALGFDRLVMLAAGAMRIDQVVWTPPADEA
3g1zB           REQQQRF--EQDNRKRGLPQQ-PIDQNLLDALAALPDCSGVALGVDRLVMLALGAESLADVI--------
3g1zA           REQQQRFEQDNRKRAARLPQQ-PIDQNLLDALAALPDCSGVALGVDRLVMLALGAESLADVI--------
3e9hA           IDQRQRFEEQLKEREQGNDEAHEMDEDFLEALEGMPPTGGLGIGVDRLVMLLTNSPSIRDVLLFP-----
1bbuA           EDQAQRFLDQVAAKDAGDDEAMFYDEDYVTALEHLPPTAGLGIGIDRMVMLFTNSHTIRDVILFP-----
1lylB           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
1lylA           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
1e1tA           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
1e1oA           EDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFP-----
1bbwA           EDQAQRFLDQV------------YDEDYVTALEHLPPTAGLGIGIDRMVMLFTNSHTIRDVILFP-----
3bjuD           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
3bjuC           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
3bjuB           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
3bjuA           MRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFP-----
1eqrA           DMQQTVFILGINEEEQREKFGFLLD----ALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAA
1c0aA           DMQQTVFILGINEEEQREKFGFLLD----ALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAA
1g51A           ----------------------------------------------------------------------
1eovA           ----------------------------------------------------------------------
1asyA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           S
3g1zB           -
3g1zA           -
3e9hA           -
1bbuA           -
1lylB           -
1lylA           -
1e1tA           -
1e1oA           -
1bbwA           -
3bjuD           -
3bjuC           -
3bjuB           -
3bjuA           -
1eqrA           A
1c0aA           A
1g51A           -
1eovA           -
1asyA           -