[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE39945.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xxhB.bssp"
#ERROR : Can't open dsspfile "1njgA.bssp"
#ERROR : Can't open dsspfile "1njfA.bssp"
#ERROR : Can't open dsspfile "1jr3B.bssp"
#ERROR : Can't open dsspfile "1jr3A.bssp"
#ERROR : Can't open dsspfile "3gliG.bssp"
#ERROR : Can't open dsspfile "3gliB.bssp"
#ERROR : Can't open dsspfile "3glhD.bssp"
#ERROR : Can't open dsspfile "3glhB.bssp"
#ERROR : Can't open dsspfile "3glfG.bssp"
#ERROR : Can't open dsspfile "3glfD.bssp"
#ERROR : Can't open dsspfile "3glgG.bssp"
#ERROR : Can't open dsspfile "3glgD.bssp"
#ERROR : Can't open dsspfile "3glgC.bssp"
#ERROR : Can't open dsspfile "3glgB.bssp"
#ERROR : Can't open dsspfile "1jr3E.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "3glhE.bssp"
#ERROR : Can't open dsspfile "1xxhE.bssp"
#ERROR : Can't open dsspfile "1sxjC.bssp"
#ERROR : Can't open dsspfile "2gnoA.bssp"

## Summary of PDB Search
:346
    1e-11  28%  1xxhB  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    1e-11  28%  1njgA  [c.37.1] DNA POLYMERASE III SUBUNIT GAMMA
    1e-11  28%  1njfA  [c.37.1] DNA POLYMERASE III SUBUNIT GAMMA
    1e-11  28%  1jr3B  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    1e-11  28%  1jr3A  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    1e-11  28%  3gliG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-11  28%  3gliB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-11  28%  3glhD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-11  28%  3glhB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-11  28%  3glfG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-11  28%  3glfD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    2e-11  28%  3glgG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    2e-11  28%  3glgD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    2e-11  28%  3glgC  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    2e-11  28%  3glgB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    9e-10  30%  1jr3E  [c.37.1 - a.80.1] DNA POLYMERASE III, DELTA' SUBUNIT
    9e-10  30%  1a5tA  [x.x.x] DELTA PRIME
    1e-09  30%  3glhE  [x.x.x] DNA POLYMERASE III SUBUNIT DELTA'
    8e-09  32%  1xxhE  [c.37.1 - a.80.1] DNA POLYMERASE III, DELTA PRIME SUBUNIT
    1e-06  29%  1sxjC  [c.37.1 - a.80.1] ACTIVATOR 1 40 KDA SUBUNIT
    4e-04  39%  2gnoA  [x.x.x] DNA POLYMERASE III, GAMMA SUBUNIT-RELATED
:346

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxPRETTALFGHHVAEQALLDAYRGGRIAHAWLIGGAQGIGKATLAYRMARFVLAHRD
1xxhB           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1njgA           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1njfA           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1jr3B           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1jr3A           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3gliG           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3gliB           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glhD           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glhB           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glfG           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glfD           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glgG           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glgD           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glgC           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
3glgB           --------------PQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETG
1jr3E           ----------------------------EKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
1a5tA           ----------------------------EKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
3glhE           ----------------------------EKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP
1xxhE           ----------------------------EKLVASYQAGRGHHALLIQALPG-GDDALIYALSRYLLCQQP
1sxjC           ----------------------------------------------------------------------
2gnoA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PLADAVQGAASLDLDPSHPVVRHVAAEAHGGLLTLERSVNDKGVLRNVITVDESRETIGFFGSTAAVEGW
1xxhB           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
1njgA           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
1njfA           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
1jr3B           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
1jr3A           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3gliG           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3gliB           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glhD           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glhB           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glfG           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glfD           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glgG           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glgD           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glgC           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
3glgB           ITATPCGVCDNC---------REIEQGRFVDLIEIDAASRTK--------VEDTRDLLDNVQYAPARGRF
1jr3E           QGHKSCGHCRGCQL---------MQAGTHPDYYTL---APEKG--KNTLGVDAVREVTEKLNEHARLGGA
1a5tA           QGHKSCGHCRGCQL---------MQAGTHPDYYTL---APEKG--KNTLGVDAVREVTEKLNEHARLGGA
3glhE           QGHKSCGHCRGCQL---------MQAGTHPDYYTL---APEKG--KNTLGVDAVREVTEKLNEHARLGGA
1xxhE           ------QGHKSC----GHCRGCQLQAGTHPDYYTL---APEKG--KNTLGVDAVREVTEKLNEHARLGGA
1sxjC           --------------------------------------------------IDVVRNQIKDFASTRQIKGF
2gnoA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVCIVDTVDDLNASSANALLKVIEEPPQRSLFLLISNSPARVLPTIQSRCRKLMLRPxxxxxxxxxxxxx
1xxhB           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
1njgA           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
1njfA           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
1jr3B           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
1jr3A           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3gliG           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3gliB           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3glhD           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3glhB           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3glfG           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3glfD           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------
3glgG           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATADPQKLPVTILSRCLQFHLK--------------
3glgD           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATADPQKLPVTILSRCLQFHLK--------------
3glgC           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATADPQKLPVTILSRCLQFHLK--------------
3glgB           KVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATADPQKLPVTILSRCLQFHLK--------------
1jr3E           KVVWVXXXXXXXXXXXXXXXXXXEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
1a5tA           KVVWVXXXXXXXXXXXXXXXXXXEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
3glhE           KVVWVXXXXXXXXXXXXXXXXXXEEPPAETWFFLATREPERLLATLRSRCRLHYLPP-------------
1xxhE           KVVWVXXXXXXXXXXXXXXXXXXEEPPAETWFFLATREPERLLATLRSRCRLHYLAP-------------
1sxjC           KLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSQCTRFRFQP-------------
2gnoA           --------------AANAFLKALEEPPEYAVIVLNTRRWHYLLPTIKSRVFRVVV---------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           ----------------------------------------------------------------------
1njgA           ----------------------------------------------------------------------
1njfA           ----------------------------------------------------------------------
1jr3B           ----------------------------------------------------------------------
1jr3A           ----------------------------------------------------------------------
3gliG           ----------------------------------------------------------------------
3gliB           ----------------------------------------------------------------------
3glhD           ----------------------------------------------------------------------
3glhB           ----------------------------------------------------------------------
3glfG           ----------------------------------------------------------------------
3glfD           ----------------------------------------------------------------------
3glgG           ----------------------------------------------------------------------
3glgD           ----------------------------------------------------------------------
3glgC           ----------------------------------------------------------------------
3glgB           ----------------------------------------------------------------------
1jr3E           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
3glhE           ----------------------------------------------------------------------
1xxhE           ----------------------------------------------------------------------
1sxjC           ----------------------------------------------------------------------
2gnoA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           ------------------------------------------------------------------
1njgA           ------------------------------------------------------------------
1njfA           ------------------------------------------------------------------
1jr3B           ------------------------------------------------------------------
1jr3A           ------------------------------------------------------------------
3gliG           ------------------------------------------------------------------
3gliB           ------------------------------------------------------------------
3glhD           ------------------------------------------------------------------
3glhB           ------------------------------------------------------------------
3glfG           ------------------------------------------------------------------
3glfD           ------------------------------------------------------------------
3glgG           ------------------------------------------------------------------
3glgD           ------------------------------------------------------------------
3glgC           ------------------------------------------------------------------
3glgB           ------------------------------------------------------------------
1jr3E           ------------------------------------------------------------------
1a5tA           ------------------------------------------------------------------
3glhE           ------------------------------------------------------------------
1xxhE           ------------------------------------------------------------------
1sxjC           ------------------------------------------------------------------
2gnoA           ------------------------------------------------------------------