[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE40040.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3exeE.bssp"
#ERROR : Can't open dsspfile "3exeC.bssp"
#ERROR : Can't open dsspfile "3exeA.bssp"
#ERROR : Can't open dsspfile "2ozlA.bssp"
#ERROR : Can't open dsspfile "3exfC.bssp"
#ERROR : Can't open dsspfile "3exfA.bssp"
#ERROR : Can't open dsspfile "3exhC.bssp"
#ERROR : Can't open dsspfile "3exhA.bssp"
#ERROR : Can't open dsspfile "3exgE.bssp"
#ERROR : Can't open dsspfile "3exgW.bssp"
#ERROR : Can't open dsspfile "3exgG.bssp"
#ERROR : Can't open dsspfile "3exgU.bssp"
#ERROR : Can't open dsspfile "3exgK.bssp"
#ERROR : Can't open dsspfile "3exgI.bssp"
#ERROR : Can't open dsspfile "3exgA.bssp"
#ERROR : Can't open dsspfile "3exg3.bssp"
#ERROR : Can't open dsspfile "3exgS.bssp"
#ERROR : Can't open dsspfile "1ni4A.bssp"
#ERROR : Can't open dsspfile "3exg1.bssp"
#ERROR : Can't open dsspfile "3exgO.bssp"
#ERROR : Can't open dsspfile "3exhE.bssp"
#ERROR : Can't open dsspfile "3exiA.bssp"
#ERROR : Can't open dsspfile "1umdC.bssp"
#ERROR : Can't open dsspfile "1umdA.bssp"
#ERROR : Can't open dsspfile "2bffA.bssp"
#ERROR : Can't open dsspfile "1u5bA.bssp"
#ERROR : Can't open dsspfile "1wciA.bssp"
#ERROR : Can't open dsspfile "1olxA.bssp"
#ERROR : Can't open dsspfile "2beuA.bssp"
#ERROR : Can't open dsspfile "1olsA.bssp"
#ERROR : Can't open dsspfile "1x7zA.bssp"
#ERROR : Can't open dsspfile "1dtwA.bssp"
#ERROR : Can't open dsspfile "2j9fA.bssp"
#ERROR : Can't open dsspfile "1w85G.bssp"
#ERROR : Can't open dsspfile "1w85C.bssp"
#ERROR : Can't open dsspfile "3dvaA.bssp"
#ERROR : Can't open dsspfile "1v1mA.bssp"
#ERROR : Can't open dsspfile "2bfeA.bssp"
#ERROR : Can't open dsspfile "2bfbA.bssp"
#ERROR : Can't open dsspfile "1x7xA.bssp"
#ERROR : Can't open dsspfile "1x7wA.bssp"
#ERROR : Can't open dsspfile "1w85A.bssp"
#ERROR : Can't open dsspfile "1v16A.bssp"
#ERROR : Can't open dsspfile "1oluA.bssp"
#ERROR : Can't open dsspfile "2bfdA.bssp"
#ERROR : Can't open dsspfile "2bfcA.bssp"
#ERROR : Can't open dsspfile "1um9C.bssp"
#ERROR : Can't open dsspfile "1v11A.bssp"
#ERROR : Can't open dsspfile "3dvaE.bssp"
#ERROR : Can't open dsspfile "1um9A.bssp"
#ERROR : Can't open dsspfile "3dv0C.bssp"
#ERROR : Can't open dsspfile "3dv0G.bssp"
#ERROR : Can't open dsspfile "3dv0A.bssp"
#ERROR : Can't open dsspfile "3dv0E.bssp"
#ERROR : Can't open dsspfile "1w88A.bssp"
#ERROR : Can't open dsspfile "1w88C.bssp"
#ERROR : Can't open dsspfile "1w85E.bssp"
#ERROR : Can't open dsspfile "1v1rA.bssp"
#ERROR : Can't open dsspfile "2bp7A.bssp"
#ERROR : Can't open dsspfile "1w88G.bssp"
#ERROR : Can't open dsspfile "1w88E.bssp"
#ERROR : Can't open dsspfile "1qs0A.bssp"

## Summary of PDB Search
:344
    2e-85  54%  3exeE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-85  54%  3exeC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-85  54%  3exeA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-85  53%  2ozlA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT ALPHA
    5e-85  53%  3exfC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-85  53%  3exfA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    4e-83  53%  3exhC  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-82  53%  3exhA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-74  52%  3exgE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-74  52%  3exgW  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-74  52%  3exgG  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-74  52%  3exgU  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-73  51%  3exgK  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-73  52%  3exgI  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-72  52%  3exgA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-72  52%  3exg3  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    6e-72  52%  3exgS  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-69  52%  1ni4A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT: ALPHA
    4e-69  52%  3exg1  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    8e-67  51%  3exgO  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    4e-66  52%  3exhE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-63  52%  3exiA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-31  32%  1umdC  [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    2e-31  32%  1umdA  [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    8e-30  28%  2bffA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-29  27%  1u5bA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-29  27%  1wciA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-29  27%  1olxA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-29  27%  2beuA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-29  27%  1olsA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    5e-29  27%  1x7zA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-28  28%  1dtwA  [c.36.1] BRANCHED-CHAIN ALPHA-KETO ACID DEHYDROGENASE
    2e-28  28%  2j9fA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    3e-27  32%  1w85G  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    3e-27  32%  1w85C  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    5e-27  32%  3dvaA  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-26  27%  1v1mA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-26  27%  2bfeA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-25  27%  2bfbA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-25  27%  1x7xA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-25  27%  1x7wA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-25  32%  1w85A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    2e-25  27%  1v16A  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-25  27%  1oluA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    4e-25  27%  2bfdA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    6e-25  27%  2bfcA  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    7e-25  32%  1um9C  [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    1e-24  27%  1v11A  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    1e-24  30%  3dvaE  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-24  32%  1um9A  [c.36.1] 2-OXO ACID DEHYDROGENASE ALPHA SUBUNIT
    5e-24  31%  3dv0C  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    2e-23  31%  3dv0G  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    3e-23  31%  3dv0A  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    5e-23  29%  3dv0E  [x.x.x] PYRUVATE DEHYDROGENASE E1 COMPONENT SUBUNIT
    1e-22  31%  1w88A  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    2e-22  31%  1w88C  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    4e-21  32%  1w85E  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    7e-21  26%  1v1rA  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    9e-21  26%  2bp7A  [x.x.x] 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
    2e-18  31%  1w88G  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    4e-15  30%  1w88E  [c.36.1] PYRUVATE DEHYDROGENASE E1 COMPONENT, ALPHA
    2e-14  28%  1qs0A  [c.36.1] 2-OXOISOVALERATE DEHYDROGENASE ALPHA-SUBUNIT
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxGPTKSKVPDFTKEQELHAFRDMLLIRRFEEKAGQLYGMGAIGGFCHLYIGQE
3exeE           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exeC           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exeA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
2ozlA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exfC           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exfA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exhC           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exhA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgE           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgW           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgG           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgU           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgK           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgI           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exg3           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgS           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
1ni4A           ------------------GPPVTTV--LTREDGLKYYRQTV---RRELKADQLYKQKIIRGFCHLCDGQE
3exg1           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exgO           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exhE           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
3exiA           ------------------GPPVTTV--LTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQE
1umdC           --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
1umdA           --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
2bffA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1u5bA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1wciA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1olxA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2beuA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1olsA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1x7zA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1dtwA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2j9fA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1w85G           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1w85C           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
3dvaA           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1v1mA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bfeA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bfbA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1x7xA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1x7wA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1w85A           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1v16A           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1oluA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bfdA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bfcA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
1um9C           --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
1v11A           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
3dvaE           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1um9A           --------------------------DLEGEKLRRLYRDMLAARMLDERYTILIRTGKTS-FIAPAAGHE
3dv0C           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
3dv0G           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
3dv0A           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
3dv0E           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1w88A           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1w88C           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1w85E           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1v1rA           ----------------------SEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNY-GEE
2bp7A           ------------------------------------------------------------------LGEE
1w88G           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1w88E           ------------------------MPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPT-AGQE
1qs0A           ------------------------------------------------------------------LGEE


                         .         .         *         .         .         .         .:140
query           AVVVGMQMALREGDQVITGYRDHGHMLACEMDAKGVMAELTXXXXXXXXXXXXXMHMFSMEKHFYGGHGI
3exeE           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exeC           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exeA           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
2ozlA           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exfC           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exfA           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exhC           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exhA           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgE           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgW           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgG           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgU           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgK           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgI           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgA           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exg3           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgS           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
1ni4A           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSHYA----KNFYGGNGI
3exg1           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exgO           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exhE           ACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
3exiA           ACCVGLEAGINPTDHLITAFRAHGFTFTRGLSVREILAELTXXXXXXXXXXXXSMHMYA--KNFYGGNGI
1umdC           AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
1umdA           AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
2bffA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1u5bA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1wciA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1olxA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2beuA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1olsA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1x7zA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1dtwA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2j9fA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1w85G           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1w85C           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
3dvaA           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1v1mA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfeA           GTHVGSAAALDNTDLVFGAAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfbA           GTHVGSAAALDNTDLVFGAYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1x7xA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1x7wA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1w85A           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1v16A           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1oluA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfdA           GTHVGSAAALDNTDLVFGQAREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bfcA           GTHVGSAAALDNTDLVFGQFREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
1um9C           AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
1v11A           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
3dvaE           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1um9A           AAQVAIAHAIRPGDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASP
3dv0C           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
3dv0G           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
3dv0A           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
3dv0E           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1w88A           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1w88C           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1w85E           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1v1rA           GTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSP
2bp7A           AIGSGQALALNRTDMCFPTYRQQSILMARDVSLVEMICQLLSNERDPLKGRQLPIMYSVREAGFFTISGN
1w88G           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1w88E           ASQIASHFALEKEDFILPGYRDVPQII-------------------WHGLPLYQAFLFS-RGHFHGNQIP
1qs0A           AIGSGQALALNRTDCFPT-YRQQS-ILARDVSLVEICQLLSNERDPLKGRQ---LPIYSVEAGFFTISGN


                         +         .         .         .         .         *         .:210
query           VGAQVSLGTGIAFANRYRDNGSVCLAYFGDGASNQGQVYESFNMAELWKLPVVYVIENNRYAMGTSVTRS
3exeE           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
3exeC           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
3exeA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
2ozlA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERA
3exfC           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTAVERA
3exfA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTAVERA
3exhC           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTAVERA
3exhA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMG---ERA
3exgE           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exgW           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exgG           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exgU           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exgK           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENN---------RA
3exgI           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR------VERA
3exgA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exg3           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR-------ERA
3exgS           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENN---------RA
1ni4A           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYN-AALWKLPCIFICENNRYG-GTSVERA
3exg1           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR--------RA
3exgO           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENN---------RA
3exhE           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR-------ERA
3exiA           VGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNR----------
1umdC           IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQ
1umdA           IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISVDYRHQ
2bffA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1u5bA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1wciA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1olxA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2beuA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1olsA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1x7zA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1dtwA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2j9fA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1w85G           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1w85C           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dvaA           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQ
1v1mA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfeA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfbA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1x7xA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1x7wA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1w85A           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1v16A           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1oluA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfdA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
2bfcA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
1um9C           IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTI-------
1v11A           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAISTPTSEQ
3dvaE           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAASTPVEKQ
1um9A           IASHVPPAAGAAISMKLLRTGQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFPTI-------
3dv0C           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dv0G           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dv0A           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
3dv0E           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1w88A           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1w88C           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRFAISTPVEKQ
1w85E           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNR--------KQ
1v1rA           LATQIPQXXXXXXXXXXXXXXXXXICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNN--------SEQ
2bp7A           LATQFVQAVGWAMASAIKGDTKIASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTQAIAG
1w88G           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRFAQTVAKT--
1w88E           EGVNVXXXXXXXLGLKMRGKKAVAITYTGDGGTSQGNFYQGINFAGAFKAPAIFVVQNNRF---------
1qs0A           LATQFVQAVGWA-ASAIKGDTKIASAWIGDGATAESDFHTALTFAHVYRAPVILNVVNNQWAISTQAIAG


                         .         .         .         +         .         .         .:280
query           SAQTDFSKRGVSFNIPGEQVDGMDVRAVKAAGDKAVAHCRAGNGPYILEMQTYRYRGHSMSDPAKYRTRE
3exeE           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
3exeC           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
3exeA           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVSYRTRE
2ozlA           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHEMSDPVSYRTRE
3exfC           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRTRE
3exfA           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRTRE
3exhC           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGH-MSDPVAYRTRE
3exhA           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHGHSMSDPVAYRTRE
3exgE           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH-----DPVAYRTRE
3exgW           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYHA--------YRTRE
3exgG           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH-------VAYRTRE
3exgU           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH-----PGVAYRTRE
3exgK           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRYH-----PGVAYRTRE
3exgI           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR-----------YHTRE
3exgA           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR-----------YHTRE
3exg3           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRY------------TRE
3exgS           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYR-----------YHTRE
1ni4A           AASTDYYKRGDF--IPGLRVDG-DILCVREATRFAAAYCRSGKGP-ILELQTYRYHGHSSDPGVSYRTRE
3exg1           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTYRY---------------
3exgO           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTY-----------------
3exhE           AASTDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTY-----------------
3exiA           ---TDYYKRGDF--IPGLRVDGMDILCVREATRFAAAYCRSGKGPILMELQTY-----------------
1umdC           THSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDSRYRPKE
1umdA           THSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDSRYRPKE
2bffA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYR---
1u5bA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRVN
1wciA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYRWD
1olxA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSS-AYRN
2beuA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSS-AYRN
1olsA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHH--SDDSSYRYWD
1x7zA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHDTSDDSSAYRVN
1dtwA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSYR---
2j9fA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSD--------
1w85G           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSDPTRYRSK-
1w85C           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSDPTRYRSK-
3dvaA           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSDPTRYRSK-
1v1mA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRIGDH------------
2bfeA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRI-GHS-----------
2bfbA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYR----------------
1x7xA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYR----------------
1x7wA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYR----------------
1w85A           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDSKELENE
1v16A           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRI---------------
1oluA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYR----------------
2bfdA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYR----------------
2bfcA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYRI---------------
1um9C           ------ADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHSSADDRK-----
1v11A           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYAI---------------
3dvaE           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDNEWAKKD
1um9A           ------ADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYGPHRKKDP-------
3dv0C           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTENEWAK-----
3dv0G           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHT-----------
3dv0A           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPH------------
3dv0E           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYEWAKKDPLVRFRKFL
1w88A           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYK--------------
1w88C           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRY---------------
1w85E           TVAKTLAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDKELENE
1v1rA           YRGDGIAARGPGYGIMSIRVDGNDVFAVYNATKEARRRAVAENQPFLIEAMTYH----------------
2bp7A           GESTTFAGRGVGCGIASLRVDGNDFVXXXXXXXXXXXXXXXGLGPSLIEWVTYRAGPHSTSDPSKYRPAD
1w88G           -----LAQKAVAAGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIE---------------------
1w88E           -XXXXXXXXXXXXGIPGIQVDGMDPLAVYAAVKAARERAINGEGPTLIE---------------------
1qs0A           GESTTFAGRGVGCGIASLRVDGNDFVXXXXXXXXXXXXXXXGLGPSLIEWVTYRAGPHSTSDPSKYRPAD


                         .         *         .         .         .         .         +:350
query           EVDKIRNDQDPIEQVRQRLLGSDMTEDDLKKIDAEVRKIVNEAADFAQNDPEPDPSELYTDVYR
3exeE           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exeC           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exeA           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
2ozlA           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exfC           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exfA           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exhC           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exhA           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgE           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgW           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgG           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgU           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgK           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgI           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgA           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exg3           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgS           EIQEVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
1ni4A           EIQEVRSKSDPI-LLKDRVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exg1           ---EVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exgO           ---EVRSKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exhE           ------SKSDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
3exiA           --------SDPIMLLKDRMVNSNLASEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIY-
1umdC           EVAFWRK-KDPIPRFRRFL---------------------------------------------
1umdA           EVAFWRK-KDPIPRFRRFL---------------------------------------------
2bffA           EVGYWDKQDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1u5bA           YWDK---QDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1wciA           KQD------HPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1olxA           YWDK---QDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2beuA           YWDK---QDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1olsA           KQD------HPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1x7zA           YWDK---QDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1dtwA           ---------HPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2j9fA           --DSSAYDH-PISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1w85G           ELENEWAKKDPLVRFRKFL---------------------------------------------
1w85C           ELENEWAKKDPLVRFRKFL---------------------------------------------
3dvaA           ELENEWAKKDPLVRFRKFL---------------------------------------------
1v1mA           ----------PISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfeA           -------TDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfbA           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1x7xA           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1x7wA           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1w85A           WAKK-----DPLVRFRKFL---------------------------------------------
1v16A           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1oluA           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfdA           ----IGSTDHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bfcA           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
1um9C           ----------------------------------------------------------------
1v11A           --------DHPISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
3dvaE           PLVRFR----------------------------------------------------------
1um9A           ----------------------------------------------------------------
3dv0C           ----------------------------------------------------------------
3dv0G           ----------------------------------------------------------------
3dv0A           ----------------------------------------------------------------
3dv0E           EAKGLWSEEE------------------------------------------------------
1w88A           ----------------------------------------------------------------
1w88C           ----------------------------------------------------------------
1w85E           WAKK-----DPLVRFRKFL---------------------------------------------
1v1rA           ----------PISRLRHYLLSQGWWDEEQEKARKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQ
2bp7A           DWSHFPLG-DPIARLKQHLIKGHWSEEEHQATTAEFEAAVIAAQKEAENGHIPSAASMFEDVYK
1w88G           ----------------------------------------------------------------
1w88E           ----------------------------------------------------------------
1qs0A           DWSHFPLG-DPIARLKQHLI--------------------------------------------