[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE40088.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3frqA.bssp"
#ERROR : Can't open dsspfile "3frqB.bssp"
#ERROR : Can't open dsspfile "3g56A.bssp"
#ERROR : Can't open dsspfile "3g56B.bssp"
#ERROR : Can't open dsspfile "2g7sA.bssp"
#ERROR : Can't open dsspfile "2qopA.bssp"
#ERROR : Can't open dsspfile "3geuA.bssp"

## Summary of PDB Search
:217
    5e-27  37%  3frqA  [x.x.x] REPRESSOR PROTEIN MPHR(A)
    2e-26  37%  3frqB  [x.x.x] REPRESSOR PROTEIN MPHR(A)
    1e-24  37%  3g56A  [x.x.x] REGULATOR OF MACROLIDE 2'-PHOSPHOTRANSFERASE I
    2e-24  37%  3g56B  [x.x.x] REGULATOR OF MACROLIDE 2'-PHOSPHOTRANSFERASE I
    6e-06  32%  2g7sA  [x.x.x] TRANSCRIPTIONAL REGULATOR, TETR FAMILY
    1e-05  41%  2qopA  [x.x.x] HTH-TYPE TRANSCRIPTIONAL REGULATOR ACRR
    3e-04  24%  3geuA  [x.x.x] INTERCELLULAR ADHESION PROTEIN R
:217

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLHSDDDILDTAQLVLLRQGPSHFTLSDVAKAVGISRA
3frqA           --------------------------------KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRA
3frqB           ---------------------------------LKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRA
3g56A           -----------------------------------SDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRA
3g56B           ---------------------------------LKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRA
2g7sA           -------------------------------------DDILQCARTLIIRGGYNSFSYADISQVVGIRNA
2qopA           ---------------------------------------ILDVALRLFSQQGVSSTSLGEIAKAAGVTRG
3geuA           ----------------------------------NAKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKA


                         .         .         *         .         .         .         .:140
query           ALIQRFTDKATLQRRIMERMTQEVRDYFDAAPSHTGLAPLWTMLKDLIGGMGSGEDAAGHLLLYWGDTQX
3frqA           ALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQV
3frqB           ALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQV
3g56A           ALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSM---NDFSVNYLISWYELQV
3g56B           ALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNT---FSVNYLISWYELQV
2g7sA           SIHHHFPSKSDLVCKLVSQYRQE-----------------------------------------------
2qopA           AIYWHFKDKSDLFSEIWE----------------------------------------------------
3geuA           SLYYHFDSKKSIYEQSVKCCFDYLNNIINQNKSNYSIDALYQFLFEFI----------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXGAIERRLPSEPHNPEQASGLVQAVIQGACMQWLIARNGPLDAFMTEQTRQVLSVL
3frqA           PELRTLAIQRNRAVVEGIRKR--XXXXXXXXXXXXXHSVIAGATMQWAVDPDGELADHVLAQIAAILCLM
3frqB           PELRTLAIQRNRAVVEGIRKR--XXXXXXXXXXXXXHSVIAGATMQWAVDPDGELADHVLAQIAAILCLM
3g56A           PELRTLAIQRNRAVVEGIRKR--XXXXXXXXXXXXXHSVIAGATMQWAVDPDGELADHVLAQIAAILCLM
3g56B           PELRTLAIQRNRAVVEGIRKR--XXXXXXXXXXXXXHSVIAGATMQWAVDPDGELADHVLAQIAAILCLM
2g7sA           ----------------------------------------------------------------------
2qopA           ----------------------------------------------------------------------
3geuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           YPGHxxx
3frqA           FPEH---
3frqB           FPEH---
3g56A           FPEH---
3g56B           FPEH---
2g7sA           -------
2qopA           -------
3geuA           -------