[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE40227.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1c7iA.bssp"
#ERROR : Can't open dsspfile "1c00A.bssp"

## Summary of PDB Search
:92
    7e-04  34%  1c7iA  [c.69.1] PROTEIN (PARA-NITROBENZYL ESTERASE)
    7e-04  34%  1c00A  [x.x.x] PARA-NITROBENZYL ESTERASE
:92

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xKPEDFEPWVGRAVRVATVPEPVELTLIRLQRKPLFIGAEREPFSLFFEAPDDVYLLDAAYEFDCGRGGP
1c7iA           -KENIFQLFFQPALDPKTLPEEPEKSIAEGAASPLLIGTTRDEGYFFFTPDSDVYTLDAALEYLLGK--P
1c00A           -KENIFQLFFQPALDPKTLPEEPEKSIAEGAASPLLIGTTRDEGYFFFTPDSDVYTLDAALEYLLGK--P


                         .         .         *         .         .         .         .:140
query           YTILISQLQPRNxxxxxxxxxx
1c7iA           LAEKVADLYPRS----------
1c00A           LAEKVADLYPRS----------