[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37468.1

[Show Plain Result]


## Summary of Sequence Search
    1::89
    1::89      2e-46 100%   89 aa  RS15_RHOPS RecName: Full=30S ribosomal protein S15;
    1::89      5e-46  99%   89 aa  RS15_RHOP2 RecName: Full=30S ribosomal protein S15;
    1::89      3e-43  93%   89 aa  RS15_RHOPT RecName: Full=30S ribosomal protein S15;
    1::89      3e-43  93%   89 aa  RS15_RHOPA RecName: Full=30S ribosomal protein S15;AltName:
    1::89      5e-43  93%   89 aa  RS15_RHOPB RecName: Full=30S ribosomal protein S15;
    1::89      1e-42  92%   89 aa  RS15_OLICO RecName: Full=30S ribosomal protein S15;
    1::89      9e-42  91%   89 aa  RS15_RHOP5 RecName: Full=30S ribosomal protein S15;
    1::89      9e-42  91%   89 aa  RS15_NITHX RecName: Full=30S ribosomal protein S15;
    1::89      2e-41  91%   89 aa  RS15_NITWN RecName: Full=30S ribosomal protein S15;
    1::89      2e-41  90%   89 aa  RS15_BRASO RecName: Full=30S ribosomal protein S15;
    1::89      2e-41  89%   89 aa  RS15_BRASB RecName: Full=30S ribosomal protein S15;
    1::89      2e-41  90%   89 aa  RS15_BRAJA RecName: Full=30S ribosomal protein S15;
    1::89      2e-34  75%   89 aa  RS15_METNO RecName: Full=30S ribosomal protein S15;
    1::89      4e-34  76%   89 aa  RS15_METRJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-33  75%   89 aa  RS15_XANP2 RecName: Full=30S ribosomal protein S15;
    1::89      2e-33  73%   89 aa  RS15_METSB RecName: Full=30S ribosomal protein S15;
    1::89      2e-33  74%   89 aa  RS15_METS4 RecName: Full=30S ribosomal protein S15;
    1::89      3e-33  74%   89 aa  RS15_PARL1 RecName: Full=30S ribosomal protein S15;
    1::89      8e-33  74%   89 aa  RS15_BEII9 RecName: Full=30S ribosomal protein S15;
    1::89      1e-32  72%   89 aa  RS15_SPHAL RecName: Full=30S ribosomal protein S15;
    1::89      1e-32  73%   89 aa  RS15_METEP RecName: Full=30S ribosomal protein S15;
    1::89      1e-32  73%   89 aa  RS15_METC4 RecName: Full=30S ribosomal protein S15;
    1::89      1e-32  73%   89 aa  RS15_METPB RecName: Full=30S ribosomal protein S15;
    1::89      1e-32  74%   89 aa  RS15_AZOC5 RecName: Full=30S ribosomal protein S15;
    1::89      2e-32  73%   89 aa  RS15_MESSB RecName: Full=30S ribosomal protein S15;
    1::89      3e-32  74%   89 aa  RS15_PHEZH RecName: Full=30S ribosomal protein S15;
    1::89      1e-31  71%   89 aa  RS15_BARBK RecName: Full=30S ribosomal protein S15;
    1::89      1e-31  72%   89 aa  RS15_CAUCR RecName: Full=30S ribosomal protein S15;
    1::89      1e-31  72%   89 aa  RS15_CAUCN RecName: Full=30S ribosomal protein S15;
    1::89      2e-31  72%   89 aa  RS15_RHISN RecName: Full=30S ribosomal protein S15;
    1::89      2e-31  72%   89 aa  RS15_RHILO RecName: Full=30S ribosomal protein S15;
    1::89      2e-31  72%   89 aa  RS15_RHIEC RecName: Full=30S ribosomal protein S15;
    1::89      2e-31  72%   89 aa  RS15_RHIE6 RecName: Full=30S ribosomal protein S15;
    1::89      2e-31  70%   89 aa  RS15_NOVAD RecName: Full=30S ribosomal protein S15;
    1::89      3e-31  70%   89 aa  RS15_ROSDO RecName: Full=30S ribosomal protein S15;
    1::89      7e-31  71%   89 aa  RS15_RHILW RecName: Full=30S ribosomal protein S15;
    1::89      7e-31  72%   89 aa  RS15_AGRRK RecName: Full=30S ribosomal protein S15;
    1::89      9e-31  69%   89 aa  RS15_SILPO RecName: Full=30S ribosomal protein S15;
    1::89      9e-31  71%   89 aa  RS15_RHIL3 RecName: Full=30S ribosomal protein S15;
    1::89      9e-31  69%   89 aa  RS15_BARQU RecName: Full=30S ribosomal protein S15;
    1::89      9e-31  69%   89 aa  RS15_BARHE RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_CAUSK RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUSU RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUSI RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUO2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUME RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUMB RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUC2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUAB RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUA2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  71%   89 aa  RS15_BRUA1 RecName: Full=30S ribosomal protein S15;
    1::89      1e-30  67%   89 aa  RS15_BART1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-30  69%   89 aa  RS15_ZYMMO RecName: Full=30S ribosomal protein S15;
    1::89      2e-30  70%   89 aa  RS15_MARMM RecName: Full=30S ribosomal protein S15;
    1::89      3e-30  70%   89 aa  RS15_OCHA4 RecName: Full=30S ribosomal protein S15;
    1::89      5e-30  67%   89 aa  RS15_RHOS5 RecName: Full=30S ribosomal protein S15;
    1::89      5e-30  70%   89 aa  RS15_PARDP RecName: Full=30S ribosomal protein S15;
    1::89      6e-30  67%   89 aa  RS15_DINSH RecName: Full=30S ribosomal protein S15;
    1::89      1e-29  70%   89 aa  RS15_HYPNA RecName: Full=30S ribosomal protein S15;
    1::89      4e-29  66%   89 aa  RS15_SILST RecName: Full=30S ribosomal protein S15;
    1::89      4e-29  66%   89 aa  RS15_GLUOX RecName: Full=30S ribosomal protein S15;
    1::89      1e-28  66%   89 aa  RS15_RHORT RecName: Full=30S ribosomal protein S15;
    1::89      3e-28  64%   89 aa  RS15_GRABC RecName: Full=30S ribosomal protein S15;
    1::89      4e-28  63%   89 aa  RS15_ERYLH RecName: Full=30S ribosomal protein S15;
    1::89      7e-28  63%   89 aa  RS15_RHOCS RecName: Full=30S ribosomal protein S15;
    1::89      1e-27  63%   89 aa  RS15_JANSC RecName: Full=30S ribosomal protein S15;
    1::89      3e-27  63%   89 aa  RS15_GLUDA RecName: Full=30S ribosomal protein S15;
    1::89      4e-27  57%   89 aa  RS15_EXIS2 RecName: Full=30S ribosomal protein S15;
    1::89      5e-27  63%   89 aa  RS15_MYXXD RecName: Full=30S ribosomal protein S15;
    1::89      6e-27  62%   89 aa  RS15_MAGSM RecName: Full=30S ribosomal protein S15;
    2::88      8e-27  60%   88 aa  RS15_GEOSM RecName: Full=30S ribosomal protein S15;
    2::88      8e-27  60%   88 aa  RS15_GEOBB RecName: Full=30S ribosomal protein S15;
    1::86      1e-26  65%   86 aa  RS15_STRMK RecName: Full=30S ribosomal protein S15;
    1::86      1e-26  65%   86 aa  RS15_STRM5 RecName: Full=30S ribosomal protein S15;
    7::86      1e-26  66%   86 aa  RS15_XANOR RecName: Full=30S ribosomal protein S15;
    7::86      1e-26  66%   86 aa  RS15_XANOP RecName: Full=30S ribosomal protein S15;
    7::86      1e-26  66%   86 aa  RS15_XANOM RecName: Full=30S ribosomal protein S15;
    7::86      1e-26  66%   86 aa  RS15_XANC5 RecName: Full=30S ribosomal protein S15;
    7::86      1e-26  66%   86 aa  RS15_XANAC RecName: Full=30S ribosomal protein S15;
    2::88      1e-26  60%   88 aa  RS15_GEOMG RecName: Full=30S ribosomal protein S15;
    7::86      2e-26  66%   86 aa  RS15_XANCP RecName: Full=30S ribosomal protein S15;
    7::86      2e-26  66%   86 aa  RS15_XANCB RecName: Full=30S ribosomal protein S15;
    7::86      2e-26  66%   86 aa  RS15_XANC8 RecName: Full=30S ribosomal protein S15;
    2::88      2e-26  61%   88 aa  RS15_FRATN RecName: Full=30S ribosomal protein S15;
    2::88      3e-26  61%   88 aa  RS15_PELPD RecName: Full=30S ribosomal protein S15;
    2::88      3e-26  60%   88 aa  RS15_GEOUR RecName: Full=30S ribosomal protein S15;
    2::88      3e-26  60%   88 aa  RS15_GEOSF RecName: Full=30S ribosomal protein S15;
    1::89      3e-26  58%   89 aa  RS15_AERHH RecName: Full=30S ribosomal protein S15;
    2::88      5e-26  60%   88 aa  RS15_FRAP2 RecName: Full=30S ribosomal protein S15;
    2::88      7e-26  57%   88 aa  RS15_GEOSL RecName: Full=30S ribosomal protein S15;
    1::89      7e-26  58%   89 aa  RS15_ANASK RecName: Full=30S ribosomal protein S15;
    1::89      7e-26  58%   89 aa  RS15_ANADE RecName: Full=30S ribosomal protein S15;
    1::89      7e-26  58%   89 aa  RS15_ANAD2 RecName: Full=30S ribosomal protein S15;
    1::89      7e-26  58%   89 aa  RS15_AERS4 RecName: Full=30S ribosomal protein S15;
    1::89      9e-26  58%   89 aa  RS15_SYNFM RecName: Full=30S ribosomal protein S15;
    1::89      9e-26  61%   89 aa  RS15_MAGSA RecName: Full=30S ribosomal protein S15;
    1::89      1e-25  57%   89 aa  RS15_THEYD RecName: Full=30S ribosomal protein S15;
    1::89      1e-25  57%   89 aa  RS15_POLSQ RecName: Full=30S ribosomal protein S15;
    1::89      1e-25  55%   89 aa  RS15_HALHL RecName: Full=30S ribosomal protein S15;
    1::89      1e-25  56%   89 aa  RS15_ALHEH RecName: Full=30S ribosomal protein S15;
    1::89      2e-25  56%   89 aa  RS15_ALCBS RecName: Full=30S ribosomal protein S15;
    1::89      2e-25  58%   89 aa  RS15_GEOKA RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  55%   89 aa  RS15_TOLAT RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  58%   89 aa  RS15_RALSO RecName: Full=30S ribosomal protein S15;
    2::88      3e-25  57%   88 aa  RS15_PELCD RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  56%   89 aa  RS15_METFK RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  56%   89 aa  RS15_LARHH RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  60%   89 aa  RS15_DESVV RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  60%   89 aa  RS15_DESVH RecName: Full=30S ribosomal protein S15;
    1::89      3e-25  57%   89 aa  RS15_ANADF RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_GEOLS RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATW RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATT RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATO RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATM RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATH RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRATF RecName: Full=30S ribosomal protein S15;
    2::88      4e-25  59%   88 aa  RS15_FRAT1 RecName: Full=30S ribosomal protein S15;
    1::89      4e-25  55%   89 aa  RS15_EXISA RecName: Full=30S ribosomal protein S15;
    1::89      4e-25  56%   89 aa  RS15_DECAR RecName: Full=30S ribosomal protein S15;
    1::89      4e-25  55%   89 aa  RS15_ACIF5 RecName: Full=30S ribosomal protein S15;
    1::89      4e-25  55%   89 aa  RS15_ACIF2 RecName: Full=30S ribosomal protein S15;
    1::88      6e-25  58%   94 aa  RS15_PERMH RecName: Full=30S ribosomal protein S15;
    8::86      8e-25  63%   86 aa  RS15_XYLFM RecName: Full=30S ribosomal protein S15;
    8::86      8e-25  63%   86 aa  RS15_XYLFA RecName: Full=30S ribosomal protein S15;
    1::89      8e-25  56%   89 aa  RS15_GEOTN RecName: Full=30S ribosomal protein S15;
    1::89      8e-25  57%   89 aa  RS15_DESAA RecName: Full=30S ribosomal protein S15;
    1::89      1e-24  60%   89 aa  RS15_DESMR RecName: Full=30S ribosomal protein S15;
    1::89      1e-24  57%   89 aa  RS15_CARHZ RecName: Full=30S ribosomal protein S15;
    1::89      1e-24  55%   89 aa  RS15_BIFAA RecName: Full=30S ribosomal protein S15;
    1::89      1e-24  55%   89 aa  RS15_BIFA0 RecName: Full=30S ribosomal protein S15;
    1::89      2e-24  54%   89 aa  RS15_THIDA RecName: Full=30S ribosomal protein S15;
    8::86      2e-24  62%   86 aa  RS15_XYLFT RecName: Full=30S ribosomal protein S15;
    8::86      2e-24  62%   86 aa  RS15_XYLF2 RecName: Full=30S ribosomal protein S15;
    2::88      2e-24  56%   88 aa  RS15_DESHY RecName: Full=30S ribosomal protein S15;
    1::88      3e-24  57%   95 aa  RS15_SULSY RecName: Full=30S ribosomal protein S15;
    6::88      3e-24  59%   88 aa  RS15_SORC5 RecName: Full=30S ribosomal protein S15;
    1::89      3e-24  56%   89 aa  RS15_DESVM RecName: Full=30S ribosomal protein S15;
    1::89      3e-24  57%   89 aa  RS15_DESAD RecName: Full=30S ribosomal protein S15;
    1::89      3e-24  55%   89 aa  RS15_BACST RecName: Full=30S ribosomal protein S15;AltName:
    1::89      4e-24  56%   89 aa  RS15_DESDA RecName: Full=30S ribosomal protein S15;
    2::88      4e-24  57%   88 aa  RS15_ACIBL RecName: Full=30S ribosomal protein S15;
    1::89      5e-24  55%   89 aa  RS15_SYNWW RecName: Full=30S ribosomal protein S15;
    1::89      5e-24  54%   89 aa  RS15_BIFLO RecName: Full=30S ribosomal protein S15;
    1::89      5e-24  54%   89 aa  RS15_BIFLD RecName: Full=30S ribosomal protein S15;
    1::89      5e-24  54%   89 aa  RS15_BACP2 RecName: Full=30S ribosomal protein S15;
    1::89      5e-24  54%   89 aa  RS15_BACLD RecName: Full=30S ribosomal protein S15;
    1::89      6e-24  54%   89 aa  RS15_YEREN RecName: Full=30S ribosomal protein S15;
    1::89      6e-24  54%   89 aa  RS15_YERE8 RecName: Full=30S ribosomal protein S15;
    1::89      6e-24  54%   89 aa  RS15_PROMH RecName: Full=30S ribosomal protein S15;
    1::89      6e-24  53%   89 aa  RS15_MARMS RecName: Full=30S ribosomal protein S15;
    1::89      6e-24  55%   89 aa  RS15_BACHD RecName: Full=30S ribosomal protein S15;
    1::89      8e-24  55%   89 aa  RS15_POLNS RecName: Full=30S ribosomal protein S15;
    1::89      8e-24  53%   89 aa  RS15_HERAR RecName: Full=30S ribosomal protein S15;
    1::89      8e-24  54%   89 aa  RS15_GEOSW RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPY RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPS RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPP RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPN RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPG RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPE RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPB RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERPA RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  53%   89 aa  RS15_YERP3 RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  54%   89 aa  RS15_THISH RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  57%   89 aa  RS15_RHOS4 RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  57%   89 aa  RS15_RHOS1 RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  52%   89 aa  RS15_BREBN RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  61%   89 aa  RS15_AGRT5 RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  54%   89 aa  RS15_VIBSL RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  57%   95 aa  RS15_STRAW RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  52%   89 aa  RS15_BIFLI RecName: Full=30S ribosomal protein S15;
    1::89      1e-23  54%   89 aa  RS15_BACSU RecName: Full=30S ribosomal protein S15;AltName:
    1::89      1e-23  54%   89 aa  RS15_BACA2 RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  53%   89 aa  RS15_EDWI9 RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  54%   89 aa  RS15_DESDG RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  54%   89 aa  RS15_VIBFM RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  54%   89 aa  RS15_VIBF1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  52%   89 aa  RS15_PSEPK RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  52%   89 aa  RS15_PSEP1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  52%   89 aa  RS15_PSEE4 RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  53%   89 aa  RS15_OCEIH RecName: Full=30S ribosomal protein S15;
    1::89      2e-23  53%   89 aa  RS15_JANMA RecName: Full=30S ribosomal protein S15;
    5::88      3e-23  56%   88 aa  RS15_THEPX RecName: Full=30S ribosomal protein S15;
    5::88      3e-23  56%   88 aa  RS15_THEP3 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  56%   96 aa  RS15_STRGG RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALTY RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALTI RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALSV RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALPK RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALPC RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALPB RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALPA RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALNS RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALHS RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALG2 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALEP RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALDC RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALCH RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_SALA4 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  52%   89 aa  RS15_PSEPW RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  52%   89 aa  RS15_PSEPG RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  54%   89 aa  RS15_METCA RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_KLEP7 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_ENT38 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  53%   89 aa  RS15_CITK8 RecName: Full=30S ribosomal protein S15;
    1::89      3e-23  55%   89 aa  RS15_BACSK RecName: Full=30S ribosomal protein S15;
    5::88      4e-23  56%   88 aa  RS15_THETN RecName: Full=30S ribosomal protein S15;
    1::89      4e-23  53%   89 aa  RS15_SODGM RecName: Full=30S ribosomal protein S15;
    1::89      4e-23  53%   89 aa  RS15_KLEP3 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHISS RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHIFL RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHIF8 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHIDS RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHIBS RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_SHIB3 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  52%   89 aa  RS15_SERP5 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  52%   89 aa  RS15_PECCP RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ESCF3 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOUT RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOSM RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOSE RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOLU RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOLI RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOLC RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOL6 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOL5 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOK1 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOHS RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECODH RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECOBW RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO8A RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO81 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO7I RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO5E RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO57 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO55 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO45 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO27 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  53%   89 aa  RS15_ECO24 RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  51%   89 aa  RS15_DESRM RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  51%   89 aa  RS15_CHRSD RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  52%   89 aa  RS15_AZOSB RecName: Full=30S ribosomal protein S15;
    1::89      5e-23  55%   89 aa  RS15_ANOFW RecName: Full=30S ribosomal protein S15;
    1::89      7e-23  57%   89 aa  RS15_SINMW RecName: Full=30S ribosomal protein S15;
    1::89      7e-23  51%   89 aa  RS15_PSEU2 RecName: Full=30S ribosomal protein S15;
    1::89      7e-23  51%   89 aa  RS15_PSESM RecName: Full=30S ribosomal protein S15;
    1::89      7e-23  51%   89 aa  RS15_PSE14 RecName: Full=30S ribosomal protein S15;
    1::89      7e-23  54%   89 aa  RS15_COLP3 RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  56%   89 aa  RS15_SPHWW RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  57%   89 aa  RS15_RHIME RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  51%   89 aa  RS15_PSEMY RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  52%   89 aa  RS15_PSEAE RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  52%   89 aa  RS15_PSEAB RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  52%   89 aa  RS15_PSEA8 RecName: Full=30S ribosomal protein S15;
    1::89      9e-23  52%   89 aa  RS15_PSEA7 RecName: Full=30S ribosomal protein S15;
    5::87      9e-23  54%   87 aa  RS15_CLOPS RecName: Full=30S ribosomal protein S15;
    5::87      9e-23  54%   87 aa  RS15_CLOPE RecName: Full=30S ribosomal protein S15;
    5::87      9e-23  54%   87 aa  RS15_CLOP1 RecName: Full=30S ribosomal protein S15;
    1::88      1e-22  56%   90 aa  RS15_HELPJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_VIBCM RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_VIBCH RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_VIBC3 RecName: Full=30S ribosomal protein S15;
    1::84      2e-22  58%   95 aa  RS15_STRCO RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  51%   89 aa  RS15_PSEU5 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  53%   89 aa  RS15_PSEA6 RecName: Full=30S ribosomal protein S15;
    4::87      2e-22  57%   87 aa  RS15_CLOTH RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  54%   89 aa  RS15_BEUC1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACWK RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACHK RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACCZ RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACCR RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACCN RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC7 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC4 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC3 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC2 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACC0 RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACAN RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACAH RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_BACAC RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  51%   89 aa  RS15_AZOVD RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  52%   89 aa  RS15_PSYIN RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  49%   89 aa  RS15_PSEPF RecName: Full=30S ribosomal protein S15;
    1::89      2e-22  56%   89 aa  RS15_AGRVS RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  49%   89 aa  RS15_PSEF5 RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  53%   89 aa  RS15_PELTS RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  51%   89 aa  RS15_MOOTA RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  51%   89 aa  RS15_ERWT9 RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  51%   89 aa  RS15_ERWCT RecName: Full=30S ribosomal protein S15;
    1::89      3e-22  51%   89 aa  RS15_AZOSE RecName: Full=30S ribosomal protein S15;
    1::89      4e-22  53%   89 aa  RS15_STACT RecName: Full=30S ribosomal protein S15;
    1::89      4e-22  52%   89 aa  RS15_HAMD5 RecName: Full=30S ribosomal protein S15;
    1::89      4e-22  52%   89 aa  RS15_ALISL RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIMF RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIMB RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIMA RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIM0 RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIG2 RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_NEIG1 RecName: Full=30S ribosomal protein S15;
    1::89      5e-22  51%   89 aa  RS15_ENTFA RecName: Full=30S ribosomal protein S15;
    4::85      5e-22  55%   85 aa  RS15_CLOD6 RecName: Full=30S ribosomal protein S15;
    1::89      6e-22  52%   89 aa  RS15_COPPD RecName: Full=30S ribosomal protein S15;
    1::89      6e-22  51%   89 aa  RS15_CELJU RecName: Full=30S ribosomal protein S15;
    1::89      6e-22  53%   89 aa  RS15_ALTMD RecName: Full=30S ribosomal protein S15;
    1::88      8e-22  53%   90 aa  RS15_HELPS RecName: Full=30S ribosomal protein S15;
    5::87      8e-22  54%   87 aa  RS15_CLOB8 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  51%   89 aa  RS15_SHEDO RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  52%   89 aa  RS15_SHEB8 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  51%   89 aa  RS15_RENSM RecName: Full=30S ribosomal protein S15;
    5::87      1e-21  52%   87 aa  RS15_CLOAB RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  51%   89 aa  RS15_ARTCA RecName: Full=30S ribosomal protein S15;
    2::88      1e-21  49%   88 aa  RS15_SYNAS RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  51%   89 aa  RS15_STAS1 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  52%   89 aa  RS15_SHEB9 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  52%   89 aa  RS15_SHEB5 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  52%   89 aa  RS15_SHEB2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  48%   89 aa  RS15_MARAV RecName: Full=30S ribosomal protein S15;
    5::87      1e-21  53%   87 aa  RS15_CLONN RecName: Full=30S ribosomal protein S15;
    6::87      1e-21  56%   87 aa  RS15_CLOCE RecName: Full=30S ribosomal protein S15;
    5::87      1e-21  52%   87 aa  RS15_CLOBB RecName: Full=30S ribosomal protein S15;
    1::89      1e-21  54%   89 aa  RS15_ACICJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  52%   89 aa  RS15_STAHJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  49%   89 aa  RS15_SHESH RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  49%   89 aa  RS15_SHEAM RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  51%   89 aa  RS15_PHOLU RecName: Full=30S ribosomal protein S15;
    1::88      2e-21  53%   90 aa  RS15_HELAH RecName: Full=30S ribosomal protein S15;
    2::88      2e-21  49%   88 aa  RS15_CLOPH RecName: Full=30S ribosomal protein S15;
    5::87      2e-21  52%   87 aa  RS15_CLOBA RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  47%   89 aa  RS15_TERTT RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  51%   89 aa  RS15_SHESR RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  51%   89 aa  RS15_SHESM RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  51%   89 aa  RS15_SHESA RecName: Full=30S ribosomal protein S15;
    1::89      2e-21  51%   89 aa  RS15_SHEFN RecName: Full=30S ribosomal protein S15;
    1::88      2e-21  53%   90 aa  RS15_HELPY RecName: Full=30S ribosomal protein S15;
    1::88      2e-21  53%   90 aa  RS15_HELPH RecName: Full=30S ribosomal protein S15;
    1::88      2e-21  52%   89 aa  RS15_HELMI RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAW RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAT RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAS RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAR RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAN RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAM RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAE RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAC RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAAB RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAA9 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAA8 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAA3 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAA2 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_STAA1 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  49%   89 aa  RS15_SHEPA RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  49%   89 aa  RS15_SHEHH RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  48%   89 aa  RS15_DICTD RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  48%   89 aa  RS15_DICT6 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIBY RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIBT RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIBS RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIBC RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIB5 RecName: Full=30S ribosomal protein S15;
    1::89      3e-21  51%   89 aa  RS15_ACIB3 RecName: Full=30S ribosomal protein S15;
    1::89      4e-21  49%   89 aa  RS15_SHEPW RecName: Full=30S ribosomal protein S15;
    1::89      4e-21  51%   89 aa  RS15_DESAP RecName: Full=30S ribosomal protein S15;
    5::87      4e-21  49%   87 aa  RS15_CLOBM RecName: Full=30S ribosomal protein S15;
    5::87      4e-21  49%   87 aa  RS15_CLOBL RecName: Full=30S ribosomal protein S15;
    5::87      4e-21  49%   87 aa  RS15_CLOBK RecName: Full=30S ribosomal protein S15;
    5::87      4e-21  49%   87 aa  RS15_CLOBH RecName: Full=30S ribosomal protein S15;
    5::87      4e-21  49%   87 aa  RS15_CLOB1 RecName: Full=30S ribosomal protein S15;
    1::89      4e-21  49%   89 aa  RS15_ARTAT RecName: Full=30S ribosomal protein S15;
    1::88      5e-21  53%   90 aa  RS15_HELPG RecName: Full=30S ribosomal protein S15;
    1::88      5e-21  53%   90 aa  RS15_HELP2 RecName: Full=30S ribosomal protein S15;
    1::88      5e-21  51%   90 aa  RS15_CAMLR RecName: Full=30S ribosomal protein S15;
    1::89      7e-21  49%   89 aa  RS15_SHEON RecName: Full=30S ribosomal protein S15;
    2::88      7e-21  51%   88 aa  RS15_PSYA2 RecName: Full=30S ribosomal protein S15;
    1::89      7e-21  53%   89 aa  RS15_PSEHT RecName: Full=30S ribosomal protein S15;
    1::89      7e-21  48%   89 aa  RS15_PHOLL RecName: Full=30S ribosomal protein S15;
    1::88      7e-21  52%   91 aa  RS15_HYDS0 RecName: Full=30S ribosomal protein S15;
    1::89      7e-21  58%   93 aa  RS15_EHRCJ RecName: Full=30S ribosomal protein S15;
    1::89      7e-21  53%   89 aa  RS15_DESOH RecName: Full=30S ribosomal protein S15;
    1::89      9e-21  51%   89 aa  RS15_LYSSC RecName: Full=30S ribosomal protein S15;
    6::87      9e-21  51%   87 aa  RS15_CLOK5 RecName: Full=30S ribosomal protein S15;
    6::87      9e-21  51%   87 aa  RS15_CLOK1 RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  49%   89 aa  RS15_STAES RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  49%   89 aa  RS15_STAEQ RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISW6 RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISMO RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISMH RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISMF RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISMC RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_LISIN RecName: Full=30S ribosomal protein S15;
    2::88      1e-20  49%   88 aa  RS15_LEPBP RecName: Full=30S ribosomal protein S15;
    2::88      1e-20  49%   88 aa  RS15_LEPBA RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_HAHCH RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  48%   89 aa  RS15_SHEWM RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  49%   89 aa  RS15_SHESW RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  49%   89 aa  RS15_SHEPC RecName: Full=30S ribosomal protein S15;
   17::88      1e-20  58%   88 aa  RS15_FINM2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-20  57%   93 aa  RS15_EHRCR RecName: Full=30S ribosomal protein S15;
    2::88      1e-20  51%   88 aa  RS15_DICNV RecName: Full=30S ribosomal protein S15;
    1::88      2e-20  50%   89 aa  RS15_NITSB RecName: Full=30S ribosomal protein S15;
    1::89      2e-20  51%   89 aa  RS15_LACGA RecName: Full=30S ribosomal protein S15;
    1::89      2e-20  49%   89 aa  RS15_LACDB RecName: Full=30S ribosomal protein S15;
    1::89      2e-20  49%   89 aa  RS15_LACDA RecName: Full=30S ribosomal protein S15;
    1::89      2e-20  48%   89 aa  RS15_ARTS2 RecName: Full=30S ribosomal protein S15;
    7::88      3e-20  55%   88 aa  RS15_OPITP RecName: Full=30S ribosomal protein S15;
    1::89      3e-20  48%   89 aa  RS15_ACIAD RecName: Full=30S ribosomal protein S15;
    1::89      3e-20  47%   89 aa  RS15_SHELP RecName: Full=30S ribosomal protein S15;
    4::87      3e-20  50%   87 aa  RS15_ALKOO RecName: Full=30S ribosomal protein S15;
    3::87      4e-20  49%   87 aa  RS15_PROAC RecName: Full=30S ribosomal protein S15;
    1::89      4e-20  48%   89 aa  RS15_LACPL RecName: Full=30S ribosomal protein S15;
    1::89      4e-20  47%   89 aa  RS15_LACLS RecName: Full=30S ribosomal protein S15;
    1::89      4e-20  47%   89 aa  RS15_LACLM RecName: Full=30S ribosomal protein S15;
    1::89      4e-20  47%   89 aa  RS15_LACLA RecName: Full=30S ribosomal protein S15;
    1::88      4e-20  48%   89 aa  RS15_COXBU RecName: Full=30S ribosomal protein S15;
    1::88      4e-20  48%   89 aa  RS15_COXBR RecName: Full=30S ribosomal protein S15;
    1::88      4e-20  48%   89 aa  RS15_COXBN RecName: Full=30S ribosomal protein S15;
    1::88      4e-20  48%   89 aa  RS15_COXB1 RecName: Full=30S ribosomal protein S15;
    1::88      4e-20  50%   90 aa  RS15_CAMJD RecName: Full=30S ribosomal protein S15;
    2::88      6e-20  52%   88 aa  RS15_VARPS RecName: Full=30S ribosomal protein S15;
    1::89      6e-20  45%   89 aa  RS15_SACD2 RecName: Full=30S ribosomal protein S15;
    1::89      6e-20  56%   93 aa  RS15_EHRRW RecName: Full=30S ribosomal protein S15;
    1::89      6e-20  56%   93 aa  RS15_EHRRG RecName: Full=30S ribosomal protein S15;
    1::88      7e-20  49%   92 aa  RS15_SYMTH RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_LACJO RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURVG RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURTA RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURS3 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURPS RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURP6 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURP1 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURP0 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURMS RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURMA RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURM9 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURM7 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURM1 RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURCM RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURCJ RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURCH RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURCC RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURCA RecName: Full=30S ribosomal protein S15;
    1::89      7e-20  49%   89 aa  RS15_BURA4 RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  50%   90 aa  RS15_CAMJR RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  50%   90 aa  RS15_CAMJJ RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  50%   90 aa  RS15_CAMJE RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  50%   90 aa  RS15_CAMJ8 RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  48%   89 aa  RS15_ACAM1 RecName: Full=30S ribosomal protein S15;
    2::88      1e-19  51%   88 aa  RS15_VEREI RecName: Full=30S ribosomal protein S15;
    1::89      1e-19  48%   89 aa  RS15_PROA2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-19  48%   89 aa  RS15_NATTJ RecName: Full=30S ribosomal protein S15;
    1::89      1e-19  47%   89 aa  RS15_CHLTE RecName: Full=30S ribosomal protein S15;
    1::88      1e-19  50%   90 aa  RS15_CAMC5 RecName: Full=30S ribosomal protein S15;
    1::89      2e-19  48%   89 aa  RS15_MICAN RecName: Full=30S ribosomal protein S15;
    1::89      2e-19  47%   89 aa  RS15_CHLPB RecName: Full=30S ribosomal protein S15;
    1::89      2e-19  47%   89 aa  RS15_CHLP8 RecName: Full=30S ribosomal protein S15;
    1::89      2e-19  46%   89 aa  RS15_ACHLI RecName: Full=30S ribosomal protein S15;
    1::88      3e-19  49%   89 aa  RS15_THERP RecName: Full=30S ribosomal protein S15;
    3::84      3e-19  50%   84 aa  RS15_THEAB RecName: Full=30S ribosomal protein S15;
    1::89      3e-19  45%   89 aa  RS15_LEUMM RecName: Full=30S ribosomal protein S15;
    1::89      3e-19  48%   89 aa  RS15_BURP8 RecName: Full=30S ribosomal protein S15;
    1::89      4e-19  47%   89 aa  RS15_PSEPU RecName: Full=30S ribosomal protein S15;
    2::88      4e-19  49%   88 aa  RS15_DELAS RecName: Full=30S ribosomal protein S15;
    1::88      4e-19  48%   90 aa  RS15_CAMC1 RecName: Full=30S ribosomal protein S15;
    3::90      4e-19  48%   90 aa  RS15_BURXL RecName: Full=30S ribosomal protein S15;
    1::89      5e-19  45%   89 aa  RS15_LEUCK RecName: Full=30S ribosomal protein S15;
    2::88      5e-19  49%   88 aa  RS15_DIAST RecName: Full=30S ribosomal protein S15;
    1::89      5e-19  48%   89 aa  RS15_CYAA5 RecName: Full=30S ribosomal protein S15;
   20::88      5e-19  58%   88 aa  RS15_CALS8 RecName: Full=30S ribosomal protein S15;
   20::88      5e-19  58%   88 aa  RS15_ANATD RecName: Full=30S ribosomal protein S15;
    2::88      5e-19  49%   88 aa  RS15_ACISJ RecName: Full=30S ribosomal protein S15;
    1::88      6e-19  51%   90 aa  RS15_WOLSU RecName: Full=30S ribosomal protein S15;
    3::84      6e-19  50%   84 aa  RS15_THEM4 RecName: Full=30S ribosomal protein S15;
    1::89      6e-19  43%   89 aa  RS15_NOCFA RecName: Full=30S ribosomal protein S15;
    4::85      6e-19  51%   85 aa  RS15_FUSNN RecName: Full=30S ribosomal protein S15;
    1::89      6e-19  48%   89 aa  RS15_BAUCH RecName: Full=30S ribosomal protein S15;
    1::88      6e-19  47%   90 aa  RS15_AQUAE RecName: Full=30S ribosomal protein S15;
    2::88      6e-19  51%   88 aa  RS15_ACIAC RecName: Full=30S ribosomal protein S15;
    1::89      8e-19  45%   89 aa  RS15_PEDPA RecName: Full=30S ribosomal protein S15;
    6::87      8e-19  48%   87 aa  RS15_ALKMQ RecName: Full=30S ribosomal protein S15;
    1::88      1e-18  47%   89 aa  RS15_SYNR3 RecName: Full=30S ribosomal protein S15;
    1::88      1e-18  49%   89 aa  RS15_SYNP6 RecName: Full=30S ribosomal protein S15;
    1::88      1e-18  49%   89 aa  RS15_SYNE7 RecName: Full=30S ribosomal protein S15;
    1::89      1e-18  47%   89 aa  RS15_CYAP8 RecName: Full=30S ribosomal protein S15;
    1::89      1e-18  44%   89 aa  RS15_CHLCH RecName: Full=30S ribosomal protein S15;
    1::91      1e-18  46%   91 aa  RS15_CYTH3 RecName: Full=30S ribosomal protein S15;
    8::86      2e-18  52%   86 aa  RS15_RUTMC RecName: Full=30S ribosomal protein S15;
    2::88      2e-18  48%   88 aa  RS15_RHOFD RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACRJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACRE RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACRD RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACBA RecName: Full=30S ribosomal protein S15;
    1::88      2e-18  47%   89 aa  RS15_PROMA RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACCB RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  45%   89 aa  RS15_LACC3 RecName: Full=30S ribosomal protein S15;
    1::89      2e-18  42%   89 aa  RS15_BDEBA RecName: Full=30S ribosomal protein S15;
    1::89      3e-18  48%   89 aa  RS15_SOLUE RecName: Full=30S ribosomal protein S15;
    1::89      3e-18  46%   89 aa  RS15_PELPB RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  45%   89 aa  RS15_SYNY3 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRZT RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRZP RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRZJ RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRTD RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRT2 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRT1 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRR6 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRPS RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRPN RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRPJ RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRPI RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRP7 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRP4 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  46%   89 aa  RS15_STRP2 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  43%   89 aa  RS15_GRAFK RecName: Full=30S ribosomal protein S15;
    1::88      4e-18  44%   89 aa  RS15_CYAP4 RecName: Full=30S ribosomal protein S15;
    1::89      4e-18  45%   89 aa  RS15_CHLPD RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  46%   89 aa  RS15_STRSV RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPZ RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPM RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPG RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPD RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPC RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRPB RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRP8 RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRP6 RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRP3 RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  45%   89 aa  RS15_STRP1 RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  46%   89 aa  RS15_STRGC RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  43%   89 aa  RS15_NITMU RecName: Full=30S ribosomal protein S15;
    1::89      5e-18  53%   93 aa  RS15_ANAPZ RecName: Full=30S ribosomal protein S15;
    1::88      7e-18  43%   89 aa  RS15_TRIEI RecName: Full=30S ribosomal protein S15;
    1::89      7e-18  45%   89 aa  RS15_STRU0 RecName: Full=30S ribosomal protein S15;
    1::88      7e-18  47%   89 aa  RS15_PROMM RecName: Full=30S ribosomal protein S15;
    1::88      7e-18  47%   89 aa  RS15_PROM3 RecName: Full=30S ribosomal protein S15;
    7::88      7e-18  49%   88 aa  RS15_POLSJ RecName: Full=30S ribosomal protein S15;
    7::88      7e-18  49%   88 aa  RS15_POLNA RecName: Full=30S ribosomal protein S15;
    1::89      7e-18  43%   89 aa  RS15_NITEU RecName: Full=30S ribosomal protein S15;
    2::90      9e-18  44%   90 aa  RS15_THESQ RecName: Full=30S ribosomal protein S15;
    2::90      9e-18  44%   90 aa  RS15_THEP1 RecName: Full=30S ribosomal protein S15;
    2::90      9e-18  44%   90 aa  RS15_THEMA RecName: Full=30S ribosomal protein S15;
    2::88      9e-18  47%   88 aa  RS15_MESFL RecName: Full=30S ribosomal protein S15;
    1::82      9e-18  50%   90 aa  RS15_HELHP RecName: Full=30S ribosomal protein S15;
    2::88      1e-17  46%   88 aa  RS15_THICR RecName: Full=30S ribosomal protein S15;
    1::88      1e-17  50%   89 aa  RS15_THETH RecName: Full=30S ribosomal protein S15;
    1::88      1e-17  50%   89 aa  RS15_THET8 RecName: Full=30S ribosomal protein S15;
    1::88      1e-17  50%   89 aa  RS15_THET2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRS7 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRPF RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STREM RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRE4 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRA5 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRA3 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  45%   89 aa  RS15_STRA1 RecName: Full=30S ribosomal protein S15;
    1::89      1e-17  44%   89 aa  RS15_CHLL2 RecName: Full=30S ribosomal protein S15;
    2::88      1e-17  46%   88 aa  RS15_BORHD RecName: Full=30S ribosomal protein S15;
    2::88      1e-17  46%   88 aa  RS15_BORAP RecName: Full=30S ribosomal protein S15;
    1::88      2e-17  47%   89 aa  RS15_SYNS3 RecName: Full=30S ribosomal protein S15;
    1::89      2e-17  45%   89 aa  RS15_STRMU RecName: Full=30S ribosomal protein S15;
    6::87      2e-17  46%   87 aa  RS15_LEPCP RecName: Full=30S ribosomal protein S15;
    1::89      2e-17  45%   89 aa  RS15_KOCRD RecName: Full=30S ribosomal protein S15;
    1::88      2e-17  43%   89 aa  RS15_ANAVT RecName: Full=30S ribosomal protein S15;
    1::89      2e-17  43%   89 aa  RS15_TREDE RecName: Full=30S ribosomal protein S15;
    1::88      2e-17  49%   89 aa  RS15_SULNB RecName: Full=30S ribosomal protein S15;
    1::88      2e-17  48%   90 aa  RS15_ARCB4 RecName: Full=30S ribosomal protein S15;
    1::89      2e-17  53%   93 aa  RS15_ANAMF RecName: Full=30S ribosomal protein S15;
    1::88      3e-17  47%   89 aa  RS15_SYNPW RecName: Full=30S ribosomal protein S15;
    1::88      3e-17  43%   89 aa  RS15_ANASP RecName: Full=30S ribosomal protein S15;
    1::89      3e-17  53%   93 aa  RS15_ANAMM RecName: Full=30S ribosomal protein S15;
    1::89      3e-17  44%   89 aa  RS15_STRSY RecName: Full=30S ribosomal protein S15;
    1::89      3e-17  44%   89 aa  RS15_STRS2 RecName: Full=30S ribosomal protein S15;
    1::89      3e-17  44%   89 aa  RS15_LACS1 RecName: Full=30S ribosomal protein S15;
    1::89      3e-17  44%   89 aa  RS15_BORA1 RecName: Full=30S ribosomal protein S15;
    1::89      4e-17  45%   89 aa  RS15_VIBPA RecName: Full=30S ribosomal protein S15;
    2::88      4e-17  41%   88 aa  RS15_SALRD RecName: Full=30S ribosomal protein S15;
    1::88      4e-17  44%   89 aa  RS15_NOSP7 RecName: Full=30S ribosomal protein S15;
    1::89      4e-17  45%   89 aa  RS15_NITOC RecName: Full=30S ribosomal protein S15;
    1::89      4e-17  43%   89 aa  RS15_NITEC RecName: Full=30S ribosomal protein S15;
    2::88      4e-17  47%   88 aa  RS15_MYCCT RecName: Full=30S ribosomal protein S15;
    1::89      4e-17  43%   89 aa  RS15_LACF3 RecName: Full=30S ribosomal protein S15;
    2::88      6e-17  44%   88 aa  RS15_BORT9 RecName: Full=30S ribosomal protein S15;
    1::89      8e-17  43%   89 aa  RS15_RALPJ RecName: Full=30S ribosomal protein S15;
    1::89      8e-17  47%   89 aa  RS15_PARUW RecName: Full=30S ribosomal protein S15;
    1::88      8e-17  42%   91 aa  RS15_NAUPA RecName: Full=30S ribosomal protein S15;
    1::89      8e-17  42%   89 aa  RS15_CHRVO RecName: Full=30S ribosomal protein S15;
    2::88      8e-17  45%   88 aa  RS15_BORGA RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  45%   89 aa  RS15_RALEH RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  45%   89 aa  RS15_CUPTR RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  43%   89 aa  RS15_CORK4 RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  43%   89 aa  RS15_BORPE RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  43%   89 aa  RS15_BORPD RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  43%   89 aa  RS15_BORPA RecName: Full=30S ribosomal protein S15;
    1::89      1e-16  43%   89 aa  RS15_BORBR RecName: Full=30S ribosomal protein S15;
    1::89      2e-16  44%   89 aa  RS15_VIBVY RecName: Full=30S ribosomal protein S15;
    1::89      2e-16  44%   89 aa  RS15_VIBVU RecName: Full=30S ribosomal protein S15;
    1::88      2e-16  43%   89 aa  RS15_SYNPX RecName: Full=30S ribosomal protein S15;
    1::88      2e-16  44%   91 aa  RS15_SULDN RecName: Full=30S ribosomal protein S15;
    1::89      2e-16  43%   89 aa  RS15_PELLD RecName: Full=30S ribosomal protein S15;
    1::89      2e-16  44%   89 aa  RS15_MYCA9 RecName: Full=30S ribosomal protein S15;
    1::89      2e-16  43%   89 aa  RS15_CHLT3 RecName: Full=30S ribosomal protein S15;
    1::88      3e-16  43%   89 aa  RS15_SYNS9 RecName: Full=30S ribosomal protein S15;
    5::88      3e-16  46%   88 aa  RS15_RUBXD RecName: Full=30S ribosomal protein S15;
    2::87      3e-16  47%   88 aa  RS15_HALOH RecName: Full=30S ribosomal protein S15;
    1::89      3e-16  43%   89 aa  RS15_ELUMP RecName: Full=30S ribosomal protein S15;
   16::84      3e-16  51%   84 aa  RS15_AKKM8 RecName: Full=30S ribosomal protein S15;
    1::89      4e-16  44%   89 aa  RS15_RALEJ RecName: Full=30S ribosomal protein S15;
    1::88      4e-16  44%   90 aa  RS15_MYCPE RecName: Full=30S ribosomal protein S15;
    2::88      4e-16  44%   88 aa  RS15_BORBZ RecName: Full=30S ribosomal protein S15;
    2::88      4e-16  44%   88 aa  RS15_BORBU RecName: Full=30S ribosomal protein S15;
    1::89      5e-16  42%   89 aa  RS15_SALTO RecName: Full=30S ribosomal protein S15;
    1::89      5e-16  44%   89 aa  RS15_OENOB RecName: Full=30S ribosomal protein S15;
    1::90      6e-16  50%   90 aa  RS15_WOLTR RecName: Full=30S ribosomal protein S15;
    1::88      6e-16  45%   89 aa  RS15_PROMT RecName: Full=30S ribosomal protein S15;
    2::88      6e-16  46%   88 aa  RS15_MYCMS RecName: Full=30S ribosomal protein S15;
    2::88      6e-16  43%   88 aa  RS15_LEPIN RecName: Full=30S ribosomal protein S15;
    2::88      6e-16  43%   88 aa  RS15_LEPIC RecName: Full=30S ribosomal protein S15;
    1::89      8e-16  45%   89 aa  RS15_RHOBA RecName: Full=30S ribosomal protein S15;
    1::88      8e-16  41%   89 aa  RS15_PROM4 RecName: Full=30S ribosomal protein S15;
    1::88      8e-16  45%   89 aa  RS15_PROM1 RecName: Full=30S ribosomal protein S15;
   23::90      8e-16  53%   91 aa  RS15_PETMO RecName: Full=30S ribosomal protein S15;
    1::89      8e-16  44%   89 aa  RS15_CHLAB RecName: Full=30S ribosomal protein S15;
    1::88      1e-15  43%   89 aa  RS15_SYNSC RecName: Full=30S ribosomal protein S15;
    1::88      1e-15  41%   91 aa  RS15_SYNJA RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  40%   89 aa  RS15_SALAI RecName: Full=30S ribosomal protein S15;
    1::88      1e-15  43%   89 aa  RS15_PROMP RecName: Full=30S ribosomal protein S15;
    1::88      1e-15  41%   89 aa  RS15_PROM5 RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLTR RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLTB RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLTA RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLT2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLPN RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLMU RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLFF RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  44%   89 aa  RS15_CHLCV RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  43%   89 aa  RS15_PROVI RecName: Full=30S ribosomal protein S15;
    1::88      1e-15  41%   90 aa  RS15_CAMHC RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  40%   89 aa  RS15_BACFR RecName: Full=30S ribosomal protein S15;
    1::89      1e-15  40%   89 aa  RS15_BACFN RecName: Full=30S ribosomal protein S15;
    1::89      2e-15  44%   89 aa  RS15_THEFY RecName: Full=30S ribosomal protein S15;
    1::88      2e-15  41%   91 aa  RS15_SYNJB RecName: Full=30S ribosomal protein S15;
    1::88      2e-15  43%   89 aa  RS15_PROM9 RecName: Full=30S ribosomal protein S15;
    1::88      2e-15  43%   91 aa  RS15_LEGPA RecName: Full=30S ribosomal protein S15;
    1::89      2e-15  39%   89 aa  RS15_HAES2 RecName: Full=30S ribosomal protein S15;
    1::89      2e-15  39%   89 aa  RS15_HAES1 RecName: Full=30S ribosomal protein S15;
    1::89      2e-15  42%   89 aa  RS15_RHOOB RecName: Full=30S ribosomal protein S15;
    1::88      2e-15  43%   89 aa  RS15_PROM2 RecName: Full=30S ribosomal protein S15;
    2::88      2e-15  43%   88 aa  RS15_MYCFL RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  40%   89 aa  RS15_PORGI RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  40%   89 aa  RS15_PORG3 RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  37%   89 aa  RS15_MYCTU RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  37%   89 aa  RS15_MYCTA RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  37%   89 aa  RS15_MYCBT RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  37%   89 aa  RS15_MYCBP RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  37%   89 aa  RS15_MYCBO RecName: Full=30S ribosomal protein S15;
    1::89      3e-15  43%   89 aa  RS15_DESAH RecName: Full=30S ribosomal protein S15;
    3::83      3e-15  42%   88 aa  RR15_CHLAT RecName: Full=30S ribosomal protein S15,
    1::90      4e-15  46%   90 aa  RS15_WOLWR RecName: Full=30S ribosomal protein S15;
    1::86      4e-15  47%   86 aa  RS15_UNCTG RecName: Full=30S ribosomal protein S15;
    1::89      4e-15  42%   89 aa  RS15_KINRD RecName: Full=30S ribosomal protein S15;
    1::89      4e-15  45%   89 aa  RS15_DESPS RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  41%   89 aa  RS15_UREU1 RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  41%   89 aa  RS15_UREPA RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  41%   89 aa  RS15_UREP2 RecName: Full=30S ribosomal protein S15;
    4::86      5e-15  46%   87 aa  RS15_THELT RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  42%   89 aa  RS15_PROM0 RecName: Full=30S ribosomal protein S15;
    2::88      5e-15  40%   88 aa  RS15_MYCMO RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  42%   91 aa  RS15_LEGPL RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  42%   91 aa  RS15_LEGPH RecName: Full=30S ribosomal protein S15;
    1::88      5e-15  42%   91 aa  RS15_LEGPC RecName: Full=30S ribosomal protein S15;
    1::89      5e-15  39%   89 aa  RS15_BACV8 RecName: Full=30S ribosomal protein S15;
    1::89      5e-15  42%   89 aa  RS15_AZOPC RecName: Full=30S ribosomal protein S15;
    1::89      7e-15  45%   91 aa  RS15_RICBR RecName: Full=30S ribosomal protein S15;
    1::89      7e-15  45%   91 aa  RS15_RICB8 RecName: Full=30S ribosomal protein S15;
    1::88      7e-15  42%   89 aa  RS15_PROMS RecName: Full=30S ribosomal protein S15;
    1::89      7e-15  37%   89 aa  RS15_MYCUA RecName: Full=30S ribosomal protein S15;
    1::89      7e-15  37%   89 aa  RS15_MYCMM RecName: Full=30S ribosomal protein S15;
    1::88      7e-15  42%   88 aa  RS15_FLAJ1 RecName: Full=30S ribosomal protein S15;
    4::85      7e-15  48%   91 aa  RS15_DEIRA RecName: Full=30S ribosomal protein S15;
    1::90      9e-15  45%   90 aa  RS15_WOLPM RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  40%   89 aa  RS15_RHOSR RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  42%   89 aa  RS15_RHOE4 RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  40%   89 aa  RS15_PHOPR RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  45%   89 aa  RS15_ORITB RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  40%   89 aa  RS15_MYCVP RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  40%   89 aa  RS15_MYCS2 RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  37%   89 aa  RS15_MYCLE RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  37%   89 aa  RS15_MYCLB RecName: Full=30S ribosomal protein S15;
    2::88      9e-15  40%   88 aa  RS15_MYCAP RecName: Full=30S ribosomal protein S15;
    1::89      9e-15  42%   89 aa  RS15_BUCBP RecName: Full=30S ribosomal protein S15;
    1::74      9e-15  47%   74 aa  RS15_AYWBP RecName: Full=30S ribosomal protein S15;
   16::83      9e-15  46%   87 aa  RR15_ZYGCR RecName: Full=30S ribosomal protein S15,
    1::89      1e-14  39%   89 aa  RS15_BACTN RecName: Full=30S ribosomal protein S15;
    8::89      2e-14  44%   89 aa  RS15_RALME RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  37%   89 aa  RS15_PSEFS RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  45%   89 aa  RS15_ORITI RecName: Full=30S ribosomal protein S15;
    1::74      2e-14  47%   74 aa  RS15_ONYPE RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  38%   89 aa  RS15_HAEDU RecName: Full=30S ribosomal protein S15;
    1::88      2e-14  41%   89 aa  RR15_PAUCH RecName: Full=30S ribosomal protein S15, organellar
    7::91      2e-14  40%   91 aa  RS15_NOCSJ RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  39%   89 aa  RS15_MYCSS RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  39%   89 aa  RS15_MYCSK RecName: Full=30S ribosomal protein S15;
    1::89      2e-14  39%   89 aa  RS15_MYCSJ RecName: Full=30S ribosomal protein S15;
    1::89      3e-14  38%   89 aa  RS15_MANSM RecName: Full=30S ribosomal protein S15;
    1::88      3e-14  41%   88 aa  RS15_FLAPJ RecName: Full=30S ribosomal protein S15;
    1::89      3e-14  39%   89 aa  RS15_ACIC1 RecName: Full=30S ribosomal protein S15;
    1::90      4e-14  44%   90 aa  RS15_WOLPP RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  39%   89 aa  RS15_MYCPA RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  39%   89 aa  RS15_MYCGI RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  39%   89 aa  RS15_MYCA1 RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  42%   89 aa  RS15_LEIXX RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%   89 aa  RS15_HAEPS RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%  113 aa  RS15_HAEIE RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%   89 aa  RS15_HAEI8 RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  37%   89 aa  RS15_CHLSY RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  37%   89 aa  RS15_CHLAA RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  37%   89 aa  RS15_ACTSZ RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%   89 aa  RS15_ACTPJ RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%   89 aa  RS15_ACTP7 RecName: Full=30S ribosomal protein S15;
    1::89      4e-14  38%   89 aa  RS15_ACTP2 RecName: Full=30S ribosomal protein S15;
    1::89      5e-14  43%   91 aa  RS15_RICRS RecName: Full=30S ribosomal protein S15;
    1::89      5e-14  43%   91 aa  RS15_RICRO RecName: Full=30S ribosomal protein S15;
    1::89      5e-14  43%   91 aa  RS15_RICM5 RecName: Full=30S ribosomal protein S15;
    1::89      5e-14  43%   91 aa  RS15_RICCN RecName: Full=30S ribosomal protein S15;
    1::89      5e-14  43%   91 aa  RS15_RICAE RecName: Full=30S ribosomal protein S15;
    2::88      5e-14  40%   88 aa  RS15_PSYWF RecName: Full=30S ribosomal protein S15;
    1::89      6e-14  43%   91 aa  RS15_RICPU RecName: Full=30S ribosomal protein S15;
   14::82      6e-14  48%   82 aa  RS15_PELUB RecName: Full=30S ribosomal protein S15;
    1::91      6e-14  42%   91 aa  RS15_AMOA5 RecName: Full=30S ribosomal protein S15;
    1::89      8e-14  43%   91 aa  RS15_RICPR RecName: Full=30S ribosomal protein S15;
    1::89      8e-14  43%   91 aa  RS15_RICCK RecName: Full=30S ribosomal protein S15;
    1::89      8e-14  39%   89 aa  RS15_PARD8 RecName: Full=30S ribosomal protein S15;
    1::89      1e-13  43%   91 aa  RS15_RICTY RecName: Full=30S ribosomal protein S15;
    1::89      1e-13  37%   89 aa  RS15_HAEIN RecName: Full=30S ribosomal protein S15;
    1::89      1e-13  37%   89 aa  RS15_HAEIG RecName: Full=30S ribosomal protein S15;
    1::89      1e-13  38%   89 aa  RS15_FRAAA RecName: Full=30S ribosomal protein S15;
    1::89      1e-13  38%   89 aa  RS15_FRASC RecName: Full=30S ribosomal protein S15;
    1::89      2e-13  43%   91 aa  RS15_RICAH RecName: Full=30S ribosomal protein S15;
    1::89      2e-13  38%   89 aa  RS15_FRASN RecName: Full=30S ribosomal protein S15;
   26::88      2e-13  49%   89 aa  RS15_WIGBR RecName: Full=30S ribosomal protein S15;
    2::88      2e-13  39%   88 aa  RS15_PSYCK RecName: Full=30S ribosomal protein S15;
    1::89      3e-13  43%   91 aa  RS15_RICFE RecName: Full=30S ribosomal protein S15;
    2::88      3e-13  38%   88 aa  RS15_MYCS5 RecName: Full=30S ribosomal protein S15;
    1::89      3e-13  37%   89 aa  RS15_CORA7 RecName: Full=30S ribosomal protein S15;
   15::85      3e-13  45%   90 aa  RR15_SOYBN RecName: Full=30S ribosomal protein S15,
    1::89      4e-13  36%   89 aa  RS15_PASMU RecName: Full=30S ribosomal protein S15;
   16::84      4e-13  48%   84 aa  RS15_FERNB RecName: Full=30S ribosomal protein S15;
    1::88      7e-13  39%   90 aa  RS15_MYCGA RecName: Full=30S ribosomal protein S15;
    6::88      7e-13  41%   88 aa  RS15_ACIC5 RecName: Full=30S ribosomal protein S15;
    1::89      1e-12  35%   89 aa  RS15_CHLAD RecName: Full=30S ribosomal protein S15;
    1::88      1e-12  41%   89 aa  RS15_BLOPB RecName: Full=30S ribosomal protein S15;
    2::78      1e-12  42%   81 aa  RS15_MYCHR RecName: Full=30S ribosomal protein S15;Flags:
    2::88      1e-12  38%   88 aa  RS15_MYCHJ RecName: Full=30S ribosomal protein S15;
    2::88      1e-12  38%   88 aa  RS15_MYCH7 RecName: Full=30S ribosomal protein S15;
    2::88      1e-12  38%   88 aa  RS15_MYCH2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-12  36%   89 aa  RS15_MICLC RecName: Full=30S ribosomal protein S15;
    1::89      1e-12  37%   89 aa  RS15_CLAMS RecName: Full=30S ribosomal protein S15;
    1::89      1e-12  37%   89 aa  RS15_CLAM3 RecName: Full=30S ribosomal protein S15;
    3::83      1e-12  42%   88 aa  RR15_LEPVR RecName: Full=30S ribosomal protein S15,
   10::87      3e-12  41%   92 aa  RR15_LACSA RecName: Full=30S ribosomal protein S15,
   15::85      3e-12  45%   90 aa  RR15_CITSI RecName: Full=30S ribosomal protein S15,
    1::89      3e-12  40%   89 aa  RS15_LACH4 RecName: Full=30S ribosomal protein S15;
   15::85      3e-12  42%   90 aa  RR15_PELHO RecName: Full=30S ribosomal protein S15,
   15::85      3e-12  42%   90 aa  RR15_MANES RecName: Full=30S ribosomal protein S15,
   20::85      3e-12  45%   90 aa  RR15_IPOPU RecName: Full=30S ribosomal protein S15,
    6::83      3e-12  42%   88 aa  RR15_ARATH RecName: Full=30S ribosomal protein S15,
    3::84      3e-12  41%   88 aa  RR15_AETCO RecName: Full=30S ribosomal protein S15,
   21::88      4e-12  44%   89 aa  RS15_BUCCC RecName: Full=30S ribosomal protein S15;
   10::82      4e-12  44%   86 aa  RR15_PSINU RecName: Full=30S ribosomal protein S15,
    3::83      4e-12  41%   88 aa  RR15_DRANE RecName: Full=30S ribosomal protein S15,
    2::88      6e-12  34%   88 aa  RS15_MYCA5 RecName: Full=30S ribosomal protein S15;
    1::89      6e-12  38%   89 aa  RS15_GLOVI RecName: Full=30S ribosomal protein S15;
   14::85      6e-12  42%   90 aa  RR15_POPTR RecName: Full=30S ribosomal protein S15,
   14::85      6e-12  42%   90 aa  RR15_POPAL RecName: Full=30S ribosomal protein S15,
   17::82      6e-12  45%   87 aa  RR15_OENAR RecName: Full=30S ribosomal protein S15,
    3::83      6e-12  41%   88 aa  RR15_LOBMA RecName: Full=30S ribosomal protein S15,
    3::83      6e-12  40%   92 aa  RR15_CARPA RecName: Full=30S ribosomal protein S15,
    3::83      6e-12  41%   88 aa  RR15_ARAHI RecName: Full=30S ribosomal protein S15,
   13::83      6e-12  45%   88 aa  RR15_AETGR RecName: Full=30S ribosomal protein S15,
    9::90      7e-12  38%   90 aa  RS15_TROWT RecName: Full=30S ribosomal protein S15;
    9::90      7e-12  38%   90 aa  RS15_TROW8 RecName: Full=30S ribosomal protein S15;
    1::89      7e-12  36%   89 aa  RS15_IDILO RecName: Full=30S ribosomal protein S15;
    1::89      7e-12  37%   89 aa  RS15_CYAP7 RecName: Full=30S ribosomal protein S15;
    3::83      7e-12  41%   88 aa  RR15_OLIPU RecName: Full=30S ribosomal protein S15,
    3::83      7e-12  41%   88 aa  RR15_NASOF RecName: Full=30S ribosomal protein S15,
    3::83      7e-12  41%   88 aa  RR15_CRUWA RecName: Full=30S ribosomal protein S15,
    3::83      7e-12  41%   88 aa  RR15_BARVE RecName: Full=30S ribosomal protein S15,
    1::89      1e-11  33%   89 aa  RS15_SACEN RecName: Full=30S ribosomal protein S15;
    1::89      1e-11  36%   89 aa  RS15_LACSS RecName: Full=30S ribosomal protein S15;
   15::85      1e-11  44%   90 aa  RR15_LOTJA RecName: Full=30S ribosomal protein S15,
    9::86      1e-11  41%   91 aa  RR15_EUCGG RecName: Full=30S ribosomal protein S15,
    3::83      1e-11  41%   88 aa  RR15_CAPBU RecName: Full=30S ribosomal protein S15,
   20::85      1e-11  45%   90 aa  RR15_PANGI RecName: Full=30S ribosomal protein S15,
   15::85      1e-11  42%   90 aa  RR15_CUCSA RecName: Full=30S ribosomal protein S15,
   22::87      2e-11  45%   92 aa  RR15_GUIAB RecName: Full=30S ribosomal protein S15,
   17::83      2e-11  43%   88 aa  RR15_ANGEV RecName: Full=30S ribosomal protein S15,
   19::85      2e-11  45%   89 aa  RR15_ANEMR RecName: Full=30S ribosomal protein S15, plastid;
    1::89      2e-11  34%   89 aa  RS15_ROSCS RecName: Full=30S ribosomal protein S15;
    1::89      2e-11  34%   89 aa  RS15_CORGL RecName: Full=30S ribosomal protein S15;
    1::89      2e-11  34%   89 aa  RS15_CORGB RecName: Full=30S ribosomal protein S15;
   11::83      2e-11  41%   88 aa  RR15_VITVI RecName: Full=30S ribosomal protein S15,
   15::85      2e-11  42%   90 aa  RR15_PLAOC RecName: Full=30S ribosomal protein S15,
   18::83      2e-11  44%   88 aa  RR15_PINTH RecName: Full=30S ribosomal protein S15,
   18::84      2e-11  43%   88 aa  RR15_PINKO RecName: Full=30S ribosomal protein S15,
   15::86      2e-11  40%   90 aa  RR15_PHAVU RecName: Full=30S ribosomal protein S15,
    9::85      2e-11  42%   91 aa  RR15_CUSEX RecName: Full=30S ribosomal protein S15, plastid;
   18::83      2e-11  47%   86 aa  RR15_CRYJA RecName: Full=30S ribosomal protein S15,
   17::82      3e-11  44%   87 aa  RR15_OENPA RecName: Full=30S ribosomal protein S15,
   17::82      3e-11  44%   87 aa  RR15_OENGL RecName: Full=30S ribosomal protein S15,
   17::82      3e-11  44%   87 aa  RR15_OENEH RecName: Full=30S ribosomal protein S15,
   17::82      3e-11  44%   87 aa  RR15_OENBI RecName: Full=30S ribosomal protein S15,
   20::85      3e-11  45%   90 aa  RR15_DAUCA RecName: Full=30S ribosomal protein S15,
   21::86      3e-11  42%   91 aa  RR15_CICAR RecName: Full=30S ribosomal protein S15,
   20::88      4e-11  39%   88 aa  RS15_MYCPU RecName: Full=30S ribosomal protein S15;
   15::85      4e-11  41%   90 aa  RR15_NANDO RecName: Full=30S ribosomal protein S15,
   15::85      4e-11  42%   90 aa  RR15_LIRTU RecName: Full=30S ribosomal protein S15,
   15::85      4e-11  44%   90 aa  RR15_DRIGR RecName: Full=30S ribosomal protein S15,
   15::85      5e-11  41%   90 aa  RR15_PIPCE RecName: Full=30S ribosomal protein S15,
   17::82      5e-11  42%   87 aa  RR15_ILLOL RecName: Full=30S ribosomal protein S15,
   22::87      5e-11  44%   92 aa  RR15_HELAN RecName: Full=30S ribosomal protein S15,
   17::82      6e-11  44%   87 aa  RR15_TOBAC RecName: Full=30S ribosomal protein S15,
   17::82      6e-11  44%   87 aa  RR15_SOLLC RecName: Full=30S ribosomal protein S15,
   17::82      6e-11  44%   87 aa  RR15_NICTO RecName: Full=30S ribosomal protein S15,
   17::82      6e-11  44%   87 aa  RR15_NICSY RecName: Full=30S ribosomal protein S15,
   17::82      8e-11  44%   87 aa  RR15_SOLTU RecName: Full=30S ribosomal protein S15,
   17::82      8e-11  44%   87 aa  RR15_SOLBU RecName: Full=30S ribosomal protein S15,
   15::85      8e-11  39%   90 aa  RR15_GOSHI RecName: Full=30S ribosomal protein S15,
   15::85      8e-11  39%   90 aa  RR15_GOSBA RecName: Full=30S ribosomal protein S15,
   15::85      8e-11  42%   90 aa  RR15_DIOEL RecName: Full=30S ribosomal protein S15,
   17::82      8e-11  44%   87 aa  RR15_ATRBE RecName: Full=30S ribosomal protein S15,
    7::87      1e-10  36%   90 aa  RS15_HERA2 RecName: Full=30S ribosomal protein S15;
    1::89      1e-10  35%   89 aa  RS15_CORU7 RecName: Full=30S ribosomal protein S15;
    1::49      1e-10  53%   90 aa  RS15_CAMFF RecName: Full=30S ribosomal protein S15;
   15::85      1e-10  44%   90 aa  RR15_SPIOL RecName: Full=30S ribosomal protein S15,
   14::79      1e-10  44%   83 aa  RR15_FAGEA RecName: Full=30S ribosomal protein S15,
    9::86      1e-10  41%   91 aa  RR15_CERDE RecName: Full=30S ribosomal protein S15,
    1::89      1e-10  33%   89 aa  RS15_COREF RecName: Full=30S ribosomal protein S15;
    7::86      2e-10  39%   86 aa  RS15_VESOH RecName: Full=30S ribosomal protein S15;
    1::62      2e-10  48%   90 aa  RS15_BLOFL RecName: Full=30S ribosomal protein S15;
    9::85      2e-10  43%   90 aa  RR15_CUSRE RecName: Full=30S ribosomal protein S15, plastid;
   15::85      2e-10  41%   90 aa  RR15_ACOCL RecName: Full=30S ribosomal protein S15,
    1::89      2e-10  33%   89 aa  RS15_CORJK RecName: Full=30S ribosomal protein S15;
   16::86      2e-10  39%   91 aa  RR15_PHAAO RecName: Full=30S ribosomal protein S15,
   16::83      2e-10  43%   88 aa  RR15_MARPO RecName: Full=30S ribosomal protein S15,
   15::79      2e-10  43%   90 aa  RR15_BUXMI RecName: Full=30S ribosomal protein S15,
    1::89      3e-10  36%   89 aa  RS15_BUCAT RecName: Full=30S ribosomal protein S15;
    1::89      3e-10  36%   89 aa  RS15_BUCAI RecName: Full=30S ribosomal protein S15;
    1::89      3e-10  36%   89 aa  RS15_BUCA5 RecName: Full=30S ribosomal protein S15;
   15::85      3e-10  38%   90 aa  RR15_MORIN RecName: Full=30S ribosomal protein S15,
   17::82      3e-10  44%   87 aa  RR15_COFAR RecName: Full=30S ribosomal protein S15,
  169::233     4e-10  42%  286 aa  RT28_YEAST RecName: Full=37S ribosomal protein S28,
   18::85      4e-10  43%   86 aa  RS15_MYCPN RecName: Full=30S ribosomal protein S15;
   18::83      4e-10  41%   88 aa  RR15_CALFG RecName: Full=30S ribosomal protein S15,
  192::268     5e-10  36%  288 aa  RT28_SCHPO RecName: Full=Probable 40S ribosomal protein S28,
    1::89      7e-10  36%   89 aa  RS15_BUCAP RecName: Full=30S ribosomal protein S15;
   17::82      7e-10  41%   87 aa  RR15_NYMAL RecName: Full=30S ribosomal protein S15,
    1::88      1e-09  35%   89 aa  RS15_THEEB RecName: Full=30S ribosomal protein S15;
   22::87      1e-09  42%   92 aa  RR15_LEMMI RecName: Full=30S ribosomal protein S15,
    9::80      2e-09  40%  109 aa  RR15_TRACE RecName: Full=30S ribosomal protein S15,
    1::89      2e-09  31%   89 aa  RS15_ROSS1 RecName: Full=30S ribosomal protein S15;
    4::85      2e-09  37%   91 aa  RS15_DEIGD RecName: Full=30S ribosomal protein S15;
   17::82      2e-09  41%   89 aa  RR15_CHLSC RecName: Full=30S ribosomal protein S15,
    1::52      3e-09  50%   89 aa  RS15_TREPS RecName: Full=30S ribosomal protein S15;
    1::52      3e-09  50%   89 aa  RS15_TREPA RecName: Full=30S ribosomal protein S15;
    1::89      3e-09  33%   89 aa  RS15_CORDI RecName: Full=30S ribosomal protein S15;
    9::88      3e-09  40%   93 aa  RR15_JASNU RecName: Full=30S ribosomal protein S15,
   22::82      3e-09  39%   87 aa  RR15_AMBTC RecName: Full=30S ribosomal protein S15,
    2::88      4e-09  33%   88 aa  RS15_LEPBL RecName: Full=30S ribosomal protein S15;
    2::88      4e-09  33%   88 aa  RS15_LEPBJ RecName: Full=30S ribosomal protein S15;
    7::88      8e-09  30%   88 aa  RS15_METI4 RecName: Full=30S ribosomal protein S15;
   12::79      8e-09  38%   86 aa  RR15_CUSOB RecName: Full=30S ribosomal protein S15, plastid;
    3::83      2e-08  33%   90 aa  RR15_MESVI RecName: Full=30S ribosomal protein S15,
    3::86      1e-07  36%   86 aa  RS15_NEOSM RecName: Full=30S ribosomal protein S15;
    5::85      4e-07  31%   86 aa  RS15_MYCGE RecName: Full=30S ribosomal protein S15;
   17::84      4e-07  34%   88 aa  RR15_PHYPA RecName: Full=30S ribosomal protein S15,
    4::87      7e-07  29%   87 aa  RS15_DEHSC RecName: Full=30S ribosomal protein S15;
    4::87      7e-07  29%   87 aa  RS15_DEHSB RecName: Full=30S ribosomal protein S15;
    4::87      7e-07  29%   87 aa  RS15_DEHE1 RecName: Full=30S ribosomal protein S15;
   90::130     3e-06  46%  161 aa  RS15_HYPBU RecName: Full=30S ribosomal protein S15P/S13e;
   39::106     5e-06  31%  111 aa  RR15_STAPU RecName: Full=30S ribosomal protein S15, chloroplastic;
   81::131     6e-06  43%  151 aa  RS15_PYRKO RecName: Full=30S ribosomal protein S15P/S13e;
   88::139     6e-06  44%  158 aa  RS15_PYRAB RecName: Full=30S ribosomal protein S15P/S13e;
   88::139     8e-06  44%  158 aa  RS15_PYRHO RecName: Full=30S ribosomal protein S15P/S13e;
   88::139     8e-06  44%  158 aa  RS15_PYRFU RecName: Full=30S ribosomal protein S15P/S13e;
   91::132     1e-05  48%  153 aa  RS15_METJA RecName: Full=30S ribosomal protein S15P/S13e;
   18::88      1e-05  32%   90 aa  RR15_LOLPR RecName: Full=30S ribosomal protein S15,
   18::88      1e-05  32%   90 aa  RR15_AGRST RecName: Full=30S ribosomal protein S15,
   89::129     1e-05  44%  159 aa  RS15_IGNH4 RecName: Full=30S ribosomal protein S15P/S13e;
   88::130     3e-05  40%  150 aa  RS15_AERPE RecName: Full=30S ribosomal protein S15P/S13e;
    6::76      4e-05  31%   78 aa  RR15_SORBI RecName: Full=30S ribosomal protein S15,
    6::76      4e-05  31%   78 aa  RR15_SACOF RecName: Full=30S ribosomal protein S15,
    6::76      4e-05  31%   78 aa  RR15_SACHY RecName: Full=30S ribosomal protein S15,
   18::88      4e-05  31%   90 aa  RR15_MAIZE RecName: Full=30S ribosomal protein S15,
   18::88      5e-05  31%   90 aa  RR15_ORYSJ RecName: Full=30S ribosomal protein S15,
   18::88      5e-05  31%   90 aa  RR15_ORYSI RecName: Full=30S ribosomal protein S15,
   18::88      5e-05  31%   90 aa  RR15_ORYSA RecName: Full=30S ribosomal protein S15,
   18::88      5e-05  31%   90 aa  RR15_ORYNI RecName: Full=30S ribosomal protein S15,
   21::61      7e-05  46%   78 aa  RS15_SULMW RecName: Full=30S ribosomal protein S15;
   47::115     7e-05  30%  133 aa  RS15_METST RecName: Full=30S ribosomal protein S15P/S13e;
   91::131     9e-05  41%  154 aa  RS15_STAMF RecName: Full=30S ribosomal protein S15P/S13e;
   66::131     2e-04  33%  150 aa  RS15_CALMQ RecName: Full=30S ribosomal protein S15P/S13e;
  135::174     3e-04  42%  263 aa  RT15_DANRE RecName: Full=28S ribosomal protein S15, mitochondrial; 
   47::109     4e-04  33%  132 aa  RS15_METS3 RecName: Full=30S ribosomal protein S15P/S13e;
   81::132     4e-04  38%  149 aa  RS15_METKA RecName: Full=30S ribosomal protein S15P/S13e;
   89::130     6e-04  36%  148 aa  RS15_THEPD RecName: Full=30S ribosomal protein S15P/S13e;
   74::111     6e-04  45%  134 aa  RS15_METTH RecName: Full=30S ribosomal protein S15P/S13e;
   91::130     7e-04  40%  151 aa  RS15_META3 RecName: Full=30S ribosomal protein S15P/S13e;
   19::83      0.001  29%   88 aa  RR15_CYCTA RecName: Full=30S ribosomal protein S15,
    1::89

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
RS15_RHOPS      MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
RS15_RHOP2      MSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIANLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
RS15_RHOPT      MSITAERKAEVIKTSATKAGDTGSPEVQVAILSERITNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYI
RS15_RHOPA      MSITAERKAEVIKTSATKAGDTGSPEVQVAILSERITNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYI
RS15_RHOPB      MSITAERKAEVIKTNAKKAGDTGSPEVQVAILSERIANLTSHFKTHVKDNHSRRGLLKLVSTRRSLLDYV
RS15_OLICO      MSITAERKAEVIKTNAKKAGDTGSPEVQVAILSERIANLTEHFKTHSKDNHSRRGLLKLVSTRRSLLDYV
RS15_RHOP5      MSIAAERKAEVIKTNARKDGDTGSPEVQVAILSERIANLTAHFKTHVKDNHSRRGLLKLVSTRRSLLDYV
RS15_NITHX      MSITAERKAEVIKTNARKSGDTGSPEVQVAILSERIVNLTNHFKSHGKDNHSRRGLLKLVSTRRSLLDYV
RS15_NITWN      MSIAAERKAEVIKTSANKPGDTGSPEVQVAILSERIANLTAHFKIHTKDNHSRRGLLKLVSTRRSLLDYV
RS15_BRASO      MSITAERKAEIIKANATKAGDTGSPEVQVAILSERINNLTGHFKTHGKDNHSRRGLLKLVSTRRSLLDYL
RS15_BRASB      MSVTAERKAEIIKANATKAGDTGSPEVQVAILSERINNLTSHFKTHGKDNHSRRGLLKLVSTRRSLLDYL
RS15_BRAJA      MSIAAERKAEVIKTNATKAGDTGSPEVQVAILSERINNLTSHFKTHVKDNHSRRGLLKLVSTRRSLLDYL
RS15_METNO      MSITAERKTALIKEYARGGADTGSPEVQIAILTERIANLTGHFKTHTKDNHSRRGLLKLVSQRRSLLDYL
RS15_METRJ      MSITAERKTALIKEHRKDAKDTGSPEVQVAILTERITNLTGHFKTHGKDNHSRRGLLKLVSQRRSLLDYV
RS15_XANP2      MSITAERKQALIKDFGAKDGDTGSPEVQVAILTERITNLTGHFKSHHKDNHSRRGLLKLVSQRRSLLDYL
RS15_METSB      MSITPERKQTLVKEYAQKSGDTGSPEVQVAILTERIVNLTEHFKTHVKDNHSRRGLLKMVSQRRQLLDYV
RS15_METS4      MSITAERKTALIKDYARGGTDTGSPEVQVAILTERIANLTGHFKTHTKDNHSRRGLLKLVSQRRSLLDYL
RS15_PARL1      MSITPERKAQLIKEFAGKDGDTGSPEVQVAILTERIVNLTEHFRGHAKDNHSRRGLLKMVSQRRSLLDYV
RS15_BEII9      MSITPERKTALVKEYALKDGDTGSPEVQVAILTERIANLTEHFKTHVKDNHSRRGLLKLVSQRRQLLDYV
RS15_SPHAL      MSITAERKAEVIKDNARDKGDTGSPEVQVAILTDRINTLTEHFKTHRKDNHSRRGLLMMVNKRRSLLDYL
RS15_METEP      MSITAERKTALIKDYAKGNKDTGSPEVQIAILTERITNLTAHFKTHGKDNHSRRGLLKLVSQRRSLLDYL
RS15_METC4      MSITAERKTALIKDYAKGNKDTGSPEVQIAILTERITNLTAHFKTHGKDNHSRRGLLKLVSQRRSLLDYL
RS15_METPB      MSITAERKTALIKEYAKGNKDTGSPEVQIAILTERITNLTAHFKTHGKDNHSRRGLLKLVSQRRSLLDYL
RS15_AZOC5      MSITPERKQALISEYGAKAGDTGSPEVQVAILSERISNLTEHFKSHNKDNHSRRGLLKLVSQRRSLLDYL
RS15_MESSB      MSITAERKQELLKEFATANADTGSPEVQVALLTERIKNLTEHFKEHQKDNHSRRGLLKLVSQRRRLLDYV
RS15_PHEZH      MSITAERKAELIKTHARGEADTGSAEVQVAILSERISNLTEHFKTHKKDNHSRRGLLKLVSQRRSLLDHL
RS15_BARBK      MSITAERKQELITEYATKAGDTGSPEVQVAVLSERISNLTNHFKSHKKDNHSRRGLLKMVSQRRRLLDYL
RS15_CAUCR      MSITLERKAALIAEHARSTGDTGSAEVQVAILSERIANLTEHFKTHKKDNHSRRGLLKLVSQRRRLLDHL
RS15_CAUCN      MSITLERKAALIAEHARSTGDTGSAEVQVAILSERIANLTEHFKTHKKDNHSRRGLLKLVSQRRRLLDHL
RS15_RHISN      MSITAERKAQLIKDFATVEGDTGSPEVQVALLTERINNLTEHFKDHKKDNHSRRGLLAMVSSRRSLLDYL
RS15_RHILO      MSITAERKKELMGEFATAKGDTGSPEVQVAILSERIKNLTDHFKDHKKDNHSRRGLLALVSQRRSLLDYL
RS15_RHIEC      MSITAERKAALIKEYATAEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHSRRGLLTMVSSRRSLLDYL
RS15_RHIE6      MSITAERKAALIKEYATAEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHSRRGLLTMVSSRRSLLDYL
RS15_NOVAD      MSITAEKKQEVIQSNARAEGDTGSPEVQVAILTSRIQTLTEHFKSHHKDNHSRRGLLMMVNKRRSLLDYL
RS15_ROSDO      MSITAEEKARVMKEFATKEGDTGSPEVQVAILSSRIATLTEHFKTHKKDNHGRRGLLKMVATRRKLLDYT
RS15_RHILW      MSITAERKSALIKEYATVEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHSRRGLLTMVSSRRSLLDYL
RS15_AGRRK      MSITAERKAALIKEYATVEGDTGSPEVQVAILTERINNLTDHFKDHKKDNHSRRGLLTMVSSRRSLLDYL
RS15_SILPO      MSITTEEKARVMKEYGTKDGDTGSPEVQVAILSSRIATLTEHFKTHKKDNHGRRGLLKLVAQRRKLLDYL
RS15_RHIL3      MSITAERKSALIKEYATVEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHSRRGLLTMVSSRRSLLDYL
RS15_BARQU      MSITAERKQALVAEYANKAGDTGSPEVQIAVLSERISNLTNHFKFHKKDNHSRRGLLKMVSQRRRLLDYL
RS15_BARHE      MSITAERKKAIVAEYANKVGDTGSPEVQVAVLSERIANLTNHFKFHKKDNHSRRGLLKMVSQRRRLLDYL
RS15_CAUSK      MSITAERKTALIAEHARTEGDTGSAEVQVAILSERIANLTEHFKTHKKDNHSRRGLLMMVSQRRSLLDHL
RS15_BRUSU      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUSI      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUO2      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUME      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUMB      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUC2      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUAB      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUA2      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BRUA1      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_BART1      MSITAERKQALVAEYANKVGDTGSPEVQIAVLSERISNLTNHFKSHKKDNHSRRGLLKMVSQRRRLLDYL
RS15_ZYMMO      MSITAERKEALIKEYARVEGDTGSPEVQVAILTERIVNLTEHFKTHAKDNHSRRGLLRLVNKRRSLLDYV
RS15_MARMM      MSITQERKSALIAEHARGKTDTGSPEVQVAILTTRIANLTEHFKTHKKDNHSRRGLLKMVSQRRRLLDYV
RS15_OCHA4      MSITAERKQALIKEYATKEGDTGSPEVQVAVLSERIANLTEHFKGHKNDNHSRRGLLKLVSQRRRLLDYV
RS15_RHOS5      MSITVEEKARLIKEYATKEGDTGSPEVQVAILSSRIATLTEHFKSHKKDNHSRRGLLMMVAQRRKLLDYL
RS15_PARDP      MSITVEEKNRVMTEFATKKGDTGSPEVQVAILSSRIATLTEHFKTHKKDNHSRRGLLKLVAQRRKLLDYL
RS15_DINSH      MSITAEEKARLIKEYATKEGDTGSPEVQIAILSSRIATLTEHFKSHKKDNHSRRGLLMMVAQRRKLLDYV
RS15_HYPNA      MSITAERKQELIKKFAIKEGDTGSPEVQVAILTERINNLTDHFKTNKKDNHSRRGLLTMVATRRKLLDYA
RS15_SILST      MSITAEEKTRLMKEFATKEGDTGSPEVQVAILTSRINTLTEHFKTHKKDNHGRRGLLKMVAQRRKLLDYL
RS15_GLUOX      MSITAERRTALISEYKQSETDTGSPEVQVAILSERIVNLTEHLKTHKKDFHSRRGLLMMVGQRRSLLDYL
RS15_RHORT      MSITPERKQEMIKDYATKEGDTGSPEVQVAILTERITNLTEHFKIHKKDNHSRRGLLMMVSQRRRLLDYL
RS15_GRABC      MSITAERRTALISEYARAANDTGSPEVQIALLSERIANLTEHLKTHAKDFHSRRGLLMLVGQRRGLLDYL
RS15_ERYLH      MSVDAETKTKIIKDNARDKNDTGSPEVQVAILTTRIKNLTEHFKDHHKDNHSRRGLLQMVNKRRSLLAYL
RS15_RHOCS      MSITPERKQALIEEYKTKDGDTGSPEVQVAILTERIVNLTEHLKTHAKDFHSRRGLLVMVGQRRGLLDYL
RS15_JANSC      MSITPEEKARLMKEFATKEGDTGSPEVQVAILTSRISTLTEHFKSHKKDNHSRRGLLMMVAQRRKLLDYA
RS15_GLUDA      MSITAERRTALIGEYQTAATDTGSPEVQVALLSERITNLTEHLKTHAKDFHSRRGLLVMVGKRRGLLDYL
RS15_EXIS2      MALTKERKNEIIEAYATKQGDTGSPEVQVAVLTEQITTLNDHLRTHKKDHHSRRGLLKMVGRRRNLLTYL
RS15_MYXXD      MSLHQERKSELVSKFRTHESDTGSPEVQVALLSERITMLTEHFKTHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_MAGSM      MSITAERKQELIAEYATKENDTGSPEVQVAILTERINNLTDHLRGHNKDHHSRRGLLKMVGLRRRLLSYV
RS15_GEOSM      --LVTEKKQEIVNAHKLHDSDTGSPEVQIALLSERITYLTEHFKTHKKDHHSRRGLLKIVGQRRGLLDYL
RS15_GEOBB      --LVTEKKQEIVNAHKLHDSDTGSPEVQIALLSERITYLTEHFKTHKKDHHSRRGLLKIVGQRRGLLDYL
RS15_STRMK      MSIDTQK---VIEDNKRSSADTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_STRM5      MSIDTQK---VIEDNKRSSADTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANOR      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANOP      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANOM      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANC5      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANAC      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_GEOMG      --LVTDKKQEIITSFKRHDSDTGSPEVQIAILTERIIYLTEHFKVHKKDHHSRRGLLKIVGQRRRLLDYL
RS15_XANCP      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANCB      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XANC8      ---------KVIEDNKRSAQDTGSPEVQVALLTARIELLTGHFKTHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_FRATN      --LTAQDKQKIIKENQLAEGDTGSPEVQVALLTARINDLQGHFETHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_PELPD      --LATEKKQEIIKAFKKHDSDTGSPEVQIAILTERITYLTEHFKVHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_GEOUR      --LATDKKQEIISTYKLHDSDTGSPEVQIAILTERITYLTEHFKTHKKDHHSRRGLLKIVGQRRGLLDYL
RS15_GEOSF      --LATDKKQEIIGAYKLHDSDTGSPEVQIAILTERITYLTEHFKTHKKDHHSRRGLLKIVGQRRGLLDYL
RS15_AERHH      MSLNAEIKAQIVADNARCANDTGSPEVQVALLTAQINHLQGHFKEHSKDHHGRRGLLRMVSQRRKLLDYL
RS15_FRAP2      --LTTQDKQNIIKENQQSEGDTGSPEVQVALLTARINDLQGHFATHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_GEOSL      --LVTDKKKEIITTHKLHDSDTGSPEVQIALLTERIIYLTEHFKVHKKDHHSRRGLLKIVGQRRRLLDYL
RS15_ANASK      MALVQEKKQELVQKYKRHEKDTGSPEVQVALLSERIAYLTEHFKTHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_ANADE      MALVQEKKQELVQKYKRHEKDTGSPEVQVALLSERIAYLTEHFKTHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_ANAD2      MALVQEKKQELVQKYKRHEKDTGSPEVQVALLSERIAYLTEHFKTHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_AERS4      MSLNAEIKASIVADNARCANDTGSPEVQVALLTAQINHLQGHFKEHAKDHHGRRGLLRMVSQRRKLLDYL
RS15_SYNFM      MVMTPEKKKEIIEGFKVHSADTGSPEVQIALLSERISYLTEHFKMHKKDHHSRRGLLKLVGQRRQLLNYL
RS15_MAGSA      MSITAERTQELVKEYATKEGDTGSAEVQVAILSERIRNLTEHLKSHKKDFHSRRGLLIMVGQRRRMLDYL
RS15_THEYD      MGISPERKKEIIESFKMHSSDTGSPEVQIALMTERINYLTEHFKTHKKDHHSRRGLIKLVAQRRKLLNYL
RS15_POLSQ      MAVADIKTAEIVKDNARSANDTGSPEVQVSLLTARINELTPHFKANAKDHHSRRGLLKMVSRRRRLLDYL
RS15_HALHL      MSLNAEQKSEIVEQFRRSPSDTGSPEVQIALLSARIQHLTEHFSVHKQDHHSRQGLLKLVSQRRKLLDYL
RS15_ALHEH      MSLSAEQKGEIVKKHARTASDTGSPEVQVALLTARIQHLSGHFAEHKQDHHSRQGLLKLVSQRRKLLDYL
RS15_ALCBS      MALTVEQKAEILKEHGRKENDTGSPEVQVALLSANINGLQDHFKGHKKDHHSRRGLIRMVNQRRKLLDYL
RS15_GEOKA      MALTQERKREIIEQFKIHENDTGSPEVQVAILTEQINNLNEHLRIHKKDHHSRRGLLKMVGKRRNLLAYL
RS15_TOLAT      MSLNAETKAKIVADFSRGTNDTGSPEVQVALLTAQINHLQGHFSVHSKDHHGRRGLLRMVSQRRKLLDYL
RS15_RALSO      MSVADINKQEVVKQFARGTNDTGSPEVQVALLTARINELTPHFKAHMKDHHSRRGLLKMVSRRRRLLDYL
RS15_PELCD      --LATEKKQELIDQYKRHEGDTGSPEVQIALLSERITYLTEHFRTHKKDHHSRRGLLKIVGQRRRLLDYL
RS15_METFK      MAITVQETAKIVADFQQAPNDTGSPEVQVALLSARITYLTEHFKSHAKDHHSRRGLLKLVSQRRKLLDYL
RS15_LARHH      MAISTELKAEIVKDYQRAEGDTGSPEVQVALLTARINDLTPHFKANTKDHHSRRGLLKMVSRRRKLLDYL
RS15_DESVV      MVMDIEAKKAVIDAHAKHEGDTGSPEVQVALLTARIEQLTGHFKVHKKDYHSRTGLLKLVGQRRKLLNYL
RS15_DESVH      MVMDIEAKKAVIDAHAKHEGDTGSPEVQVALLTARIEQLTGHFKVHKKDYHSRTGLLKLVGQRRKLLNYL
RS15_ANADF      MALVQERKQELVTKYKRHEKDTGSPEVQVALLTERIAYLTEHFKTHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_GEOLS      --LATEKKQEIINNFKKHEGDTGSPEVQIAILTARIVYLTDHFKIHKKDHHSRRGLLKLVGQRRRMLDYL
RS15_FRATW      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRATT      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRATO      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLKGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRATM      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRATH      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLKGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRATF      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLKGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_FRAT1      --LTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVSQRRKLLDYL
RS15_EXISA      MALSKERKNEIIAEYATKQGDTGSPEVQVAVLTEQINTLNDHLRTHKKDHHSRRGLLKMVGRRRNLLTYL
RS15_DECAR      MALTTENKAAIVADYAQSKGDTGSPEVQVALLTARINDLTPHFKEHSKDHHSRRGLLHLVSQRRKLLDYL
RS15_ACIF5      MALSHDIKAEVVQGYATHVGDTGSPEVQVALLTTRIEGLTDHFKVNKHDHHSRQGLLRMVGQRRKLLDYL
RS15_ACIF2      MALSHDIKAEVVQGYATHVGDTGSPEVQVALLTTRIEGLTDHFKVNKHDHHSRQGLLRMVGQRRKLLDYL
RS15_PERMH      MSITPEKKAEIIKRFARHEGDTGSPEVQIAILTERIKNLTEHIKKNKKDLHSRRGLIGMVNKRRKLLNYL
RS15_XYLFM      ----------IIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XYLFA      ----------IIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_GEOTN      MALTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRNLLAYL
RS15_DESAA      MALTAKTKQELIEEFKTHDSDTGSPEVQVALLTNRITYLTEHFKTHKKDHHSRRGLLKLVGQRRRLLNYL
RS15_DESMR      MVMTAEDKAQVIGEHKKHDGDTGSPEVQVALLTSRIVYLTGHFKSHPKDFHSRTGLLKLVGQRRKLLNYL
RS15_CARHZ      MALTQEQKMEIISKYQLHEKDTGSPEVQIAILTERINQLTEHLKVHKKDFHSRRGLLKMVGQRRSLLNYL
RS15_BIFAA      MALTAEEKQEIIKTYATHEGDTGSPEVQVALLTKRIADLTEHLKEHKHDHHSRRGLLLMVGDRRRMLDYL
RS15_BIFA0      MALTAEEKQDIIAKYATHEGDTGSPEVQIALLTKRIADLTEHLKFHKHDHHSRRGLLLMVGDRRRLLDYL
RS15_THIDA      MAVTVAQKAQIVQDYQRAAADTGSPEVQVALLTARINDLTGHFKANIKDHHSRRGLLKMVSRRRKLLDYL
RS15_XYLFT      ----------IIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_XYLF2      ----------IIENNKRSAHDTGSPEVQVALLTARIELLTKHFKIHKKDHHSRRGLLQMVNRRRSLLDYL
RS15_DESHY      --MTAEKKKEIIAKFQQHEGDTGSPEVQIALLTERITYLTEHFKTHKKDHHSRRGLLKMVGQRRALLNYL
RS15_SULSY      MSITAEKKQELIKKFALHENDTGSPEVQIAVLTERIRNLTEHIKANKKDLHSRRGLIGMVNKRRKLLNYL
RS15_SORC5      ------QKTDIIQKYAIHDGDTGSPEVQIALLSERINQLQEHFRTHQKDHHSRRGLLKLVSQRRRQLDYL
RS15_DESVM      MVMDVDQKKSIIDVHAKHEGDTGSPEVQVALLTARIEQLTGHFKTHKKDFHSRTGLLKMVGQRRKLLKYL
RS15_DESAD      MVMTAEAKAKVIEEYQTKPGDTGSPEVQVALLTARIKYLTDHFKTHKKDFHSRTGLLKMVGQRRNILKYL
RS15_BACST      MALTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYL
RS15_DESDA      MVLDPTQKKSVIDAHAKHEGDTGSPEVQVALLTARIEDLTGHFKEHKKDFHSRTGLLKLVGRRRNILNYL
RS15_ACIBL      --LAREHKTNIIEQYKTHANDTGSPEVQIAILSTRITELTDHFKAHKKDHASRRGLLMMVSKRRSLLDYL
RS15_SYNWW      MALSLERKGEIIKTYQIHENDTGSPEVQIAILTERINYLNEHLKINSKDHHSRRGLLKMVGQRRSLLDYL
RS15_BIFLO      MALTAEEKQEIIAKYATHEGDTGSPEVQVALLSKRIADLTEHLKEHKHDHHSRRGMQLMIGDRRRLLDYL
RS15_BIFLD      MALTAEEKQEIIAKYATHEGDTGSPEVQVALLSKRIADLTEHLKEHKHDHHSRRGMQLMIGDRRRLLDYL
RS15_BACP2      MAITQERKTQLISEFKTHESDTGSPEVQIAVLTESINNLNEHLRTHKKDHHSRRGLLKMVGRRRNLLTYL
RS15_BACLD      MAITQERKTQLINEFKTHESDTGSPEVQIAILTDQINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_YEREN      MSLSVEAKAKIVADFGRDANDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERE8      MSLSVEAKAKIVADFGRDANDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_PROMH      MSLSTEAKAKIVAEFGRDANDTGSSEVQIALLTAEINHLQGHFSEHKKDHHSRRGLLRKVSSRRNLLDYL
RS15_MARMS      MALSAESKAALVKEFQVAEGDTGSPEVQVALLTKNIEGLQGHFKAHIHDHHSRRGLIRMVNQRRKLLDYL
RS15_BACHD      MALTQERKNEIINEFKTHENDTGSPEVQVAILTEQINTLNEHLRTHKKDHHSRRGLLKMVGQRRNLLTYL
RS15_POLNS      MAVADIKTAKIVKENARSANDTGSPEVQVSLLTARINELTPHFKANTKDHHSRCGLLKMVSRRRRLLDYL
RS15_HERAR      MSLEKTSKAAIVADNARGANDTGSPEVQVALLTARINDLNGHFKAHSKDHHSRRGLIMMVNRRKSLLSYL
RS15_GEOSW      MALSQERKREIIEQFKIHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_YERPY      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPS      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPP      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPN      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPG      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPE      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPB      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERPA      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_YERP3      MSLSVEAKAKIVADFGRGTNDTGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSTRRKLLDYL
RS15_THISH      MSLNAETKAGIVEKYRRDPSDTGSPEVQVALLSARIDHLMGHFASHKKDHHSRRGLLKMVNQRRKLLDYL
RS15_RHOS4      MSITVEEKARLIKEYATKEGDTGSPEVQVAVLSSRIATLTEHFKAHKKDNHSRRGLLMMVAQRRXXXXXX
RS15_RHOS1      MSITVEEKARLIKEYATKEGDTGSPEVQVAVLSSRIATLTEHFKAHKKDNHSRRGLLMMVAQRRXXXXXX
RS15_BREBN      MALTQERKTQLIQEFRTHENDTGSPEVQIAILTENINNLNGHLRTHKKDHHSRRGLLKMVGQRRNLLTYL
RS15_AGRT5      MSITAERKAALITEYATKAGDTGSPEVQVAILTERINNLTGHFKDHKKDNHXXXXXXXXXXXXXXXXDYL
RS15_VIBSL      MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFKAHKHDHHSRRGLLRMVSSRRKLLDYL
RS15_STRAW      MSLDAATKKQIITEFGTKEGDTGSPEVQVAMLSRRISDLTEHLKTHKHDHHSRRGLLILVGQRRRLLQYL
RS15_BIFLI      MALTADEKTQIINEYATHEGDTGSPEVQVALLSKRIADLTEHLKEHKHDHHSRRGMQLMIGDRRRLLDYL
RS15_BACSU      MAITQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACA2      MAITQERKNQLISEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_EDWI9      MSLSVEAKAKIVAEFGRDANDSGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_DESDG      MVMTPEKKMSIIEEYGQHEGDTGSPEVQVALLTARIEYLTEHFKSHKQDYHSRTGLLKLVGQRRNMLKYL
RS15_VIBFM      MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFANHKHDHHSRRGLLRMVSSRRKLLDYL
RS15_VIBF1      MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFANHKHDHHSRRGLLRMVSSRRKLLDYL
RS15_PSEPK      MALSVEEKAQIVAEYQQAAGDTGSPEVQVALLTANINKLQGHFKANDKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEP1      MALSVEEKAQIVAEYQQAAGDTGSPEVQVALLTANINKLQGHFKANDKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEE4      MALSVEEKAQIVAEYQQAAGDTGSPEVQVALLTANINKLQGHFKANEKDHHSRRGLIRMVNQRRKLLDYL
RS15_OCEIH      MAITQERKNEIISEYKVHETDTGSPEVQIAVLTEEITSLNEHLRVHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_JANMA      MSLEKASKAAIVADNARGQNDTGSPEVQVALLTARINELNSHFKAHTKDHHSRRGLIMMVNRRKSLLSYL
RS15_THEPX      -----EKKAEIINKFKLHDTDTGSPEVQIALLTERINNLNAHLQVHKKDHHSRRGLLKMVGQRRALLNYL
RS15_THEP3      -----EKKAEIINKFKLHDTDTGSPEVQIALLTERINNLNAHLQVHKKDHHSRRGLLKMVGQRRALLNYL
RS15_STRGG      MPLDAATKKQIMSEFAQKEGDTGSPEVQVAMLSRRISDLTEHLKTHKHDHHSRRGLLILVGQRRRLLQYL
RS15_SALTY      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALTI      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALSV      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALPK      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALPC      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALPB      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALPA      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALNS      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALHS      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALG2      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALEP      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALDC      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALCH      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SALA4      MSLSTEATAKIVSEFGRDANDTGSTDVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_PSEPW      MALSVEEKAQIVTDFQQAAGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEPG      MALSVEEKAQIVTDFQQAAGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_METCA      MAFTAAEKSVIVQEFQRAPGDTGSPEVQVALLTNRINYLTPHFVKHKKDFHSRRGLLRLVNQRRKLLDYL
RS15_KLEP7      MSLSVEAKAKIVSEFGRGENDSGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ENT38      MSLSVEAKAKIVSEFGRGTNDSGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_CITK8      MSLSVEAKAKIVSEFGRGTNDSGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_BACSK      MALTQERKNELIAEFKTHETDTGSPEVQVAILTEQINTLNDHLRTHKKDHHSRRGLLKMVGQRRNLLTYL
RS15_THETN      -----EKKAEIINKFKLHETDTGSPEVQIALLTERINRLTEHLQVHKKDHHSRRGLLKMVGQRRALLNYL
RS15_SODGM      MSLSVEAKAKIVSDFGSDAKDSGSTEVQVALLTAQISHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_KLEP3      MSLSVEAKAKIVSEFGRGENDSGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHISS      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHIFL      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHIF8      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHIDS      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHIBS      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SHIB3      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_SERP5      MSLSVEAKAKIVADFGRGTNDSGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_PECCP      MSLSVEAKAKIVADFGRGTNDSGSTEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ESCF3      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOUT      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOSM      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOSE      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOLU      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOLI      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOLC      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOL6      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOL5      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOK1      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOHS      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECODH      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECOBW      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO8A      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO81      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO7I      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO5E      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO57      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO55      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO45      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO27      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ECO24      MSLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_DESRM      MALSPEKKNEIIENFKTHEGDTGSPEVQIALLTERINQLTMHLKSFKKDHHSRRGLLKMVGQRRALLNYL
RS15_CHRSD      MALTAEQKATIVNEYGRGENDTGSPEVQVALLSANIDGLQDHFKSNKQDHHSRRGLIRMVNQRRKLLDYL
RS15_AZOSB      MALDTSTKAQIVSDFQRAQGDTGSPEVQVALLTARINGLTGHFKANAKDHHSRRGLLKMVSQRRKLLDYL
RS15_ANOFW      MALTQERKNEIINQFKIHETDTGSPEVQVAILTEQINNLNDHLRVHRKDHHSRRGLLKMVGRRRNLLTYL
RS15_SINMW      MSVTAERKAQIIKEFATAEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHXXXXXXXXXXXXXXXXDYL
RS15_PSEU2      MALSVEEKAQIVTDYQQAVGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSESM      MALSVEEKAQIVTDYQQAVGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSE14      MALSVEEKAQIVTDYQQAVGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_COLP3      MSLNATEKAAIVAEYAQSEGDTGSPEVQVALLTTQINHLQGHFKAHIHDHHSRRGLLRMVAQRRKLLDYL
RS15_SPHWW      MTVTAERKTAIIADNARANGDTGSPEVQVAILTERINNLTEHFKSHAKDNHSRRGLLMLVNXXXXXXXXX
RS15_RHIME      MSVTAERKAQIIKEFATVEGDTGSPEVQVAILTERINNLTEHFKDHKKDNHXXXXXXXXXXXXXXXXDYL
RS15_PSEMY      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEAE      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEAB      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEA8      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEA7      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_CLOPS      ------RKQEIIAKHARHEGDTGSPEVQIALLTERINSLTDHLRTHKKDHHSRRGLLMMVGQRRGLLNYL
RS15_CLOPE      ------RKQEIIAKHARHEGDTGSPEVQIALLTERINSLTDHLRTHKKDHHSRRGLLMMVGQRRGLLNYL
RS15_CLOP1      ------RKQEIIAKHARHEGDTGSPEVQIALLTERINSLTDHLRTHKKDHHSRRGLLMMVGQRRGLLNYL
RS15_HELPJ      MALNLEKKQEIIKAFATKANDTGSCEVQVALLNERIKLLTEHLKTNPKDHSSRLGLLKLVAQRRNLLKYI
RS15_VIBCM      MSLNAETKAAIVAEYARCENDTGSPEVQIALLTASINHLQGHFQAHKGDHHSRRGLLRMVSSRRKLLDYL
RS15_VIBCH      MSLNAETKAAIVAEYARCENDTGSPEVQIALLTASINHLQGHFQAHKGDHHSRRGLLRMVSSRRKLLDYL
RS15_VIBC3      MSLNAETKAAIVAEYARCENDTGSPEVQIALLTASINHLQGHFQAHKGDHHSRRGLLRMVSSRRKLLDYL
RS15_STRCO      MSLDAAVKKQIITEFGTKEGDTGSPEVQVALLSRRISDLTEHLKTHKHDHHSRRGLLILVGQRRRLLQYL
RS15_PSEU5      MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLTANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSEA6      MSLTTQETAAIIADYGVKEGDTGSPEVQVALLTSNINKLQGHFADHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_CLOTH      -----ELKQEIINKFKLHETDTGSPEVQIALLTERINHLTEHLKVHKKDYHSRRGLLKMVGHRRGLLNYL
RS15_BEUC1      MALDAAVKQTIITEYATHEGDTGSPEVQIAMLSQRIKDLTEHLKTHKHDHHSRRGLMLLVGQRRRLLGYL
RS15_BACWK      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACHK      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACCZ      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACCR      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACCN      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC7      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC4      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC3      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC2      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC1      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACC0      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACAN      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACAH      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_BACAC      MALTQERKNEIIAQFRTHETDTGSPEVQIAVLTEQINTLNEHLRTHKKDHHSRRGLLKMVGKRRNLLTYL
RS15_AZOVD      MALTVEEKAQIVNEYKQAEGDTGSPEVQVALLTANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PSYIN      MSLSAEQKAEIVAKYGRSENDTGSSEVQAALYTAQIDHLQGHFKEHIHDHHSRRGLLRMVSQRRKLLDYL
RS15_PSEPF      MALDVQEKAQIVADYQQAVGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_AGRVS      MSITAERKSALIKEYATNEGDTGSPEVQVAILTERITNLTEHFKGHKKDNHXXXXXXXXXXXXXXXXDYL
RS15_PSEF5      MALSVEEKAQIVTDYQQAVGDTGSPEVQVALLTANINKLQGHFKANGKDHHSRRGLIRMVNQRRKLLDYL
RS15_PELTS      MALTSEQKKNVISRYKLHDNDTGSPEVQVAILTERINSLTEHLKLHKGDHHSRRGLLKMVGQRRALLNYL
RS15_MOOTA      MALDAAKKREIIARYQKHENDTGSPEVQIAILTERINHLTEHLQVHHKDHHSRRGLLKMVGQRRGLLNYL
RS15_ERWT9      MSLSNETKAKIVADFGRDANDSGSTEVQVALLTAQISHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ERWCT      MSLSVEAKAKIVADFGRGTNDSGSTEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_AZOSE      MALDTASKSQIVNDFQRAQGDTGSPEVQVALLTARINGLTGHFKANAKDHHSRRGLLKMVSQRRKLLDYL
RS15_STACT      MAISQERKDEIIKEYRVHETDTGSPEVQIAVLTAEINALNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_HAMD5      MSLNAEQKAKVVLEHGSSAHDTGSTEVQVALLTLRINDLQKHFLEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_ALISL      MSLNAETKAAIVAEYAQCENDTGSPEVQVALLTASINHLQGHFANHKHDHHSRRGLLRMVSSRRKLLDYL
RS15_NEIMF      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_NEIMB      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_NEIMA      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_NEIM0      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_NEIG2      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_NEIG1      MALTVEQKAQIVKDFQRKEGDTGSSEVQVALLTFRINDLTPHFKANPKDHHSRRGLLKMVSQRRRLLAYL
RS15_ENTFA      MAISQERKNEIIKEYARHEGDTGSPEVQIAVLTEDINQLNEHARTHKKDHHSYRGLMKKIGHRRNLLAYL
RS15_CLOD6      -------KSEIIKEYGRAEGDTGSPEVQIALLTARINELNGHLKTHKKDHHSRRGLLKMVGRRRNLLAYL
RS15_COPPD      MEMDKEIKRKIIEEYATHSGDTGSPEVQVALLTYRIQNLTEHLKKNPKDVHSRRGLILMVSKRRKLLNYL
RS15_CELJU      MALSAAEKAGIVAKYQKVAGDTGSPEVQVALLTANINKLQNHFVAHKADHHSRRGLIRMVNSRRKLLDYL
RS15_ALTMD      MSLTKAETAKIIAEYGVKEGDTGSPEVQVALLTHNINKLQGHFADHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_HELPS      MALNLEKKQEIIKAFATKENDTGSCEVQIALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYI
RS15_CLOB8      ------RKLELIKKFGRSEGDTGSPEVQVALLTERIQSLTEHLKVHKKDHHSRRGLLMMVGQRRGLLNYL
RS15_SHEDO      MSLSTEAKAKILADFGRCENDSGSTEVQVALLTAQINHLQGHFKTHIHDHHSRRGLLRMVSARRKLTAYL
RS15_SHEB8      MSLSTEAKAKILADFGRCENDTGSTEVQVALLTAQINHLQAHFKEHIHDHHSRRGLLRMVSSRRKLTAYL
RS15_RENSM      MALEAAVKQEIIKEYATGEADTGSPEVQIAMLSKRILDLTEHLKVHKHDHHTRRGLMALVGRRKRLLTYL
RS15_CLOAB      ------KKQELIATYSRKEGDTGSPEVQIALLSERINHLTSHLKEHKKDHHSRRGLFMMIGKRRSLLNYL
RS15_ARTCA      MALDAAVKQSIIKEYATGEGDTGSPEVQVAVLTQRIKDLTEHMKEHKHDYHTQRGLLAMVGRRKRMLSYL
RS15_SYNAS      --LSSDQRGSIIENYQLHEKDTGSPEVQIALLSARIEYLTDHFKVHKKDHHSRRGLLKLVGQRRRLLDYL
RS15_STAS1      MAISQERKNELIKEYRTHEADTGSPEVQIAVLTAEITALNEHLREHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_SHEB9      MSLSTEVKAKILADFGRCENDTGSTEVQVALLTAQINHLQAHFKEHIHDHHSRRGLLRMVSSRRKLTAYL
RS15_SHEB5      MSLSTEVKAKILADFGRCENDTGSTEVQVALLTAQINHLQAHFKEHIHDHHSRRGLLRMVSSRRKLTAYL
RS15_SHEB2      MSLSTEVKAKILADFGRCENDTGSTEVQVALLTAQINHLQAHFKEHIHDHHSRRGLLRMVSSRRKLTAYL
RS15_MARAV      MALSASEKAQIVKDFQQGDGDTGSPEVQVALLSANINKLQDHFKANKQDHHSRRGLIRMVNQRRKLLDYL
RS15_CLONN      ------RKEQLIREYATHEGDTGSPEVQVALLTERINHLNEHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOCE      -------KQEIITKYQLHEGDTGSPEVQVAILTQRINHLNEHLKIHKKDYHSGRGLLKMVGARRSLLNYL
RS15_CLOBB      ------RKLEIIKQYGRSEGDTGSPEVQIALLTERINSLTGHLKVHKKDHHSRRGLLMMVGHRRGLLNYL
RS15_ACICJ      MSITPDRRQELIGEYANKANDTGSPEVQVALLTERIVNLTEHLKTHAKDFHSXXXXXXXXXXXXXXXDYV
RS15_STAHJ      MAITQERKNEIIKEYRVHETDTGSPEVQIAVLTAEIAALNEHLREHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_SHESH      MSLNAEQTATILAEFGRSEGDTGSTEVQVALLTAQINHLQGHFKEHKHDHHSRRGLLRMVNTRRKLLAYL
RS15_SHEAM      MSLSTEAKAKILAEFGRGENDTGSTEVQVALLTAQINHLQDHFKTHIHDHHSRRGLLRMVSSRRKLLSYL
RS15_PHOLU      MSLSTEAKAQIIAEFGRDANDSGSSEVQVALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_HELAH      MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLELVAQRRNLLKYI
RS15_CLOPH      --ISKEKKQEIINAYGRNANDTGSPEVQIALLTERIAELTEHLKINKKDHHSRRGLLKMVGQRKGLLEYL
RS15_CLOBA      ------RKLEIIKQYGRSEGDTGSPEVQIALLTERINSLTGHLKVHKKDHHSRRGLLMMVGHRRGLLNYL
RS15_TERTT      MALSAQEKDAIVKEHQTSETDTGSPEVQIALLTANINKLQGHFADHKQDHHSRRGLIRMVNQRRKLLDYL
RS15_SHESR      MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLLAYL
RS15_SHESM      MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLLAYL
RS15_SHESA      MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLLAYL
RS15_SHEFN      MSLSAETKAKILADFGRCENDTGSTEVQVALLTAQINHLQGHFKEHIHDHHSRRGLLRMVSARRKLSAYL
RS15_HELPY      MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYI
RS15_HELPH      MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYI
RS15_HELMI      MALDSVRKQEIIGKFKQHEKDTGSPEVQIAILTDRINYLTGHLKTHKKDHHSRRGLLKMVGQRRNLLAYL
RS15_STAAW      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAT      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAS      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAR      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAN      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAM      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAE      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAC      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAAB      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAA9      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAA8      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAA3      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAA2      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAA1      MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_SHEPA      MSLSVEAKAQILAEFGRCENDTGSSEVQVALLTAQINHLQGHFKEHIHDHHSRRGLLRMVSTRRKLLAYL
RS15_SHEHH      MSLSVEAKAQILAEFGRCENDTGSSEVQVALLTAQINHLQGHFKEHIHDHHSRRGLLRMVSTRRKLLAYL
RS15_DICTD      MALTKEEKRQIIEKFRLNENDSGSPEVQIALLTERIKKLTEHLKVHKKDYHSRVGLLKMIGRRRKLLKYL
RS15_DICT6      MALTKEEKKQIIEKFRLNENDSGSPEVQIALLTERIKRLTEHLKVHKKDYHSRVGLLKMIGRRRKLLKYL
RS15_ACIBY      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_ACIBT      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_ACIBS      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_ACIBC      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_ACIB5      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_ACIB3      MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_SHEPW      MSLSVEAKAKILAEFGRCENDTGSSEVQVALLTAQINHLQGHFKEHIHDHHSRRGLLRMVSTRRKLLAYL
RS15_DESAP      MTLSADKKQPIIDKFKLHENDTGSPEVQVAILTERINLLTEHLKTHRKDFHSRRGLLKMVGQRRALLNYL
RS15_CLOBM      ------KKQELMAKHARHEGDTGSPEVQIALLTERINHLNSHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOBL      ------KKQELMAKHARHEGDTGSPEVQIALLTERINHLNSHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOBK      ------KKQELMAKHARHEGDTGSPEVQIALLTERINHLNSHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOBH      ------KKQELMAKHARHEGDTGSPEVQIALLTERINHLNSHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOB1      ------KKQELMAKHARHEGDTGSPEVQIALLTERINHLNSHLKEHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_ARTAT      MALDAAVKQSIIKEYATTEGDTGSPEVQVAVLTQRIKDLTEHMKEHKHDFHTQRGLLAMVGRRKRMLSYL
RS15_HELPG      MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYI
RS15_HELP2      MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLKANPKDHSSRLGLLKLVAQRRNLLKYI
RS15_CAMLR      MALDSAKKAEIVAKFARKEGDTGSPEVQIALLSARISDLTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_SHEON      MSLSTEAKAKILAEFGRGANDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLLAYL
RS15_PSYA2      --LTNADREQIIAQYQRGESDTGSPEVQVALLSARINDLQNHFKAHKADHHSRRGLIRMVNTRRKLLDYL
RS15_PSEHT      MSLSNQEKIDIIAKFARAEGDTGSPEVQVALLTFDINKLQGHFADHKHDFHSRRGLLRKVSQRRKLLDYL
RS15_PHOLL      MSLSTEAKAQIIAEFGRDVNDSGSSEVQIALLTAQINHLQGHFSEHKKDHHSRRGLLRMVSQRRKLLDYL
RS15_HYDS0      MPILKERKWELIRSFQHHDKDTGSPEVQIAILTERINKLTEHMKQNKKDLHSRRGLIAMVNKRKALLDYL
RS15_EHRCJ      MSITREKKSELISEYCLKKGDTGSSFVQCAILSERIRNLTEHLKTHKKDFHCRRGLMVLVYRRRNGLQYI
RS15_DESOH      MAYTTEVKKELISKFKVHDADTGSPEVQIALLTHRITYLTEHVKVHKKDHHSRRGLLILVGKRRKLLNYV
RS15_LYSSC      MAITKERKNEIIAEYRTHESDTGSPEVQVAVLTAEINALNTHLRTHKKDFHSERGLLKMVGRRRHLLKYL
RS15_CLOK5      -------KQEIMEKYARHEGDTGSPEVQIALLTTRINHLNEHLKIHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_CLOK1      -------KQEIMEKYARHEGDTGSPEVQIALLTTRINHLNEHLKIHKKDHHSRRGLLMMVGKRRGLLNYL
RS15_STAES      MAISQQRKDELIKEYRVHETDTGSPEVQIAVLTAEITALNEHLREHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_STAEQ      MAISQQRKDELIKEYRVHETDTGSPEVQIAVLTAEITALNEHLREHKKDHHSRRGLLKMVGRRRHLLNYL
RS15_LISW6      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LISMO      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LISMH      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LISMF      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LISMC      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LISIN      MALTQERKNEIIAEYRVHDTDTGSPEVQIAVLTAEINSLNEHVRVHKKDHHSYRGLMKMVGHRRNLLTYL
RS15_LEPBP      --ITKEQKQQIIATFGSKPNDTGSAEVQIALLDSRIKDLTEHFKANKKDFHSRRGLIAMVNQRKSLLEYL
RS15_LEPBA      --ITKEQKQQIIATFGSKPNDTGSAEVQIALLDSRIKDLTEHFKANKKDFHSRRGLIAMVNQRKSLLEYL
RS15_HAHCH      MALSATEKSVIVKEYQVKEGDTGSPEVQVALLTANINKLQDHFQANKHDHHSRRGLIRMVNQRRKLLDYL
RS15_SHEWM      MSLNAEQTASILAEFGRCENDTGSTEVQVALLTAQINHLQGHFKEHKHDHHSRRGLLRMVNTRRKLLAYL
RS15_SHESW      MSLSTEAKAKILAEFGRGENDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLTAYL
RS15_SHEPC      MSLSTEAKAKILAEFGRGENDTGSTEVQVALLTAQINHLQDHFKEHIHDHHSRRGLLRMVSARRKLTAYL
RS15_FINM2      -----------------KEGDTGSPEVQVALLTYRINYLTEHLKSHKNDHHSRRGLFKMIGKRRNLLNYL
RS15_EHRCR      MSITRERKSELISEYCLKKDDTGSSFVQCAILSERIRNLTEHLKVHKKDFHCRRGLMVLVCRRRNVLQYV
RS15_DICNV      --LTVENKADIIKKYQKKEGDTGSTEVQIALLSARISDLQSHFDLNKKDHHSRRGLLKMVSRRRRLLEYF
RS15_NITSB      MALDSAKKQEIISKFAEHEGDTGSPAVQIALLSERISYLTEHLKEHKKDHSSRLGLLKLVGQRKRLLNYL
RS15_LACGA      MAISKEKKDELIKEYARHDGDTGSPEVQIALLTSDINNLNAHLKANKQDHHSYVGLLKKIGHRRNLLRYL
RS15_LACDB      MAVSKERKNEIIKEYATHEGDTGSVEVQVAVLTEDINNLTQHMREHSHDHHSYVGLLKKIGHRRNLLRYL
RS15_LACDA      MAVSKERKNEIIKEYATHEGDTGSVEVQVAVLTEDINNLTQHMREHSHDHHSYVGLLKKIGHRRNLLRYL
RS15_ARTS2      MALDAAVKQSIIKDFATSEGDTGSPEVQVAVLTQRIKDLTEHMKEHKHDFHTQRGLLAMVGRRKRMLTYL
RS15_OPITP      -------KPEIIAQYKTHDKDTGSSEVQVALLTARINHLTEHLRTHRKDFHSRRGLLQMASRRRKLLDYL
RS15_ACIAD      MALTNADRAAIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKEHKHDHHSRRGLIRMVNQRRKLLDYL
RS15_SHELP      MSLSKEVKAQILADFGRGENDTGSTEVQVALLTAQINHLQGHFKEHIHDHHSRRGLLRMVNSRRKLLAYL
RS15_ALKOO      -----ENKKTIIDTFKTHENDTGSPEVQIALLTERINHLNEHLKSHKKDFHSRRGLLKMVGKRRNLLNYL
RS15_PROAC      ----AAEKKKIIEEYATHPGDTGSPDVQVAILTKRIAELTEHLKVHKGDHHSRRGLMLMVGQRRRLLNYI
RS15_LACPL      MAISREKKTELINKYARHEGDTGSVEVQVAVLTEDINELNEHLRVHKKDFHSQRGLMKKIGHRRNLLAYL
RS15_LACLS      MAISKEKKQEIIAQYARKEGDTGSPEVQIAVLTWEINHLNDHIKSHKKDHATQRGLMKKIGHRRNLLGYL
RS15_LACLM      MAISKEKKQEIIAQYARKEGDTGSPEVQIAVLTWEINHLNDHIKSHKKDHATQRGLMKKIGHRRNLLGYL
RS15_LACLA      MAISKEKKQEIIAQYARKEGDTGSPEVQIAVLTWEINHLNDHIKSHKKDHATQRGLMKKIGHRRNLLGYL
RS15_COXBU      MSLASAETAKIVKEYQLGKDDTGSPEVQVAILTAKIIKLTDHMKAHKHDHHSRRGLLRMVSQRRKLLNFL
RS15_COXBR      MSLASAETAKIVKEYQLGKDDTGSPEVQVAILTAKIIKLTDHMKAHKHDHHSRRGLLRMVSQRRKLLNFL
RS15_COXBN      MSLASAETAKIVKEYQLGKDDTGSPEVQVAILTAKIIKLTDHMKAHKHDHHSRRGLLRMVSQRRKLLNFL
RS15_COXB1      MSLASAETAKIVKEYQLGKDDTGSPEVQVAILTAKIIKLTDHMKAHKHDHHSRRGLLRMVSQRRKLLNFL
RS15_CAMJD      MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIIELTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_VARPS      --IAASIKAEVVKDNARAANDTGSPEVQVALLTARINELTPHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_SACD2      MALSAAEKSAIVKEYQTAETDTGSPEVQVALLTANINKLQGHFSDHKQDHHSRRGLIRMVNQRRKLLDYL
RS15_EHRRW      MSVTPERKSELISEYCLKKGDTGSSFVQCAILSERIRNLTEHLKIHKKDFHCRRGLMVLVCRRRNELQYI
RS15_EHRRG      MSVTPERKSELISEYCLKKGDTGSSFVQCAILSERIRNLTEHLKIHKKDFHCRRGLMVLVCRRRNELQYI
RS15_SYMTH      MPLSQEEKQRIINEFKTHETDTGSPEVQIALLTHRINELTEHLRVHKKDHHSRRGLLKMVGQRRALLVYL
RS15_LACJO      MAISKEKKDELIKEYARHDGDTGSPEVQIALLTSDINNLNDHLKANKQDHHSYVGLLKKIGHRRNLLRYL
RS15_BURVG      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURTA      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURS3      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURPS      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURP6      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURP1      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURP0      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURMS      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURMA      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURM9      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURM7      MSVADIKKSEVVAQFARGANDTGSPEVQVALLTARITELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURM1      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURCM      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURCJ      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURCH      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURCC      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURCA      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_BURA4      MSVADIKKSEVVAQFARGTNDTGSPEVQVALLTARIVELTGHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_CAMJR      MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_CAMJJ      MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_CAMJE      MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_CAMJ8      MALDSAKKAEIVAKFAKKPGDTGSTEVQVALLTARIAELTEHLKIYKKDFSSRLGLLKLVGQRKRLLSYL
RS15_ACAM1      MALLQEKKHEIINAYQVHETDTGSADVQVAMLTERISKLSEHLKTNKKDHSSRRGLLKMIGQRKRLLTYI
RS15_VEREI      --IASSIKAEVVKANARAANDTGSPEVQVALLTARINELTPHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_PROA2      MSLTKEKKAEIINTFGGSDKNTGKTEVQIALYSRRISDLTGHLKEHPKDKHSRHGLLKLVGKRKSLLAYL
RS15_NATTJ      MPLSKEQKQEVMEKYKLHEHDTGSPEVQIAILTEKIKQLNEHLKTHQQDHASRRGLLKMVGKRRGLLNYL
RS15_CHLTE      MGLTKEHKTEIITKFGDSATDTGKAEVQVALFTRRITDLTGHLQQHPKDKHSRRGLLMLVGKRKRVLNYL
RS15_CAMC5      MALDSAKKAEIVAKFARKEGDTGSPEVQIALLTARIAELTEHLKVFKKDFSSRLGLLKLVGQRKRLLKYL
RS15_MICAN      MALTQTKKQELISQYQAHETDTGSSELQVAFLTERINQLTEHLKANPKDHASRRGLLQMIGRRRGLLTYI
RS15_CHLPB      MSVTKEIKTDIINQFGGSEKNTGQTEVQIALFSRRISDLTGHLKLHPKDKHSRHGLLKLVGKRKSLVAYL
RS15_CHLP8      MGLAKEHKTEIITKFGDSATDTGKAEVQVALFSRRIADLTGHLQQHPKDKHSRRGLLMLVGKRKRVLNYL
RS15_ACHLI      MALTKDSKKAIVEKFARFAGDTGSPEVQVAILTHEINELNEHLQTHIHDFHSKRGLFMKIGRRRNLLKYL
RS15_THERP      MALYKAQKAAIIEQFRQHENDTGSTEVQVALLTERINILTEHLREHKHDYHSRRGLMKLVGQRRRLLRYL
RS15_THEAB      -------KEEIIKEFQIHEGDTGSTEVQIALLTARIKHLTEHLKKHPKDYHSRRGLMKLVGRRRKILKYL
RS15_LEUMM      MALTQERKNEIIKAYARHEGDTGSAEVQIAVLTADINELNTHMAAHKHDFHSQRGLMKKIGSRRNLLRYL
RS15_BURP8      MSVAEIKKSDVVAQFARGANDTGSPEVQVALLTTRINELTVHFKAHTKDHHXXXXXXXXXXXXXKLLDYL
RS15_PSEPU      MALSVEEKAQIVAEYQQTAGDTGSPEVQVALLTANINKLQGHLKPTTKTTTPVRGLIRMVNHRRKLLDYL
RS15_DELAS      --IASSVKAEVVKSNARSANDTGSPEVQVALLTARINELTPHFKQHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_CAMC1      MALDSAKKAQIVAKFARKEGDTGSPEVQIALLTARITELTEHLKIFKKDFSSRLGLLKLVGQRKRLLKYL
RS15_BURXL      -AVETSKKSEVVAQFARAANDTGSPEVQVALLTTRINELTVHFKAHTKDHHXXXXXXXXXXXXXKLLDYL
RS15_LEUCK      MALTQERKNEIIKEYARHEGDTGSAEVQIAVLTADINELNVHMAAHKHDFHSQRGLMKKIGSRRNLLRYL
RS15_DIAST      --IASSVKAEVVKANARSANDTGSPEVQVALLTARINELTPHFKQHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_CYAA5      MSLTASEKQVLMSEYQVHETDTGSADLQVAILTKRITQLTDHLKQNPKDHASRRGLLKMIGRRRRLLGYI
RS15_CALS8      --------------------DTGSPEVQIALLTERINRLNEHLQIHKKDFHSRRGLLKMVGQRRKLLNYL
RS15_ANATD      --------------------DTGSPEVQIALLTERINRLNEHLQAHKKDFHSRRGLLKMVGQRRKLLNYL
RS15_ACISJ      --IASSVKAEVVKANARSANDTGSPEVQVALLTARINELTPHFKQHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_WOLSU      MALDSAIKLEIISKFARGEKDTGSPEVQVALLSRRISDLTEHLKVNVKDHASRLGLLKLVAQRKHLLKYL
RS15_THEM4      -------KEEIIKEFQIHEGDTGSAEVQVALLTARIKHLTEHLKKHPKDYHSRRGLMKLVGRRRKILKYL
RS15_NOCFA      MALTTEQKSAILAEYGLHEKDTGSPEAQIALLSKRIADITEHLKKHKHDHHTRHGLMALIGRRKRLSKYL
RS15_FUSNN      -------KAEIIKEFGKSEADTGSTEVQIALLTEKINHLTEHLRVHKKDFHSRLGLLKMVGQRKRLLAYL
RS15_BAUCH      MSLSFNTKAKIIADFGRNNYDSGSTAVQIALLTAQINHLQDHFAVHKKDHHSRRGLLRIVSQRRKLLVYF
RS15_AQUAE      MVLPKDVKWDLIRQFQRHEQDTGSPEVQIAILTERINRLTEHMKKHKKDIHSRRGLIAMVNKRRKLLEYL
RS15_ACIAC      --IASSVKAEVIKDNARAANDTGSPEVQVALLTARINELTPHFKQHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_PEDPA      MAISQEKKNEIIAKYARHEGDTGSAEVQIAVLTADINEINEHLRVHRKDFHSQRGLMKKIGHRRNLLAYL
RS15_ALKMQ      -------KKSIIDTFKTHENDTGSPEVQIALLTDRINHLNDHLKTHKKDHHSRRGLLKMVGQRRNLLNYL
RS15_SYNR3      MPLNTEKKQELINSHQTHATDTGSVEVQVAMLSERITQLTGHLQSNKHDYSSRQGLMKMLGRRKSLLGYL
RS15_SYNP6      MSLTQARKQEIFEAYQIHPTDTGSADVQVAVLSERISRLSQHLQQNKKDFASRTGLLRLIGQRKRLLAYI
RS15_SYNE7      MSLTQARKQEIFEAYQIHPTDTGSADVQVAVLSERISRLSQHLQQNKKDFASRTGLLRLIGQRKRLLAYI
RS15_CYAP8      MSLSATQKQEVITSYQVHETDTGSADLQVALLTTRISQLTGHLQQNPKDHASRRGLLKMIGRRRRLLSYI
RS15_CHLCH      MSLTQDQKVEIIKQFGTSEKDTGKSEVQVALYTRRISDLTSHLQEHPKDKHSRRGLLMLVAKRKKILNYL
RS15_CYTH3      MYLTSEIKKEIFKGTAKSATDTGSPESQIALFSHRIAHLTEHLKVNKKDYSTQLGLMKLVGKRRRLLNYL
RS15_RUTMC      ----------IIKKYQSKTGDTGSSNVQIALLTARIKHLTEHFKTHKKDHHSRRGLLHLVSQRKKLLIYL
RS15_RHOFD      --IASSIKAAVVKDNARQPGDTGSPEVQVALLTARINELMPHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_LACRJ      MAISKERKDQIIKEFATHEGDTGSTQVQVAVLTADINELNDHLRTHKHDYHSQRGLMKKIGHRRNLLAYL
RS15_LACRE      MAISKERKDQIIKEFATHEGDTGSTQVQVAVLTADINELNDHLRTHKHDYHSQRGLMKKIGHRRNLLAYL
RS15_LACRD      MAISKERKDQIIKEFATHEGDTGSTQVQVAVLTADINELNDHLRTHKHDYHSQRGLMKKIGHRRNLLAYL
RS15_LACBA      MAISQAKKNEIIKQYARHEGDTGSTEVQVAVLTADINEINVHMQEHRKDFHSQRGLMKKIGHRRNLLAYL
RS15_PROMA      MTLNTEAKQKIINKHQTHGTDTGSVEVQVAMLSERINQLSKHLQSNNHDFSSRQGLLKMIGQRKRLLNYV
RS15_LACCB      MAIEQTQKDEIIKQYARHDGDTGSPEVQIAVLTAEILALNDHLSVHKKDHHSYVGLMKKIGHRRNLLAYL
RS15_LACC3      MAIEQTQKDEIIKQYARHDGDTGSPEVQIAVLTAEILALNDHLSVHKKDHHSYVGLMKKIGHRRNLLAYL
RS15_BDEBA      MAVTKDQTSQIVKKFKTSDLDTGSSEVQIALLTAKINDLTNHFAKHKKDHHGRRGLVTMVNKRRKLLDYL
RS15_SOLUE      MALAIEAKRQILTGNQRHKTDTGSPEVQIALLSTRITMLTEHFKTHKKDHGSRKGLLTLVAKXXXXXXXX
RS15_PELPB      MSLTKEFKADVIKQFGASEKNTGKSEVQVALYTRRISDLTGHLQLHPKDKHSRRGLLMLVAKRKKMLNYV
RS15_SYNY3      MSLTQIRKQELMTEYQAHETDTGSADLQVAFLTERITQLTGHLKANPKDHASRRGLLKMIGRRKRLLSFI
RS15_STRZT      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRZP      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRZJ      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRTD      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRT2      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRT1      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRR6      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRPS      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRPN      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRPJ      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRPI      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRP7      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRP4      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRP2      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_GRAFK      MYLTSEKKEEIFSKHGKGKNDTGSAEGQIALFTHRIAHLSEHLKTNRKDYNTERSLVMLVGKRRSLLDYL
RS15_CYAP4      MALLQQRKQEIISGYQTHETDTGSADVQVAMLTERINKLSTHLQANSKDHSSRRGLLQMIGRRKRLLAYI
RS15_CHLPD      MSLTQEDKAGIISQFGGVQQNTGKAEVQVALFSRRITDLTGHLQQHPKDKHSRRGLLMLVGKRKKVLNYL
RS15_STRSV      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKRHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRPZ      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPM      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPG      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPD      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPC      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPB      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRP8      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRP6      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRP3      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRP1      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNSHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRGC      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_NITMU      MAVTTDQKAQVVRDYQRAAGDTGSPEVQVALLTARINDLADHFKTHVKDHHXXXXXXXXXXXXXKLLDYL
RS15_ANAPZ      MSITPSKKSELISEYRIKEGDTGSAYVQCAILSERIRNLTEHLRIHKKDYHCRRGLMVLVCKRRKRLQYI
RS15_TRIEI      MALKQQRKQEIIGEYQTHETDTGSADVQVAMLTEKITKLSAHLRNNKQDYSSQRGLLKMIGKRKRLLTYI
RS15_STRU0      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNGHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_PROMM      MSLDTTEKQQLINANQTHGTDTGSVEVQVAMLSERITKLSSHLQENKHDFSSRQGLLKMIGRRKRLLSYV
RS15_PROM3      MSLDTTEKQQLINANQTHGTDTGSVEVQVAMLSERITKLSSHLQENKHDFSSRQGLLKMIGRRKRLLSYV
RS15_POLSJ      -------KAEIVKANARAANDTGSPEVQVALLTGRINELTPHFKANAKDHHXXXXXXXXXXXXXKLLDYL
RS15_POLNA      -------KAEIVKDNARSALDTGSPEVQVGLLTGRINELMPHFKTHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_NITEU      MAVTTDQKSQVMRDYQRAAGDTGSPEVQVALLTTRINSLVDHFKQHVKDHHXXXXXXXXXXXXXKLLDYL
RS15_THESQ      VSLDPEKKNEIIKEFQIHENDTGSVEVQIALLTARIKHLTEHLRKHPKDFHSRRGLMKMIGRRRKMLKYL
RS15_THEP1      VSLDPEKKNEIIKEFQIHENDTGSVEVQIALLTARIKHLTEHLRKHPKDFHSRRGLMKMIGRRRKMLKYL
RS15_THEMA      VSLDPEKKNEIIKEFQIHENDTGSVEVQIALLTARIKHLTEHLRKHPKDFHSRRGLMKMIGRRRKMLKYL
RS15_MESFL      --ISKTRKAEIIKEFGGSEANTGLAEVQIALLTEDIANMTEHLKEHKKDVPTRRTLLKKVAQRRHLLDFL
RS15_HELHP      MALDMAKKKEIIAKFARDSKDTGSSEVQIALLSQRIADLTEHLKANPKDHSSRLGLLKLVGQRKSLLSYL
RS15_THICR      --LTPEDKAAIVAEYATSEGDTGSPEVQVALLTHRITYLTEHFKSHIHDNHSRTGXXXXXXXXXXXXDYL
RS15_THETH      MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
RS15_THET8      MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
RS15_THET2      MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
RS15_STRS7      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNNHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRPF      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNNHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STREM      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNNHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRE4      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNNHIKEHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRA5      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRA3      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_STRA1      MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_CHLL2      MSLTKENKSNIITQFGGAVQNTGKAEVQVALFSGRITDLTGHLQKHPKDKHSRRGLLMLVGKRKKVLNYL
RS15_BORHD      --ISKEQKQKIITEFGKNPNDTGSVEVQIALITDRIRYLTEHLKSNKKDHSSKRGLLKLVGQRRSLLRYY
RS15_BORAP      --IDKKQKQKIVSEFGKNEGDTGSVGVQIALITGRIKYLTEHLKINKKDHSSKRGLLKLVGQRRSLLQYY
RS15_SYNS3      MSLDTTEKQQLINSHQTHATDTGSAEVQVAMLSERISKLSSHLQQNIHDYSSRQGLLKMIGRRKRLLGYV
RS15_STRMU      MAISKEKKNEIIKQYARHDGDTGSVEVQVAVLTWEINHLNEHIKQHKKDHATYRGLMKKIGHRRNLLAYL
RS15_LEPCP      -------KAEIVASNARAPSDTGSPEVQVALLTARINHLMPHFKTHMKDHHXXXXXXXXXXXXXKLLDYL
RS15_KOCRD      MALDAAIKNQIITEYATHEGDTGSPEVQIAVLSRRISDLTEHLKMHKHDHHTRRGLMALVGXXXXXXXXX
RS15_ANAVT      MALTQQRKQEIINNYQVHGTDTGSTDVQIAMLTERINRLSEHLQANKKDHSSRRGLLKLIGHRKRLLAYL
RS15_TREDE      MAVTKEQKASIVKKFGASEKDTGDVKVQIALLTEKINQLTNHCKDHPKDAGSRRGLISMVGHRRSLLKYY
RS15_SULNB      MALDQAKKAEIIAKYARGENDTGSTEVQVALLTERIKYLTDHLKTNKKDHSSRLGLLKLVGQRRRLMRYL
RS15_ARCB4      MALDQEVKAAIIAKYGKKDGDTGSSEVQIALLSEQIKILTEHLKVFKKDHSSRLGLLKMVGKRKRLLAYL
RS15_ANAMF      MSITPAKKSELISEYKVKDGDTGSAYVQCAILSERIRNLTEHLKVHKKDFHCRRGLMVLVCKRRKGLQYV
RS15_SYNPW      MSLDTTEKQELINAHQTHATDTGSAEVQVAMLTERISKLSSHLQQNIHDFSSRQGLLKMIGRRKRLLGYV
RS15_ANASP      MALTQQRKQEIINNYQVHGTDTGSTDVQIAMLTERINRLSEHLQANKKDHSSRRGLLKLIGHRKRLLAYL
RS15_ANAMM      MSITPAKKSELISEYKVKDGDTGSAYVQCAILSERIRNLTEHLKIHKKDFHCRRGLMVLVCKRRKGLQYV
RS15_STRSY      MAISKEKKNEIMAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_STRS2      MAISKEKKNEIMAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGRRRNLLAYL
RS15_LACS1      MAISQEKKNEIMKKYARHEGDTGSAEVQIAVLTADINELNDHIKAHKKDYASYRGLMKKIGHRRNLLAYL
RS15_BORA1      MSVADIKKAEIVSQFQRAQGDTGSPEVQVALLTARINELTGHFKEHAKDHHXXXXXXXXXXXXXKLLDYL
RS15_VIBPA      MSLNAETKAAIVAEYAQSEGDTGSPEVQVALLTASINHLQGHFKAHKGDHHXXXXXXXXXXXXXKLLDYL
RS15_SALRD      --ITQEEQQKIIDRFGNGPNDTGTPEVQIAIFTKRIEHLTEHLEDHPNDNSTRQGLLDLVGKRRRLLNYL
RS15_NOSP7      MALTQLRKQEIISNYQVHETDTGSADVQVAMLTERINRLSEHLQANKKDHSSRRGLLKLIGQRKRLLAYI
RS15_NITOC      MSLSSERKVQVIKEHQCSVNDTGSPEVQVALLSERITQLSGHFKQHTHDHHSRQGLLRAVGQXXXXXXXX
RS15_NITEC      MAVTTDQKSQVILDYQRVAGDTGSPEVQVAILTTRINSLIDHFKEHVKDHHXXXXXXXXXXXXXKLLDYL
RS15_MYCCT      --ISKEQKLALIKEFGGSEKNTGLAEVQIAILTAEISNMTEHLKMHKKDIPTRRSLLKKVAQRRHFLDYL
RS15_LACF3      MAISKEKKNEIIKQFATHEGDTGSTQVQVAVLTADINELNEHLREHKHDYHSQRGLMKKIGHRRNLLAYL
RS15_BORT9      --ISKEQKQKIITEFGKNPNDTGSVEVQIALITDRIRYLTEHLRSNKKDHSSKRGLLKLVGQRRNLLRYY
RS15_RALPJ      MSVADIKKQDIVKDNGRSANDTGSPEVQVALLTARINELQPHFKAHMKDHHSXXXXXXXXXXXXXXXDYL
RS15_PARUW      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTERITELTEHLKRAPKDHGSRLALLKLVGQRRRLLDYL
RS15_NAUPA      MALDSAKKREIIAKFGNDEKDTGSPAVQIALLTERINEINEHLQQHKHDHSSRLGLLKLVGQRKRLMRYL
RS15_CHRVO      MAMTAAQKAEIVKGFQRAEGDTGSSEVQIALLTARINDLTPHFKANTKDHHSXXXXXXXXXXXXXXXDYL
RS15_BORGA      --IDKKQKQKIVSEFGKNESDTGSVGVQIALITGRIKYLTEHLKTNKKDHSSKRGLLKLVGQRRSLLRYY
RS15_RALEH      MAVADINKSEVIKQFARGANDTGSPEVQVALLTTRINELTPHFKANMKDHHSXXXXXXXXXXXXXXXDYL
RS15_CUPTR      MAVADINKSEVIKQFARGANDTGSPEVQVALLTTRINELTPHFKANMKDHHSXXXXXXXXXXXXXXXDYL
RS15_CORK4      MALSAAKKKEILSEFGLHETDTGSTEAQVALLTERIRQLTEHLREHKHDHHSRRGLMLLVGRRKRLLKYL
RS15_BORPE      MSVADIKKSEIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKEHMKDHHXXXXXXXXXXXXXKLLDYL
RS15_BORPD      MSVADIKKADIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKEHMKDHHXXXXXXXXXXXXXKLLDYL
RS15_BORPA      MSVADIKKSEIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKEHMKDHHXXXXXXXXXXXXXKLLDYL
RS15_BORBR      MSVADIKKSEIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKEHMKDHHXXXXXXXXXXXXXKLLDYL
RS15_VIBVY      MSLNAETKAAIVADYARGEGDTGSPEVQVALLTASINHLQGHFQAHKGDHHXXXXXXXXXXXXXKLLDYL
RS15_VIBVU      MSLNAETKAAIVADYARGEGDTGSPEVQVALLTASINHLQGHFQAHKGDHHXXXXXXXXXXXXXKLLDYL
RS15_SYNPX      MSLDTTEKQQLINTHQTHGTDTGSAEVQVAMLSERISRLSSHLQNNIHDFSSRQGLLKMIGRRKRLLSYM
RS15_SULDN      MALDSAKKQEIVTKFGRGENDTGSSEVQIALLTKRISDLTEHLKVFKKDHASRLGLLKLVGQRRRLMRYF
RS15_PELLD      MTLSKEHKAAVITQFGGNDKNTGKTEVQVALFSRRITELTGHLQQHPKDKHSRRGLLMIVGKRKKALKYL
RS15_MYCA9      MSLTTEQKKEILAQYGLHETDTGSPEAQVAMLTKRIVDLTEHLKTHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_CHLT3      MSITKEKKTELITRYGGAATNTGLPEVEIAIMTERINNLTEHLKVHKKDNHTRSXXXXXXXXXXXXXNYL
RS15_SYNS9      MSLDTTEKQQLINTHQTHGTDTGSAEVQVAMLSERINRLSGHLQNNIHDFSSRQGLLKMIGRRKRLLNYM
RS15_RUBXD      -----ENKEETIREFRTHEGDTGSPEVQVAILTRRIAHLTEHLREHKHDYHSRRGLLKMVGXXXXXXXXX
RS15_HALOH      --LTKEEKKAIIEEYQLEEGDTGSPEVQVALLTARIKNLTEHLKEHKHDYHSRRGLLKMVGXXXXXXXXX
RS15_ELUMP      MVLSVNDRKEIMGKFQASAADTGSPAVQVALITERIKYLSGHLKANPKDFAGERGLTKLVGQRKRLLSYL
RS15_AKKM8      --------------------DSGSSSYQIARLTQRIAHLTEHLSTNKHDVSSRRGLLKMVALRRKLLDYV
RS15_RALEJ      MAVADINKSEVIKQFARGTNDTGSPEVQVALLTTRINELTPHFKANMKDHHSXXXXXXXXXXXXXXXDYL
RS15_MYCPE      MAISQELKASLVKKYGGNSNNTGKVEVQIAILSAEIESLTKHIVANKKDQISKRGLFQKVSKRRSLLSYL
RS15_BORBZ      --IDKKQKQKIVSEFGKNESDTGSVGVQIALITGRIKYLTEHLKINKKDHSSKRGLLKLVGQRRSLLRYY
RS15_BORBU      --IDKKQKQKIVSEFGKNESDTGSVGVQIALITGRIKYLTEHLKINKKDHSSKRGLLKLVGQRRSLLRYY
RS15_SALTO      MALDQQAKAKIRAEYATVEGDTGSPEVQVAVLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXXNYV
RS15_OENOB      MALTQEAKNQIIKEYARHNGDTGSVEVQVAVLTADINELNNHMSENKHDFSSQRGLMKKIGHRRNLLRYL
RS15_WOLTR      MSITSEKKKNLINTYAIKEDDTGSSFVQCAILTERISNLTEHFKVHKHDHHSKXXXXXXXXXXXKHLNYI
RS15_PROMT      MSLGTEEKQNLINTHQVHPTDTGSAEVQVAMLTTRISKLSTHLQGNIHDFSSRQGLLKMIGQRKRLLGYV
RS15_MYCMS      --VSKEQKLALIKEFGGDEKNTGLAEVQIAILTAEISNLTEHLKMHKKDIPTRRTLLKKVAQRRHFLDYL
RS15_LEPIN      --IATEQKKQIISNFARKAGDTGSTEVQIALIDARIKELNEHFKTHKKDFHSXXXXXXXXXXXXXXXDYL
RS15_LEPIC      --IATEQKKQIISNFARKAGDTGSTEVQIALIDARIKELNEHFKTHKKDFHSXXXXXXXXXXXXXXXDYL
RS15_RHOBA      MTISKERKEEVISEHGAAAGDTGSPEVQIAILTERINGLTEHMRTHRKDYAXXXXXXXXXXXXXXXXDYV
RS15_PROM4      MTLNTQEKQKLINTHQNHGTDTGSAEVQVAMLSERISKLSNHLQKNIHDFSSRQGLLKMIGQRKRLLNYL
RS15_PROM1      MSLGTEEKQNLINTHQVHPTDTGSVEVQVAMLTTRISKLSTHLQGNIHDFSSRQGLLKMIGQRKRLLGYV
RS15_PETMO      --------------------DTGSVEVQVALLSARIKHLTEHLKQHPKDYHSRRGLMMMVGKRRKMLKYL
RS15_CHLAB      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_SYNSC      MSLDTTEKQQLINTHQTHGTDTGSAEVQVAMLSERINRLSRHLQNNIHDFSSRQGLLKMIGRRKRLLSYM
RS15_SYNJA      MALLQQEKQEIIETYRLHDTDTGSAEVQVALLTSRINQLSQHLQKNPKDFNSRRGLMMMIGRRKRLLNYI
RS15_SALAI      MALDQQAKAKIRAEYATVEGDTGSPEVQVAVLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXXNYV
RS15_PROMP      MTLDTAEKQKLIESHQVHATDTGSVEVQVAMLSERISKLSDHLQGNIHDYASRQGLLKMIGKRKRLLSYI
RS15_PROM5      MTLDTAEKQKLIESHQVHPTDTGSVEIQVAMISERITKLSEHLQGNIHDYASRQGLLKMIGKRKRLLSYI
RS15_CHLTR      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLTB      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLTA      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLT2      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLPN      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHIAELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLMU      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLFF      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKQHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_CHLCV      MSLDKGTKEEITKKFQLHEKDTGSADVQIAILTEHITELKEHLKRSPKDQNSRLALLKLVGQRRKLLEYL
RS15_PROVI      MSLSKEFKEEIITKFGGTDKNTGKAEVQVALFSNRISDLTGHLQKHPKDKHSRRGLLMLVSKRKKALKYL
RS15_CAMHC      MALDTAQKAQIVAKFARKEKDTGSSEVQIALLSARIDSITEHMQNNPKDFSSRLGLLKLVGQRKRLMKYL
RS15_BACFR      MYLDAAKKQEIFSKYGKSNTDTGSAEAQIALFSYRITHLTEHMKLNRKDYSTERALTMLVGKRRALLDYL
RS15_BACFN      MYLDAAKKQEIFSKYGKSNTDTGSAEAQIALFSYRITHLTEHMKLNRKDYSTERALTMLVGKRRALLDYL
RS15_THEFY      MPIDTATKQKIIAEYATKEGDTGSPEVQVALLTHRINQLTEHLKEHKHDHHSXXXXXXXXXXXXXXXQYV
RS15_SYNJB      MALLQQEKQQIIESYRLHDTDTGSAEVQVALLTSRINQLSQHLQRNPKDFNSRRGLLMMIGRRKRLLNYI
RS15_PROM9      MSLDTAEKQKLIETHQVHATDTGSVEVQVAMLSKRISKLSEHLQGNIHDFASRQGLLKMIGKRKRLLSYI
RS15_LEGPA      MSLNSAEKAEIINEYKRGDKDTGSPEVQVSLITGRIKYLTDHFKENKKDFHSRRGLQELVNXXXXXXXXX
RS15_HAES2      MSLSTEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQAHFSTHKKDHHXXXXXXXXXXXXXKLLDYL
RS15_HAES1      MSLSTEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQAHFSTHKKDHHXXXXXXXXXXXXXKLLDYL
RS15_RHOOB      MALTTEEKKQVLSEYGLHETDTGSPEAQVAMLTKRIVDLTEHLKMHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_PROM2      MSLDTAEKQKLIETHQVHPTDTGSAEVQVAMLSKRISKLSDHLQGNIHDFSSRQGLLKMIGKRKRLLSYI
RS15_MYCFL      --ITKAKKAEIITRFGKSEKNTGDISVQIALLPEDIEKLKLHFEKNKKDKHSMRGFIAKVNKRKKLLNYL
RS15_PORGI      MYLDSAKKAELFEKYGKSVKDTGSPESQIALFTFRIAHLTEHLRQNKKDFATERSLKMLVGKRRRMLDYL
RS15_PORG3      MYLDSAKKAELFEKYGKSVKDTGSPESQIALFTFRIAHLTEHLRQNKKDFATERSLKMLVGKRRRMLDYL
RS15_MYCTU      MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_MYCTA      MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_MYCBT      MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_MYCBP      MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_MYCBO      MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_DESAH      MVLLAENKDEMIANFKLHDSDTGSPEVQVALLTHRISYLTEHVKVHKKDHHXXXXXXXXXXXXXXXXDYL
RR15_CHLAT      -------KKTLINNYAIHTSDTGSTQVQVALLTAKVIQLSQHLKNHNKDYASQRGLRKILGSRKQLLKYL
RS15_WOLWR      MSITSEKKKSLINIYAIKEDDTGSSFVQCAILTERISNLTEHFKVHKHDHHSKXXXXXXXXXXXKHLNYI
RS15_UNCTG      --MTFEKKTVVDQFKVH-ATDTGSSEVQIAILTTRIKYLSDHFKKFPKDFASRVGFLKMIGQRRQLLDYL
RS15_KINRD      MPLDAAVKKSIMAEYATSEGDTGSPEVQVAMLTQRIRDLTEHLKTHQHDHHSXXXXXXXXXXXXXXXKYM
RS15_DESPS      MAQSAVVKNEIIEKFKTHEGDTGSSEVQIALLTDRIQYLXXXXXXXXXXXXSRQGLLKLVGQRRSLLDYL
RS15_UREU1      MAVSKQQKHDLTVKFGGSASNTGKTEVQVAILSAEIDSLTTHMIENKKDKASKRGLYKKVAQRKKLLSYL
RS15_UREPA      MAVSKQQKHDLTVKFGGSASNTGKTEVQVAILSAEIDSLTTHMIENKKDKASKRGLYKKVAQRKKLLSYL
RS15_UREP2      MAVSKQQKHDLTVKFGGSASNTGKTEVQVAILSAEIDSLTTHMIENKKDKASKRGLYKKVAQRKKLLSYL
RS15_THELT      -----EEKKKIIEQFRINEKDTGSAEVQVAILTARIRHLTEHLKAHPKDFHSRRGLMKMVGXXXXXXXXX
RS15_PROM0      MSLDTAEKQKLIENHQVHPTDTGSAEVQVAMLSKRISKLSDHLQGNIHDFASRQGLLKMIGKRKRLLSYL
RS15_MYCMO      --VSNTKKLELIKSFGKNEKDSGSIEAQIAILTEDIESLKLHFEKNKKDLHSRRGFIAKINHRKKLLAYL
RS15_LEGPL      MSLNSAEKAEIINEYKRGDKDTGSPEVQVSLITSRIKYLTDHFKENKKDFHSRRGLQELVNXXXXXXXXX
RS15_LEGPH      MSLNSAEKAEIINEYKRGDKDTGSPEVQVSLITSRIKYLTDHFKENKKDFHSRRGLQELVNXXXXXXXXX
RS15_LEGPC      MSLNSAEKAEIINEYKRGDKDTGSPEVQVSLITSRIKYLTDHFKENKKDFHSRRGLQELVNXXXXXXXXX
RS15_BACV8      MYLDAAKKQEIFEKYGKSNTDTGSAEAQIALFSYRISHLTEHLKLNRKDYSTERALTTLVGKRRALLNYL
RS15_AZOPC      MYLNPEKKKEFFAKYGKSNTDSGSPEGQIALFSYRISHLTEHLKVNRKDYNTERSLKMLVGKRRRLLDYL
RS15_RICBR      MSITQERKQELIKNYAINDNDTGSSAVQCAILTERINNLTEHFKSNHKDHTSXXXXXXXXXXXXXXXNYI
RS15_RICB8      MSITQERKQELIKNYAINDNDTGSSAVQCAILTERINNLTEHFKSNHKDHTSXXXXXXXXXXXXXXXNYI
RS15_PROMS      MSLDTAEKQKLIENHQVHPTDTGSVEVQVAMLSKRISKLSDHLQGNIHDFASRQGLLKMIGKRKRLLSYL
RS15_MYCUA      MALTAEQKKEILNSYGLHETDTGSPEAQIALLTKRISDLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_MYCMM      MALTAEQKKEILNSYGLHETDTGSPEAQIALLTKRISDLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYI
RS15_FLAJ1      MYLTKEKKEEIFAQHGD-AKNTGKAEGQIALFTYRISHLTEHLKKNRHDYNTERSLVLLVGKRRALLDYL
RS15_DEIRA      -------KQQVISDNAAGANDTGSTAVQVALLTARINNLAGHLQTNKKDKAGQRGLQLMNGQRRRLLKYL
RS15_WOLPM      MSITSEKKKSLMNIYAIKEDDTGSSFVQCAILTERISNLTEHFKVHKHDHHSKXXXXXXXXXXXKHLNYI
RS15_RHOSR      MALTTEEKKQVLSEYGLHETDTGSPEAQVAMLTKRIVDLTEHLKMHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_RHOE4      MALTTEEKKVVLGEYGLHETDTGSPEAQVAMLTKRITDLTEHLKTHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_PHOPR      MSLNAETKAAIVAEYAQCENDTGSPEVQVALLTAQINHLQGHFANHKHDHHXXXXXXXXXXXXXKLLDYL
RS15_ORITB      MSITVERKKALISEYADLENNTGSVEVQCAILTERIINLTQHCKINFKDFHSKRGLLMLVXXXXXXXXXX
RS15_MYCVP      MALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIVDLTEHLKQHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_MYCS2      MALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHHSXXXXXXXXXXXXXXXKYV
RS15_MYCLE      MALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYL
RS15_MYCLB      MALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSXXXXXXXXXXXXXXIKYL
RS15_MYCAP      --ITKEQKAQIVAKYGANKKDTGNIFVQIAILTAEIEDLKPHFLANPKDNHSRRGFIAKITKRRILLQHL
RS15_BUCBP      MSENMNIKSKIITQFGVNSKDSGKSEVQIALLTNRINYLQNHFSLHKKDHCSRRGLLNMVSKRRKLLNYL
RS15_AYWBP      MALTKEQKQEIIKQNSHFAKDTGSSEVQIAILSAEIKQLSEHLKQHPHDFHSKRGLFMKNSKRRNLVKYL
RR15_ZYGCR      --------------------DSGSPEAQISFLTLRVLQISSHLKMHTKDYSSKRGLRKVLGTRKRLLSYL
RS15_BACTN      MYLDAAEKQEIFGKYGKSNSDTGSTEAQIALFSYRISHLTEHMKLNRKDYSTERALTMLVAKRRRLLNYL
RS15_RALME      -------KSEIIAKFARGTNDTGSPEVQVALLTTRINELTPHFKANMKDHHSXXXXXXXXXXXXXXXDYL
RS15_PSEFS      MALDVQEKAQIVADYQQAVGDTGSPEVQVALLTHNINKLQGHFKANGKDHHSRRGLIRMVNQXXXXXXXX
RS15_ORITI      MSITVERKKALISEYADLEKNTGSVEVQCAILTERIINLTQHCKINFKDFHSKRGLLMLVXXXXXXXXXX
RS15_ONYPE      MALTKEQKQEIIKQNSRFAKDTGSSEVQIAILSAEIKQLSEHLKQHPHDFHSKRGLFMKNSKRRDLVKYL
RS15_HAEDU      MS