[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37597.1

[Show Plain Result]


## Summary of Sequence Search
    1::426
   16::307     2e-61  49%  317 aa  RLUD_ZYMMO RecName: Full=Ribosomal large subunit pseudouridine
    4::295     2e-60  46%  303 aa  YLYB_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   33::318     1e-58  46%  327 aa  Y1629_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
   16::311     3e-54  46%  320 aa  RLUD_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   27::303     8e-51  46%  316 aa  Y901_CHLAA RecName: Full=Uncharacterized RNA pseudouridine synthase
   24::332     2e-50  44%  344 aa  RLUD_NITEU RecName: Full=Ribosomal large subunit pseudouridine
   17::305     4e-50  41%  316 aa  Y1758_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
    7::314     7e-50  42%  325 aa  RLUD_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   18::313     1e-49  43%  324 aa  RLUD_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   19::312     9e-49  42%  325 aa  RLUD_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
    7::314     2e-48  45%  326 aa  RLUD_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    7::314     2e-48  44%  326 aa  RLUD_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    7::314     2e-48  45%  326 aa  RLUD_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    7::314     2e-48  45%  326 aa  RLUD_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    7::314     5e-48  41%  326 aa  RLUD_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    7::314     5e-48  41%  326 aa  RLUD_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    4::318     2e-47  41%  331 aa  RLUD_XYLFA RecName: Full=Ribosomal large subunit pseudouridine
    7::318     4e-47  42%  331 aa  RLUD_XYLFT RecName: Full=Ribosomal large subunit pseudouridine
   15::318     7e-47  40%  331 aa  RLUD_XANAC RecName: Full=Ribosomal large subunit pseudouridine
   19::312     7e-47  47%  325 aa  RLUD_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   10::318     1e-46  43%  331 aa  RLUD_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   13::326     2e-46  39%  327 aa  Y723_CHLP8 RecName: Full=Uncharacterized RNA pseudouridine synthase
  130::349     6e-45  51%  358 aa  RLUD_RALSO RecName: Full=Ribosomal large subunit pseudouridine
    6::313     3e-44  42%  324 aa  RLUD_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
    7::312     5e-44  45%  325 aa  RLUD_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   58::417     2e-43  39%  445 aa  PUS2_ORYSJ RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   19::308     1e-42  39%  312 aa  RLUD_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   40::332     5e-42  42%  374 aa  RLUD_NEIMA RecName: Full=Ribosomal large subunit pseudouridine
   40::332     1e-41  42%  374 aa  RLUD_NEIMB RecName: Full=Ribosomal large subunit pseudouridine
   65::425     2e-41  36%  430 aa  PUS2_ARATH RecName: Full=RNA pseudourine synthase 2, chloroplastic;
   20::313     4e-40  39%  317 aa  RLUD_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   19::312     5e-40  37%  324 aa  RLUD_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
    7::318     5e-39  36%  321 aa  RLUD_BLOFL RecName: Full=Ribosomal large subunit pseudouridine
   97::296     3e-34  44%  302 aa  YHCT_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
   19::307     1e-33  36%  315 aa  RLUD_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   88::277     7e-33  43%  283 aa  YJBO_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
  108::298     4e-32  47%  308 aa  Y1567_MYCBO RecName: Full=Uncharacterized RNA pseudouridine
  108::298     4e-32  47%  308 aa  Y1540_MYCTU RecName: Full=Uncharacterized RNA pseudouridine
   98::261     4e-30  46%  326 aa  RLUD_BORBU RecName: Full=Ribosomal large subunit pseudouridine
   20::187     4e-26  42%  219 aa  Y505_ZYMMO RecName: Full=Uncharacterized RNA pseudouridine synthase
   11::310     5e-24  35%  319 aa  RLUC_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   11::310     1e-23  35%  319 aa  RLUC_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   12::285     1e-23  32%  309 aa  Y292_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
   11::310     2e-23  35%  319 aa  RLUC_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   11::310     4e-23  35%  319 aa  RLUC_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   11::310     4e-23  35%  319 aa  RLUC_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   17::319     5e-23  29%  326 aa  RLUC_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   11::310     5e-23  35%  319 aa  RLUC_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
  108::311     4e-21  35%  315 aa  RLUC_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   60::218     8e-21  40%  219 aa  RLUA_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
   60::218     8e-21  40%  219 aa  RLUA_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   60::218     8e-21  40%  219 aa  RLUA_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   99::298     1e-20  34%  327 aa  Y745_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   16::314     1e-20  28%  322 aa  RLUC_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   99::298     2e-20  34%  327 aa  Y745_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
  108::311     3e-20  35%  315 aa  RLUC_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
  109::307     7e-20  35%  315 aa  RLUC_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   60::218     9e-20  39%  219 aa  RLUA_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   16::318     1e-19  29%  320 aa  RLUC_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
   60::218     2e-19  39%  219 aa  RLUA_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   60::218     2e-19  39%  219 aa  RLUA_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   11::313     2e-19  33%  320 aa  RLUC_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   50::254     3e-18  39%  257 aa  TRUC_YERPE RecName: Full=tRNA pseudouridine synthase C;       
   61::215     1e-17  38%  219 aa  RLUA_PASMU RecName: Full=Ribosomal large subunit pseudouridine
  107::262     3e-17  36%  315 aa  RLUC_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
   59::211     3e-17  38%  250 aa  RLUA_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   59::204     3e-17  39%  245 aa  RLUA_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
  106::294     3e-17  35%  314 aa  RLUC_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   47::195     3e-17  41%  206 aa  RLUA_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   59::211     4e-17  38%  250 aa  RLUA_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   61::215     7e-17  37%  219 aa  RLUA_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   61::218     5e-16  38%  222 aa  RLUA_HAEDU RecName: Full=Ribosomal large subunit pseudouridine
  197::376     8e-16  37%  477 aa  PUS4_ARATH RecName: Full=RNA pseudourine synthase 4, mitochondrial;
   51::213     2e-15  34%  243 aa  TRUC_HAEDU RecName: Full=tRNA pseudouridine synthase C;       
  125::295     2e-15  37%  393 aa  PUS7_ORYSJ RecName: Full=RNA pseudourine synthase 7;       
  106::307     7e-15  32%  314 aa  RLUC_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   16::223     9e-15  32%  244 aa  TRUC_VIBCH RecName: Full=tRNA pseudouridine synthase C;       
   94::284     1e-14  33%  308 aa  Y209_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
  141::303     2e-14  39%  318 aa  RLUC_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
  164::329     3e-14  35%  376 aa  TRUC_PECCC RecName: Full=tRNA pseudouridine synthase C;       
   88::208     4e-14  38%  242 aa  Y956_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
   63::285     4e-14  38%  324 aa  RUSD4_XENTR RecName: Full=RNA pseudouridylate synthase
  103::259     4e-14  35%  303 aa  RLUC_RICCN RecName: Full=Ribosomal large subunit pseudouridine
  101::285     6e-14  38%  326 aa  Y548_MYCPN RecName: Full=Uncharacterized RNA pseudouridine synthase
  103::301     6e-14  32%  301 aa  RLUC_RICBR RecName: Full=Ribosomal large subunit pseudouridine
   88::208     8e-14  37%  242 aa  Y956_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
   20::227     1e-13  30%  246 aa  TRUC_VIBPA RecName: Full=tRNA pseudouridine synthase C;       
  119::313     1e-13  32%  394 aa  YA32_SCHPO RecName: Full=Uncharacterized protein C18B11.02c;
  135::259     1e-13  34%  305 aa  RLUC_RICFE RecName: Full=Ribosomal large subunit pseudouridine
  133::316     2e-13  33%  404 aa  PUS6_YEAST RecName: Full=Pseudouridylate synthase 6;       
  128::379     4e-13  33%  397 aa  PUS5_ORYSJ RecName: Full=RNA pseudourine synthase 5;       
   51::223     6e-13  33%  260 aa  TRUC_ECOL6 RecName: Full=tRNA pseudouridine synthase C;       
  162::314     8e-13  33%  432 aa  YK27_CAEEL RecName: Full=Uncharacterized protein K07E8.7;
  102::298     8e-13  34%  323 aa  Y370_MYCGE RecName: Full=Uncharacterized RNA pseudouridine synthase
   17::224     8e-13  32%  243 aa  TRUC_PASMU RecName: Full=tRNA pseudouridine synthase C;       
   16::230     8e-13  33%  239 aa  TRUC_HAEIN RecName: Full=tRNA pseudouridine synthase C;       
  135::295     8e-13  33%  303 aa  RLUC_RICPR RecName: Full=Ribosomal large subunit pseudouridine
  202::357     1e-12  31%  462 aa  YDL36_YEAST RecName: Full=Uncharacterized protein YDL036C;
   51::223     1e-12  33%  260 aa  TRUC_SHIFL RecName: Full=tRNA pseudouridine synthase C;       
   51::223     1e-12  33%  260 aa  TRUC_ECOLI RecName: Full=tRNA pseudouridine synthase C;       
   51::223     1e-12  33%  260 aa  TRUC_ECO57 RecName: Full=tRNA pseudouridine synthase C;       
   17::233     5e-12  35%  247 aa  PUS5_CANAL RecName: Full=Pseudouridylate synthase PUS5;       
  207::373     7e-12  36%  478 aa  PUS3_ARATH RecName: Full=RNA pseudourine synthase 3, mitochondrial;
  150::311     9e-12  34%  395 aa  PUS7_ARATH RecName: Full=RNA pseudourine synthase 7;       
   56::320     9e-12  30%  369 aa  PUS5_ARATH RecName: Full=RNA pseudourine synthase 5;       
   16::217     2e-11  31%  245 aa  TRUC_VIBVU RecName: Full=tRNA pseudouridine synthase C;       
   64::194     2e-11  38%  308 aa  RUSD1_BOVIN RecName: Full=RNA pseudouridylate synthase
   83::240     4e-11  31%  298 aa  Y347_HELPY RecName: Full=Uncharacterized RNA pseudouridine synthase
  135::295     4e-11  32%  303 aa  RLUC_RICTY RecName: Full=Ribosomal large subunit pseudouridine
  175::348     4e-11  33%  591 aa  RIB2_YEAST RecName: Full=DRAP deaminase;
  237::389     5e-11  33%  545 aa  RUSD2_HUMAN RecName: Full=RNA pseudouridylate synthase
   47::167     6e-11  32%  224 aa  Y042_HAEIN RecName: Full=Uncharacterized RNA pseudouridine synthase
   51::223     6e-11  32%  260 aa  TRUC_SALTI RecName: Full=tRNA pseudouridine synthase C;       
  111::329     6e-11  40%  377 aa  RUSD4_RAT RecName: Full=RNA pseudouridylate synthase
   51::223     8e-11  31%  260 aa  TRUC_SALTY RecName: Full=tRNA pseudouridine synthase C;       
  250::402     8e-11  33%  553 aa  RUSD2_MOUSE RecName: Full=RNA pseudouridylate synthase
   83::240     1e-10  30%  293 aa  Y347_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
  203::276     2e-10  42%  291 aa  Y1592_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine
  218::371     2e-10  35%  475 aa  PUS3_ORYSJ RecName: Full=RNA pseudourine synthase 3, mitochondrial;
   64::194     3e-10  36%  306 aa  RUSD1_MOUSE RecName: Full=RNA pseudouridylate synthase
   64::194     4e-10  36%  312 aa  RUSD1_HUMAN RecName: Full=RNA pseudouridylate synthase
  115::316     5e-10  33%  322 aa  PUS1_ARATH RecName: Full=RNA pseudourine synthase 1;       
  119::297     1e-09  36%  358 aa  RUSD4_DANRE RecName: Full=RNA pseudouridylate synthase
   64::211     1e-09  34%  293 aa  RUSD1_DANRE RecName: Full=RNA pseudouridylate synthase
  129::335     2e-09  36%  345 aa  PUS1_ORYSJ RecName: Full=RNA pseudourine synthase 1;       
  111::329     3e-09  37%  377 aa  RUSD4_MOUSE RecName: Full=RNA pseudouridylate synthase
  111::289     4e-09  38%  377 aa  RUSD4_HUMAN RecName: Full=RNA pseudouridylate synthase
   67::228     3e-08  33%  254 aa  PUS5_YEAST RecName: Full=Pseudouridylate synthase PUS5;       
   64::170     4e-08  43%  260 aa  PUS5_ASHGO RecName: Full=Pseudouridylate synthase PUS5;       
  190::345     1e-07  32%  448 aa  PUS4_ORYSJ RecName: Full=RNA pseudourine synthase 4, mitochondrial;
  111::289     3e-07  37%  377 aa  RUSD4_BOVIN RecName: Full=RNA pseudouridylate synthase
 7081::7173    5e-07  36% 10061 aa  MLRR1_PLAF7 RecName: Full=MATH and LRR domain-containing protein
   77::192     2e-04  41%  221 aa  RLUE_SALTI RecName: Full=Ribosomal large subunit pseudouridine
  372::399     2e-04  61%  472 aa  PUS6_ARATH RecName: Full=RNA pseudourine synthase 6, chloroplastic;
   88::267     3e-04  27%  344 aa  RUSD3_MOUSE RecName: Full=RNA pseudouridylate synthase
   87::266     3e-04  26%  343 aa  RUSD3_HUMAN RecName: Full=RNA pseudouridylate synthase
  369::394     3e-04  62%  477 aa  PUS6_ORYSJ RecName: Full=RNA pseudourine synthase 6, chloroplastic;
   88::267     7e-04  25%  344 aa  RUSD3_BOVIN RecName: Full=RNA pseudouridylate synthase
    1::426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RLUD_ZYMMO      ----------------------------------------------------------------------
YLYB_BACSU      ----------------------------------------------------------------------
Y1629_SYNY3     ----------------------------------------------------------------------
RLUD_PSEAE      ----------------------------------------------------------------------
Y901_CHLAA      ----------------------------------------------------------------------
RLUD_NITEU      ----------------------------------------------------------------------
Y1758_AQUAE     ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_PASMU      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
RLUD_SHIFL      ----------------------------------------------------------------------
RLUD_ECOLI      ----------------------------------------------------------------------
RLUD_ECOL6      ----------------------------------------------------------------------
RLUD_ECO57      ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_XYLFA      ----------------------------------------------------------------------
RLUD_XYLFT      ----------------------------------------------------------------------
RLUD_XANAC      ----------------------------------------------------------------------
RLUD_VIBPA      ----------------------------------------------------------------------
RLUD_XANCP      ----------------------------------------------------------------------
Y723_CHLP8      ----------------------------------------------------------------------
RLUD_RALSO      ----------------------------------------------------------------------
RLUD_HAEIN      ----------------------------------------------------------------------
RLUD_HAEDU      ----------------------------------------------------------------------
PUS2_ORYSJ      ----------------------------------------------------------------------
RLUD_BUCAI      ----------------------------------------------------------------------
RLUD_NEIMA      ----------------------------------------------------------------------
RLUD_NEIMB      ----------------------------------------------------------------------
PUS2_ARATH      ----------------------------------------------------------------------
RLUD_BUCBP      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RLUD_BLOFL      ----------------------------------------------------------------------
YHCT_BACSU      ----------------------------------------------------------------------
RLUD_BUCAP      ----------------------------------------------------------------------
YJBO_BACSU      ----------------------------------------------------------------------
Y1567_MYCBO     ----------------------------------------------------------------------
Y1540_MYCTU     ----------------------------------------------------------------------
RLUD_BORBU      ----------------------------------------------------------------------
Y505_ZYMMO      ----------------------------------------------------------------------
RLUC_SALTI      ----------------------------------------------------------------------
RLUC_SALTY      ----------------------------------------------------------------------
Y292_MYCPN      ----------------------------------------------------------------------
RLUC_ECOL6      ----------------------------------------------------------------------
RLUC_SHIFL      ----------------------------------------------------------------------
RLUC_ECOLI      ----------------------------------------------------------------------
RLUC_PASMU      ----------------------------------------------------------------------
RLUC_ECO57      ----------------------------------------------------------------------
RLUC_VIBPA      ----------------------------------------------------------------------
RLUA_SHIFL      ----------------------------------------------------------------------
RLUA_ECOLI      ----------------------------------------------------------------------
RLUA_ECOL6      ----------------------------------------------------------------------
Y745_HELPJ      ----------------------------------------------------------------------
RLUC_HAEIN      ----------------------------------------------------------------------
Y745_HELPY      ----------------------------------------------------------------------
RLUC_VIBVU      ----------------------------------------------------------------------
RLUC_VIBCH      ----------------------------------------------------------------------
RLUA_SALTI      ----------------------------------------------------------------------
RLUC_HAEDU      ----------------------------------------------------------------------
RLUA_SALTY      ----------------------------------------------------------------------
RLUA_ECO57      ----------------------------------------------------------------------
RLUC_YERPE      ----------------------------------------------------------------------
TRUC_YERPE      ----------------------------------------------------------------------
RLUA_PASMU      ----------------------------------------------------------------------
RLUC_BUCBP      ----------------------------------------------------------------------
RLUA_VIBVU      ----------------------------------------------------------------------
RLUA_VIBCH      ----------------------------------------------------------------------
RLUC_BUCAP      ----------------------------------------------------------------------
RLUA_YERPE      ----------------------------------------------------------------------
RLUA_VIBPA      ----------------------------------------------------------------------
RLUA_HAEIN      ----------------------------------------------------------------------
RLUA_HAEDU      ----------------------------------------------------------------------
PUS4_ARATH      ----------------------------------------------------------------------
TRUC_HAEDU      ----------------------------------------------------------------------
PUS7_ORYSJ      ----------------------------------------------------------------------
RLUC_BUCAI      ----------------------------------------------------------------------
TRUC_VIBCH      ----------------------------------------------------------------------
Y209_MYCGE      ----------------------------------------------------------------------
RLUC_PSEAE      ----------------------------------------------------------------------
TRUC_PECCC      ----------------------------------------------------------------------
Y956_HELPJ      ----------------------------------------------------------------------
RUSD4_XENTR     ----------------------------------------------------------------------
RLUC_RICCN      ----------------------------------------------------------------------
Y548_MYCPN      ----------------------------------------------------------------------
RLUC_RICBR      ----------------------------------------------------------------------
Y956_HELPY      ----------------------------------------------------------------------
TRUC_VIBPA      ----------------------------------------------------------------------
YA32_SCHPO      ----------------------------------------------------------------------
RLUC_RICFE      ----------------------------------------------------------------------
PUS6_YEAST      ----------------------------------------------------------------------
PUS5_ORYSJ      ----------------------------------------------------------------------
TRUC_ECOL6      ----------------------------------------------------------------------
YK27_CAEEL      ----------------------------------------------------------------------
Y370_MYCGE      ----------------------------------------------------------------------
TRUC_PASMU      ----------------------------------------------------------------------
TRUC_HAEIN      ----------------------------------------------------------------------
RLUC_RICPR      ----------------------------------------------------------------------
YDL36_YEAST     ----------------------------------------------------------------------
TRUC_SHIFL      ----------------------------------------------------------------------
TRUC_ECOLI      ----------------------------------------------------------------------
TRUC_ECO57      ----------------------------------------------------------------------
PUS5_CANAL      ----------------------------------------------------------------------
PUS3_ARATH      ----------------------------------------------------------------------
PUS7_ARATH      ----------------------------------------------------------------------
PUS5_ARATH      ----------------------------------------------------------------------
TRUC_VIBVU      ----------------------------------------------------------------------
RUSD1_BOVIN     ----------------------------------------------------------------------
Y347_HELPY      ----------------------------------------------------------------------
RLUC_RICTY      ----------------------------------------------------------------------
RIB2_YEAST      ----------------------------------------------------------------------
RUSD2_HUMAN     ----------------------------------------------------------------------
Y042_HAEIN      ----------------------------------------------------------------------
TRUC_SALTI      ----------------------------------------------------------------------
RUSD4_RAT       ----------------------------------------------------------------------
TRUC_SALTY      ----------------------------------------------------------------------
RUSD2_MOUSE     ----------------------------------------------------------------------
Y347_HELPJ      ----------------------------------------------------------------------
Y1592_SYNY3     ----------------------------------------------------------------------
PUS3_ORYSJ      ----------------------------------------------------------------------
RUSD1_MOUSE     ----------------------------------------------------------------------
RUSD1_HUMAN     ----------------------------------------------------------------------
PUS1_ARATH      ----------------------------------------------------------------------
RUSD4_DANRE     ----------------------------------------------------------------------
RUSD1_DANRE     ----------------------------------------------------------------------
PUS1_ORYSJ      ----------------------------------------------------------------------
RUSD4_MOUSE     ----------------------------------------------------------------------
RUSD4_HUMAN     ----------------------------------------------------------------------
PUS5_YEAST      ----------------------------------------------------------------------
PUS5_ASHGO      ----------------------------------------------------------------------
PUS4_ORYSJ      ----------------------------------------------------------------------
RUSD4_BOVIN     ----------------------------------------------------------------------
MLRR1_PLAF7     ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
PUS6_ARATH      ----------------------------------------------------------------------
RUSD3_MOUSE     ----------------------------------------------------------------------
RUSD3_HUMAN     ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
RUSD3_BOVIN     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxGSIVNDSSGHLLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
RLUD_ZYMMO      ------------------------------------------RLDRALASLITRLSRERLKNLISSGCVS
YLYB_BACSU      ------------------------------IDITASEEQKSERIDKFLASTENDWSRTQVQQWVKDGQVV
Y1629_SYNY3     ------------------------------------------RLDKWLAEQLPELSRSRCQKLIESGQVQ
RLUD_PSEAE      ---------------------------------------GGQRLDQIAAQLFPEHSRSRLAGWIKDGRLT
Y901_CHLAA      ------------------------------------------RIDRFLAGAMPDLSRAQVQRLIEQGFVL
RLUD_NITEU      -------------------GSQENENT---IELTVPDNLAGLRLDQALAQLLPQWSRSRLQGWIEQKCVS
Y1758_AQUAE     ------------------------------------------RLDKFLARAYPDFSRSYIKKLVKEGLVY
RLUD_YERPE      ------------------------------LSATVAESQLGQRLDQALAELFPDYSRSRIKEWILDSRVT
RLUD_PASMU      ------------------------------------------RLDQALAELFPDYSRSRLKTWIEQNLVH
RLUD_VIBVU      ------------------------------------------RLDQAIAELFADFSRSRLKEWLLDGKVT
RLUD_SHIFL      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVL
RLUD_ECOLI      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVL
RLUD_ECOL6      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVL
RLUD_ECO57      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVL
RLUD_SALTY      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRVL
RLUD_SALTI      ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRVL
RLUD_XYLFA      --------------------SMSDDLAGFSRQTTVPDGAAGRRFDAVLAELFPEFSRSRLTEWIKSGDVL
RLUD_XYLFT      -----------------------DDLAGFSRQTTVPDGAAGRRFDAVLAELFPEFSRSRLTEWIKSGDVL
RLUD_XANAC      -------------------------------QAIVPDNAAGRRFDAVLAELFPEFSRSRLSEWIKSGDAL
RLUD_VIBPA      ------------------------------------------RLDQAIAELFADFSRSRLKEWLLDGKVQ
RLUD_XANCP      ------------------------DSS--LRQAVVPDSAAGRRFDAVLAELFPEFSRSRLSEWIKSGDAL
Y723_CHLP8      ------------------------------------------RIDRYLTQQVENMTRNKVQAAIEEGRVL
RLUD_RALSO      ----------------------------------------------------------------------
RLUD_HAEIN      ------------------------------LSAEVQPEQMGQRLDQTLAELFPEYSRSRLKTWIEADLVK
RLUD_HAEDU      ------------------------------LTAEISADLLGYRLDQALAQLFPDYSRSRIKVWIENDLVK
PUS2_ORYSJ      ---------------------------GTRLEEAVPAGEGRSRIDAWISARLGGVSRARIQASIRAGLVV
RLUD_BUCAI      ------------------------------------------RLDLVLSKLFREYSRSYLKKLIIMNQVL
RLUD_NEIMA      ------------------------------------------RLDAVLAKLLPDYSRSRLTLWIKEGAVI
RLUD_NEIMB      ------------------------------------------RLDAVLAKLLPDYSRSRLTSWIKEGAVI
PUS2_ARATH      ------------------------NNAGLRIEEIVDAAKGKIRLDSWISSRINGVSRARVQSSIRLGLVT
RLUD_BUCBP      ------------------------------------------RLDQVLASLFKKHSRTILKRHILSKDVC
RLUD_VIBCH      ------------------------------------------RLDQAVAELFTDFSRSRLKEWLLEGKIA
RLUD_BLOFL      --------------------------------MIVQVHQSGYRLDYILSKLLPQYSRSQIKHWILNKKVV
YHCT_BACSU      ----------------------------------------------------------------------
RLUD_BUCAP      ------------------------------------------RLDQILSKLFMQYSRSCLKKWIIMNNVY
YJBO_BACSU      ----------------------------------------------------------------------
Y1567_MYCBO     ----------------------------------------------------------------------
Y1540_MYCTU     ----------------------------------------------------------------------
RLUD_BORBU      ----------------------------------------------------------------------
Y505_ZYMMO      ----------------------------------------------------------------------
RLUC_SALTI      --------------------------------VAIAADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
RLUC_SALTY      --------------------------------VAIAADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
Y292_MYCPN      ------------------------------------------RLDTFLATLLN-LSRVKVAKLIVDGLVS
RLUC_ECOL6      --------------------------------VAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
RLUC_SHIFL      --------------------------------VAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
RLUC_ECOLI      --------------------------------VAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
RLUC_PASMU      --------------------------------LTISEDEAGQRIDNYLLAKLKGVPKSLIYRILRKGEVR
RLUC_ECO57      --------------------------------VAITADEAGQRIDNFLRTQLKGVPKSMIYRILRKGEVR
RLUC_VIBPA      ----------------------------------------------------------------------
RLUA_SHIFL      ----------------------------------------------------------------------
RLUA_ECOLI      ----------------------------------------------------------------------
RLUA_ECOL6      ----------------------------------------------------------------------
Y745_HELPJ      ----------------------------------------------------------------------
RLUC_HAEIN      --------------------------------LTISEDESGQRIDNYLLAKLKGVPKSLIYRIVRKGEVR
Y745_HELPY      ----------------------------------------------------------------------
RLUC_VIBVU      ----------------------------------------------------------------------
RLUC_VIBCH      ----------------------------------------------------------------------
RLUA_SALTI      ----------------------------------------------------------------------
RLUC_HAEDU      ----------------------------------ISDDEAGQRLDNFLLAKLKGVPKSLIYRIVRKGEVR
RLUA_SALTY      ----------------------------------------------------------------------
RLUA_ECO57      ----------------------------------------------------------------------
RLUC_YERPE      --------------------------------ITISADEAGQRIDNFLLAKLKGVPKSMIYRIVRKGEVR
TRUC_YERPE      ----------------------------------------------------------------------
RLUA_PASMU      ----------------------------------------------------------------------
RLUC_BUCBP      ----------------------------------------------------------------------
RLUA_VIBVU      ----------------------------------------------------------------------
RLUA_VIBCH      ----------------------------------------------------------------------
RLUC_BUCAP      ----------------------------------------------------------------------
RLUA_YERPE      ----------------------------------------------------------------------
RLUA_VIBPA      ----------------------------------------------------------------------
RLUA_HAEIN      ----------------------------------------------------------------------
RLUA_HAEDU      ----------------------------------------------------------------------
PUS4_ARATH      ----------------------------------------------------------------------
TRUC_HAEDU      ----------------------------------------------------------------------
PUS7_ORYSJ      ----------------------------------------------------------------------
RLUC_BUCAI      ----------------------------------------------------------------------
TRUC_VIBCH      ----------------------------------------------------------------------
Y209_MYCGE      ----------------------------------------------------------------------
RLUC_PSEAE      ----------------------------------------------------------------------
TRUC_PECCC      ----------------------------------------------------------------------
Y956_HELPJ      ----------------------------------------------------------------------
RUSD4_XENTR     ----------------------------------------------------------------------
RLUC_RICCN      ----------------------------------------------------------------------
Y548_MYCPN      ----------------------------------------------------------------------
RLUC_RICBR      ----------------------------------------------------------------------
Y956_HELPY      ----------------------------------------------------------------------
TRUC_VIBPA      ----------------------------------------------------------------------
YA32_SCHPO      ----------------------------------------------------------------------
RLUC_RICFE      ----------------------------------------------------------------------
PUS6_YEAST      ----------------------------------------------------------------------
PUS5_ORYSJ      ----------------------------------------------------------------------
TRUC_ECOL6      ----------------------------------------------------------------------
YK27_CAEEL      ----------------------------------------------------------------------
Y370_MYCGE      ----------------------------------------------------------------------
TRUC_PASMU      ----------------------------------------------------------------------
TRUC_HAEIN      ----------------------------------------------------------------------
RLUC_RICPR      ----------------------------------------------------------------------
YDL36_YEAST     ----------------------------------------------------------------------
TRUC_SHIFL      ----------------------------------------------------------------------
TRUC_ECOLI      ----------------------------------------------------------------------
TRUC_ECO57      ----------------------------------------------------------------------
PUS5_CANAL      ----------------------------------------------------------------------
PUS3_ARATH      ----------------------------------------------------------------------
PUS7_ARATH      ----------------------------------------------------------------------
PUS5_ARATH      ---------------------------------------------------------------IQNGQIQ
TRUC_VIBVU      ----------------------------------------------------------------------
RUSD1_BOVIN     ----------------------------------------------------------------------
Y347_HELPY      ----------------------------------------------------------------------
RLUC_RICTY      ----------------------------------------------------------------------
RIB2_YEAST      ----------------------------------------------------------------------
RUSD2_HUMAN     ----------------------------------------------------------------------
Y042_HAEIN      ----------------------------------------------------------------------
TRUC_SALTI      ----------------------------------------------------------------------
RUSD4_RAT       ----------------------------------------------------------------------
TRUC_SALTY      ----------------------------------------------------------------------
RUSD2_MOUSE     ----------------------------------------------------------------------
Y347_HELPJ      ----------------------------------------------------------------------
Y1592_SYNY3     ----------------------------------------------------------------------
PUS3_ORYSJ      ----------------------------------------------------------------------
RUSD1_MOUSE     ----------------------------------------------------------------------
RUSD1_HUMAN     ----------------------------------------------------------------------
PUS1_ARATH      ----------------------------------------------------------------------
RUSD4_DANRE     ----------------------------------------------------------------------
RUSD1_DANRE     ----------------------------------------------------------------------
PUS1_ORYSJ      ----------------------------------------------------------------------
RUSD4_MOUSE     ----------------------------------------------------------------------
RUSD4_HUMAN     ----------------------------------------------------------------------
PUS5_YEAST      ----------------------------------------------------------------------
PUS5_ASHGO      ----------------------------------------------------------------------
PUS4_ORYSJ      ----------------------------------------------------------------------
RUSD4_BOVIN     ----------------------------------------------------------------------
MLRR1_PLAF7     ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
PUS6_ARATH      ----------------------------------------------------------------------
RUSD3_MOUSE     ----------------------------------------------------------------------
RUSD3_HUMAN     ----------------------------------------------------------------------
PUS6_ORYSJ      ----------------------------------------------------------------------
RUSD3_BOVIN     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRGAPVRDPAYHAASGETITIDXXXXXXXXXXXXXXXLXXXXXXXXXXXXXKPRGLVVHPAAGHETGTLV
RLUD_ZYMMO      SQGALVRDPAFKIKSLDCFTVDIPLPRPAHNEPQDIPLEIVFEDEHLLVVNKPAGMVVHPAAGNYDNTLV
YLYB_BACSU      VNGSAVK-ANYKIQPGDQVTVTVPEPEALDVLAEPMDLDIYYEDQDVLVVNKPRGMVVHPAPGHLTGTLV
Y1629_SYNY3     RNGLVCQDKNLILKTGDRLVVNIPELIPLDVVAQNIPLDILYEDEQLIIINKPAGLVVHPGPGHPDGTVV
RLUD_PSEAE      VDGAVLR-PRDIVHSGAQLVLEAEQEAQGEWLAQDIELEIVYEDEHILVIDKPAGLVVHPAAGHQDGTLL
Y901_CHLAA      YDGRSPR-ASQPVRPGAVIQLTIPPPIPTELVAEPIPLDVVYEDADIAVINKPAGMVVHPAPGHPRGTLV
RLUD_NITEU      VDSAAATCKQ-KVWGGESIVIAGQTENDQSHQAEAIPLKILFEDDHLIIIDKPAGLVVHPGNGNWHGTLL
Y1758_AQUAE     VNGEEVRKPSRKLREGERVILHVPEPEPLDVKPENIPINIIYEDEDIAVVEKPCGLVVHPSPGYTSGTLV
RLUD_YERPE      VNGKKINKPKEKVLGGELVAIDAQIEEDARWAPQEIPLDIVYEDNDILVINKPRGLVVHPGAGNPDGTVL
RLUD_PASMU      VNGDVVNVPRAKVYGGEQIEIVVEIDDDTRFEPENLPLNIVYEDDDILVINKPKDFVVHPGAGNASGTVL
RLUD_VIBVU      VDGNVVTKPRTKVMGGEVITVLAELEDEVRWEAQDIPLDIVYEDDDILVINKPRDFVVHPGAGTPDGTVL
RLUD_SHIFL      VNGKVCDKPKEKVLGGEQVAINAEIEEEARFEPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVL
RLUD_ECOLI      VNGKVCDKPKEKVLGGEQVAINAEIEEEARFEPQDIPLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVL
RLUD_ECOL6      VNGKVCDKPKEKVLGGEQVAINAEIEEEARFEPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVL
RLUD_ECO57      VNGKLCDKPKEKVLGGEQVAINAEIEEEARFEPQDIPLXXXXXXXXXXXXNKPRDLVVHPGAGNPDGTVL
RLUD_SALTY      VNGQLCDKPKEKVLGGERVAIDAEIDEEIRFEAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVL
RLUD_SALTI      VNGQLCDKPKEKVLGGERVAIDAEIDEEIRFEAQDIPLDIVYEDDDILVINKPRDLVVHPGAGNPDGTVL
RLUD_XYLFA      LNGVLVRDPVY---GGEVVRLQVVPDIRTDAVPQDIPLDILYEDEHVFVLNKPAGLVVHPGAGNPDGTLV
RLUD_XYLFT      LNGVLVRDPVY---GGEVVWLQVMPDIRTDAVPQDIPLDILYEDEHVFVINKPAGLVVHPGAGNPDGTLV
RLUD_XANAC      LDGEMAR-PRDTLRGGESVQVQVVLETQTHAAPQDIPLSVLYEDEQVLVIDKPAGLVVHPGAGNPDRTLV
RLUD_VIBPA      VNGEVVTKPRTKVMGGEEITLQAELEDEERWEAQDIPLXXXXXXXXXXXXNKPRDFVVHPGAGTPDGTVL
RLUD_XANCP      LDGETAR-PRDTLRGGXXXXXXXXXXXXXHAAPQDIPLNVLYEDDHVLVIDKPAGLVVHPGAGNPDGTLV
Y723_CHLP8      VNGKPVKSN-YRVKSCDHIHLTFLRPPAPELAPEDIPITILYEDDDLMVIDKEAGMVVHPAFGNWTGTLA
RLUD_RALSO      ---------------------------------------------------KPAGLVVHPAAGNWSGTVL
RLUD_HAEIN      LNDRITNIPREKVLGGERXXXXXXXXDETRFEAENIPLNIVYEDDDIIVINKPKDLVVHPGAGNPNGTVL
RLUD_HAEDU      VNGIIVNRARGKVFGGXXXXXXXXXXXXXRFEPQNIPLNIVHEXXXXXXXNKPKNLVVHPGAGNPDGTVL
PUS2_ORYSJ      VNGRPVSKVSHMVKGGDIVSCTVLELQPLRAEPEDIPLDIVYEDDHLLVVNKPAHMVVHPAPGNANGTLV
RLUD_BUCAI      VNESIVNQPDKKILGGETLTIHPFSKDLLVDIPENIFLDIVYEDSDILIINKPAGLVVHPGSGNKSGTIL
RLUD_NEIMA      VNDKPSQ-PKDKMIGGEQIRVTVRPSEENLAFVPEPMLDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXX
RLUD_NEIMB      VNDKPSQ-PKDKMIGGEQICVTVRPSEENLAFVPEPMLDIVYEDDTVIVVNKPAGLVVHPAAXXXXXXXX
PUS2_ARATH      VNGRVVDKVSHNVKSGDEVNCTISELQPLKAEAEDIPLDIVYEDKHVLVVNKPAHMVVHPAPGNPTGTLV
RLUD_BUCBP      VNGRILDQPDAKVLYKDIISINLKFKAKNDYQAENIFLNVIYEDDDILVINKQDNFVVHPGAGNTSGTLL
RLUD_VIBCH      VNGDVITKPRTKVMGGEVITVQAELEDEQRWEAQDLPLNIVYEDDDIIVINKPRDFVVHPGAGQADKTVL
RLUD_BLOFL      VNNQVSTLPRKKVVYGELIEINNDICKSEDIVPQNIPLNIIYEDNDILVINKASNMVVHPGIGHYQGTVL
YHCT_BACSU      ---------------------------------------------------KPAGIATHPNEDGQTGTLA
RLUD_BUCAP      INGKIENQPDKKILGGEKITIYSTDEKLPINLPQNIALNTIYEDSNILIINKPPGLVVHPGAGNQDGTIL
YJBO_BACSU      -----------------------------------------------------------PSREHPSGSIA
Y1567_MYCBO     -----------------------------------------------------------------TGPTV
Y1540_MYCTU     -----------------------------------------------------------------TGPTV
RLUD_BORBU      ---------------------------------------------------KPQGILSHPGISHWDDTVV
Y505_ZYMMO      ---------------------------------------------------KPAGLPVTSVRDGSL-SLE
RLUC_SALTI      VNKKRIK-PEYKLESGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
RLUC_SALTY      VNKKRIK-PEYKLEAGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
Y292_MYCPN      VNGKKITKNGWLVQPEDRVHVELFEKVPVEVQPYDFPLDILYEDEQIMVVNKPNGLISHPTSFNESESLL
RLUC_ECOL6      VNKKRIK-PEYKLEAGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
RLUC_SHIFL      VNKKRIK-PEYKLEAGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
RLUC_ECOLI      VNKKRIK-PEYKLEAGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
RLUC_PASMU      VNKGRIK-PEYKLQANDIVRVPPVRVSEKEHAPISTKLNKVSQLEKQILFEKPSGIAVHGGSGLSFGVI-
RLUC_ECO57      VNKKRIK-PEYKLEAGDXXXXXXXXXXXXXXXXXSPHLQKVAALADVILYEDDHILVLNKPSG-------
RLUC_VIBPA      ---------------------------------------------------KPSGTAVHGGSGLKFGAI-
RLUA_SHIFL      ----------------------------------------------------------------------
RLUA_ECOLI      ----------------------------------------------------------------------
RLUA_ECOL6      ----------------------------------------------------------------------
Y745_HELPJ      ----------------------------------------------------------HKAPSVKEPTLV
RLUC_HAEIN      VNKGRIK-PEYKLQTGDVVRIPPVRVAEKNDAPISKNLNKVAALENQILFEKPSGIAVHGGSGLNFG-VI
Y745_HELPY      ----------------------------------------------------------HKALSVKEPTLV
RLUC_VIBVU      ---------------------------------------------------KPSGTAVHGGSGLKFGA-I
RLUC_VIBCH      ---------------------------------------------------KPSGTAVHGGSGLHFGAI-
RLUA_SALTI      ----------------------------------------------------------------------
RLUC_HAEDU      VNKGRVK-PDYKLQHNDIVRIPLVRVTPKNEAPISTKLNKVAELEQHILYEKPSGIGVHGGSGLSFG-VI
RLUA_SALTY      ----------------------------------------------------------------------
RLUA_ECO57      ----------------------------------------------------------------------
RLUC_YERPE      VNKGRIK-PEYKLADGDXXXXXXXXXXXXXXXXXSAKLDKVAALADCILFEKPSGTAVHGGSGLSFG-VI
TRUC_YERPE      ----------------------------------------------------------------------
RLUA_PASMU      ----------------------------------------------------------------------
RLUC_BUCBP      ---------------------------------------------------KPSGMSVHSGSGINYGMIE
RLUA_VIBVU      ----------------------------------------------------------------------
RLUA_VIBCH      ----------------------------------------------------------------------
RLUC_BUCAP      ---------------------------------------------------KPSGIAVHGGSGINLGVI-
RLUA_YERPE      ----------------------------------------------------------------------
RLUA_VIBPA      ----------------------------------------------------------------------
RLUA_HAEIN      ----------------------------------------------------------------------
RLUA_HAEDU      ----------------------------------------------------------------------
PUS4_ARATH      ---------------------------------------------------KPHGLAVQGGSGIKTS--I
TRUC_HAEDU      ----------------------------------------------------------------------
PUS7_ORYSJ      ---------------------------------------------------KPASVPVHPCGQYRKNTVV
RLUC_BUCAI      ---------------------------------------------------KPSGIAVHGGSGLNFGVI-
TRUC_VIBCH      ---------------------------------------------------KPAGMLVHRSDKHETEFVM
Y209_MYCGE      ---------------------------------------------------KPSGLLTHPTTFNEKASLL
RLUC_PSEAE      ----------------------------------------------------------------------
TRUC_PECCC      ----------------------------------------------------------------------
Y956_HELPJ      ----------------------------------------------------------------------
RUSD4_XENTR     ---------------------------------------------------KPHGLPVHPTVERSVASLL
RLUC_RICCN      ---------------------------------------------------KPAGLAT------QGGTKI
Y548_MYCPN      ---------------------------------------------------KPAGVVCQPDAKHELFNLA
RLUC_RICBR      ---------------------------------------------------KPAGLAT------QGGSKI
Y956_HELPY      ----------------------------------------------------------------------
TRUC_VIBPA      ---------------------------------------------------KPAGMLVHRSDKHETQFVM
YA32_SCHPO      ---------------------------------------------------KPAGVPVHPTGRYNHNTVL
RLUC_RICFE      ----------------------------------------------------------------------
PUS6_YEAST      ---------------------------------------------------KPSGIPVHPTGQFYQNTIT
PUS5_ORYSJ      ---------------------------------------------------KPSGLQVLPKGLFQQRTVL
TRUC_ECOL6      ----------------------------------------------------------------------
YK27_CAEEL      ---------------------------------------------------KPPSLPVHTCGQYAIHTVL
Y370_MYCGE      ---------------------------------------------------KPTGIVCQPDKKHSIINLS
TRUC_PASMU      ---------------------------------------------------KPAGMLVHRSDRHETQFVM
TRUC_HAEIN      ---------------------------------------------------KPAGMLVHRSDPHETQFVM
RLUC_RICPR      ----------------------------------------------------------------------
YDL36_YEAST     ---------------------------------------------------KPSGIPVHPTGRYRFNTIT
TRUC_SHIFL      ----------------------------------------------------------------------
TRUC_ECOLI      ----------------------------------------------------------------------
TRUC_ECO57      ----------------------------------------------------------------------
PUS5_CANAL      ---------------------------------------------------KPSGMVCD--ASH-TNNII
PUS3_ARATH      ----------------------------------------------------------------------
PUS7_ARATH      ---------------------------------------------------KPASVPVHPCGQYRKNTIV
PUS5_ARATH      IDGEVVKDPNTLLRSGSKLVYSRLPWKEPDTPYSLEVLYEDDDLIALN---KPSGLQVLPGGLFQQRTVL
TRUC_VIBVU      ---------------------------------------------------KPAGMLVHRSDKHETQFVM
RUSD1_BOVIN     ----------------------------------------------------------------------
Y347_HELPY      ---------------------------------------------------KPHQVYTHPKGYFYHESLL
RLUC_RICTY      ----------------------------------------------------------------------
RIB2_YEAST      ---------------------------------------------------KPSSIPVHPTGRYRFNTIT
RUSD2_HUMAN     ---------------------------------------------------KPSSIPVHPCGRFRHNTVI
Y042_HAEIN      ----------------------------------------------------------------------
TRUC_SALTI      ----------------------------------------------------------------------
RUSD4_RAT       ---------------------------------------------------KPYGLPVHGGPGVQLPILA
TRUC_SALTY      ----------------------------------------------------------------------
RUSD2_MOUSE     ---------------------------------------------------KPSSIPVHPCGRFRHNTVI
Y347_HELPJ      ---------------------------------------------------KPAQIYTHPKGYFYHESLL
Y1592_SYNY3     ----------------------------------------------------------------------
PUS3_ORYSJ      ----------------------------------------------------------------------
RUSD1_MOUSE     ----------------------------------------------------------------------
RUSD1_HUMAN     ----------------------------------------------------------------------
PUS1_ARATH      ----------------------------------------------------------------------
RUSD4_DANRE     ----------------------------------------------------------------------
RUSD1_DANRE     ----------------------------------------------------------------------
PUS1_ORYSJ      ----------------------------------------------------------------------
RUSD4_MOUSE     ---------------------------------------------------KPYGLPVHGGPGVQLPILA
RUSD4_HUMAN     ---------------------------------------------------KPYGLPVHGGPGVQLPILA
PUS5_YEAST      ----------------------------------------------------------------------
PUS5_ASHGO      ----------------------------------------------------------------------
PUS4_ORYSJ      ---------------------------------------------------KPPGMPVQGGVGIKNS--I
RUSD4_BOVIN     ---------------------------------------------------KPYGLPVHGGPG------V
MLRR1_PLAF7     ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
PUS6_ARATH      ----------------------------------------------------------------------
RUSD3_MOUSE     ---------------------------------------------------KPQGLPVTGRPGELTLLSV
RUSD3_HUMAN     ---------------------------------------------------KPQGL---PVTGKPGELTL
PUS6_ORYSJ      ----------------------------------------------------------------------
RUSD3_BOVIN     ---------------------------------------------------KPQGLPVTGKPGELT----


                         .         .         .         +         .         .         .:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
RLUD_ZYMMO      NALLYHCAGKLSGIGGVARPGIVHRIDKDTSGLLVVAKTDPAHAGLAAQFADH----SINRRYRAIVDGH
YLYB_BACSU      NGLMAHCTD-LSGINGVMRPGIVHRIDKDTSGLLMVAKNDMAHESLVNQLVNKTVT----RKYTAVVHGL
Y1629_SYNY3     NALLAHCPD-LAGIGGVQRPGIVHRLDKDTTGAMVVAKTELALHNLQVQLKEK----TARRLYWGIVYGS
RLUD_PSEAE      NALLYHVPD----IANVPRAGIVHRLDKDTTGLMVVAKTLEAHTKLVAQL----QARSVSRIYEAXXXXX
Y901_CHLAA      NALLARYPDL--AIGGELRPGIVHRLDRDTSGLLVIARHDQAMRSL----VDQQQARRMRKIYQALVIGR
RLUD_NITEU      NALLNHAPQ----LSQVPRAGIVHRLDKDTTGLLVVAKTIEAQFDLARQLQQR----TVKRHYLALVLGK
Y1758_AQUAE     NALLYHI-KDLSSIGGVERPGIVHRLDKETAGVMVIAKNNTAHRNLVRQFQER----KTEKFYKVLVKGL
RLUD_YERPE      NALLHYYPEIMD----VPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVEAL----QAREITREYEAVAIGN
RLUD_PASMU      NALLYH----YPAIAEVPRAGIVHRLDKDTTGLMVIAKTIPAQTKLVRDLQKR----KITREYEAIACGI
RLUD_VIBVU      NALLFHCPE----VAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRALQKRNITRE----YEAIAIGR
RLUD_SHIFL      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
RLUD_ECOLI      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
RLUD_ECOL6      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
RLUD_ECO57      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
RLUD_SALTY      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QLREITREYEAVAIGH
RLUD_SALTI      NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QLREITREYEAVAIGH
RLUD_XYLFA      NALL-HRDPALAA---VPRAGVVHRLDKDTSGVMVVARTLQAQTALVEQLSSR----QVHRQYLAVVVSA
RLUD_XYLFT      NALL-HRDPALAA---VPRAGVVHRLDKDTSGVMVVARTLQAQTALVEQLSSR----QVHRQYLAVVVSA
RLUD_XANAC      NALLFRD----PALASVPRAGVVHRLDKDTSGVMVVARTVQAQTALVEQLSAR----EVHR-QYXXXXXX
RLUD_VIBPA      NALLHHYPD----IAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRALQKRNITRE----YEAIAIGR
RLUD_XANCP      NALLFRD----PNLAAVPRAGVVHRLDKDTSGVMVVARTLQAQTALVEQLSAR----DVHR-QYXXXXXX
Y723_CHLP8      NAILHHLGKDADELDKTERPGIVHRLDKDTSGLIIIAKNPTALHKLARQFANR----QVEKVYKAIVWGV
RLUD_RALSO      NGLLHRYPQA----AGLPRAGIVHRLDKETSGLMVVARTLPAQTDLVRQL--QART--VKRTYLALVWGE
RLUD_HAEIN      NALLYH----YPPIVEVPRAGIVHRLDKDTTGLMVVAKTIPAQTKLVRDLQKR----KITREYEAVASGI
RLUD_HAEDU      NALLYY----YPPIAEVPRAGIIHRLDKDTTGLMVVAKNIPAQTHLVTALQKR----RITREYEAIASGI
PUS2_ORYSJ      NAILHHCGEVSSEVRALVRPGIVHRLDKGTSGLLVVAKDEHSHAQLAEQFKLH----TIRRVYISLTCGA
RLUD_BUCAI      NALLYHYKNSKD----LPRAGIVHRLDKDTSGLMVIAKNIFSYNHXXXXXKEK----KIIREYEGIVHGK
RLUD_NEIMA      XXXXAHCPE----LSQIPRAGIVHRLDKETSGLMVVAKTLPAQNSLVWQLQER----TVKRIYRAVANGI
RLUD_NEIMB      XXXXAHCPE----LSQVPRAGIVHRLDKETSGLMVVAKTLPAQNSLVRQLQER----TVKRIYRAVANGI
PUS2_ARATH      NGILHHCSLPCSSYAASVRPGIVHRLDKGTTGLLVVAKDEHSHAHLAEQFKLH----TIERVYVSLTTGV
RLUD_BUCBP      NALLHRD----STFFNIPRAGIVHRLDKDTTGLMVIAKNNLSYMALIDQI----KCKKVIREYQAIVYGK
RLUD_VIBCH      NALLFH----YSPIAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRAL----QKRDVTREYEAIVIGT
RLUD_BLOFL      NALLYRYPSILKIS---KQAGIVQRLDKDTTGLMIIAKTVSAYDNLLRSF----KLRKVVKEYDAIVYGK
YHCT_BACSU      NLIAYHYQIN----GETCKVRHVHRLDQDTSGAIVFAKHRLAHAILDQQLEKK----TLKRTYTAIAEGK
RLUD_BUCAP      NALLYR----YTNISSIPRCGIIHRLDKDTSGLMVIAKTIFSYNKLVTLL----KKRKIIRKYQGIIKG-
YJBO_BACSU      NGIIDHYQTT-----GVRATHLVTRLDRDTSGIMLVAKHRFAHSILSSA----QKNGLVKRRYAAVVHGR
Y1567_MYCBO     LGGLAAAGYRITTSGVHERQGIVHRLDVGTSGVMVVAISERAYTVLKRAFKY--RTVDKR--YHALVQGH
Y1540_MYCTU     LGGLAAAGYRITTSGVHERQGIVHRLDVGTSGVMVVAISERAYTVLKRAFKY--RTVDKR--YHALVQGH
RLUD_BORBU      NFLLYHIKSLKINFNEEKRPGIVHRLDKDTSGVLICAKNISTLRFLAQQFKDK-RTNKV---YIAIVKGN
Y505_ZYMMO      NYLASLC------FGFKRWPSIVHRLDRDTSGCLLLARNPKMHRRLSEAFSQ----GQVKKCYWAILEGV
RLUC_SALTI      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
RLUC_SALTY      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
Y292_MYCPN      GAALFHCNH--------QPVFLVHRLDRDTSGVIMLAKNXXXXXXXXXXXXXR----VMKRYYLALVHFP
RLUC_ECOL6      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
RLUC_SHIFL      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
RLUC_ECOLI      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
RLUC_PASMU      --------EALRTLRDARFLELVHRLDRDTSGILLVAKKRSALRSLHEQL----REKTVQKDYLALVRGQ
RLUC_ECO57      TAVHGGSGLSFGVIEGLRRPELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
RLUC_VIBPA      --------EALRALRPQARLELVHRIDRDTSGILLVAKKRSALRHLQAQF----REKTVKKFYFALVMGQ
RLUA_SHIFL      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
RLUA_ECOLI      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
RLUA_ECOL6      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
Y745_HELPJ      DWLKSQNYE-LSNLGLKERYGIVHRLDKDTSGGIVIAKNNFTHVCLSEQL----KTKMMGRYYIALLSTP
RLUC_HAEIN      EALRALRPEA-------RFLELVHRLDRDTSGILLIAKKRSALRNLHEQL----RVKTVQKDYLALVRGQ
Y745_HELPY      DWLEFKNYE-LSNLGLKERYGIVHRLDKDTSGGIVIAKNNFTHVHLSEQL----KTKMMGRYYIALLSTP
RLUC_VIBVU      EALRALRPEA-------RFLELVHRIDRDTSGILLVAKKRSALRHLQAQF----REKTVQKYYFALVMGE
RLUC_VIBCH      --------EALRALRPQARLELVHRIDRDTSGILLVAKKRSALRHLQAQF----REKTVQKYYYALVMGH
RLUA_SALTI      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
RLUC_HAEDU      EALRALRPQA-------RFLELVHRIDRDTSGILLVAKKRSALRALHEQL----REKVVQKDYLALVRGQ
RLUA_SALTY      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
RLUA_ECO57      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----RERVPKKQYVTRVWGH
RLUC_YERPE      EGLRALRPEA-------RFLELVHRLDRDTSGVLLVAKKRSALRSLHEQL----RLKSMQKDYLALVRGQ
TRUC_YERPE      ----------------------VHRLDRPTSGVLLMALSSDVARMLSLQFEQH----QIQKTYHAVVRGY
RLUA_PASMU      -----------------------HRLDMSTSGLILFALSKVADRELKRQF----REREPKKHYQALVWGH
RLUC_BUCBP      NLRILRPYN--------RYLDLVHRLDRDTSGVLIIAKKRSILRNLHEQL----REKKIKKKYVALVHGV
RLUA_VIBVU      ---------------------VVHRLDMSTSGLMVFAKNKRAEAALKKQF----QYRLTHKVYYARVWGH
RLUA_VIBCH      ---------------------VVHRLDMSTSGLILFAKGKHMESALKKQF-QYRLTHKI---YYARVWGV
RLUC_BUCAP      --------EYFRKIRPLEKLELVHRIDRDTSGVLMLAKKRRSLLSLHKQI----REKKVQKKYIALVHGL
RLUA_YERPE      ----------------------VHRLDMATSGVIVVALTKAAERELKRQF----REREPKKTYIARVWGH
RLUA_VIBPA      ---------------------VVHRLDMSTSGLMVLAKNKRAESALKKQF----QFRLTHKIYYARVWGH
RLUA_HAEIN      -----------------------HRLDMATSGIIVFALSKAADRELKRQF----REREPKKHYQAIVWGH
RLUA_HAEDU      -----------------------HRLDMATSGIILLALSKVAEKELKRQFRDR----EPKKHYIALLWGK
PUS4_ARATH      DELAASCLK----FDKSESPRLVHRLDRDCSGLLVLARTQTAATVLHSIFREK-TTGSLKRKYMALVIGC
TRUC_HAEDU      ----------------------IHRLDRPTSGVLLFALNSEMARLMSEQFEQH----KVEKEYLAIVRGY
PUS7_ORYSJ      GILQAE--------HGLVPLFPVHRLDRLVSGLLIFAKNADKAESFRQQI----EASLLQKEYVAKVVGV
RLUC_BUCAI      --------EYFRKLRPLNKLELVHRIDRDTSGVLILAKKRTSLVSLHEQL----REKKIKKEYIALVHGL
TRUC_VIBCH      QTLRDQIGQHVFPL---------HRLDRPTSGVLVFALSSQIASEVMPMFANH----EMEKTYHAIVRGW
Y209_MYCGE      AACIFHNNKN--------PVYLVHRLDRDTSGAIVVCKXXXXXXXXXXXXXXR----TLKRYYVALVHFP
RLUC_PSEAE      ---------------------LVHRLDRDTSGLLMIAKKRHLHEALRGEKIVDKRYHALVRGH----WPA
TRUC_PECCC      ----------------------VHRLDRPTSGVLLLALSSEVARALSQQFESH----QMQKTYHAVVRGY
Y956_HELPJ      ---------------------LLHRLDKETSGVILLVKNSEFHLKAKKAFKDRA----VKKEYLAIVQGI
RUSD4_XENTR     PALAKH------HFGWKAEPKLCHRLDRDTTGALILARTTEAAERVQQAL----REREVHRVYWALCLGT
RLUC_RICCN      NLSIDSALKYLNYKGADFK--LVHRLDKKTSGLLLIAKNYLSSVKLHNAFKEK----LVVKTYFAVTYGK
Y548_MYCPN      NSLLKHCGNSLSFI-----PRFAHRIDRNTCGLVIGAKTNQALQELEAVF----RHNLLMKQYQGLVFG-
RLUC_RICBR      NLSVDSALKYLNSQGADFK--LVHRLDKETSGLLLIAKNYVSSVKLHDAFKEK----LVEKTYLAVTYGK
Y956_HELPY      ---------------------LLHRLDKETSGVVLLVKNSEFHLKAKKAFKDRA----VKKEYLALTQGI
TRUC_VIBPA      QTLRDQIGQHVFPL---------HRLDRPTSGVLVFALSSEVASQVMPMFAEH----KMEKTYHAIVRGW
YA32_SCHPO      HILMKENKCSLLYP--------CNRLDRLTSGLMFFSKSPKAAEEMRV----HMISKSLKKEYVARVIGE
RLUC_RICFE      ---------------------LVHRLDKETSGLLLIAKNYLSNVKLHDAFKEK----LVVKTYFAVTYGK
PUS6_YEAST      ELLKLHGVDALP----------CYRLDKITSGLLILAKNSQSAGEIQKSI----RSRDMIKIYLARVKGA
PUS5_ORYSJ      AQLQLKDWKMPSSFCSKRKPVPVHRLGRGTSGXXXXXXXXXXXXXXXXYFAEGAKARKISKFYRALVTGI
TRUC_ECOL6      -----------------------HRLDRPTSGVLLMGLSSEAGRLLAQQFEQH----QIQKRYHAIVRGW
YK27_CAEEL      GQLRVNEGRT-----GLR---VLHRLDRATSGVLLFAKN----YETDLEFKTTLKQGEWSKEYICKVDGV
Y370_MYCGE      NMLLKHCGYRQFDSNKLNYPQFAHRIDRNTSGIVIGAKTNKALKELNKVF----KNNHLTKRYKGLVFGQ
TRUC_PASMU      QTLRDQIGQHVYPI---------HRLDRPTSGVLLFALSSEVANLLCLQFENK----QVQKSYLAIVRGG
TRUC_HAEIN      QTLRDQIGQHVFPI---------HRLDRPTSGVLLFALSSEIANLMCEQFEQK----YVQKSYLAVVRGG
RLUC_RICPR      ---------------------LVHRLDKETSGLLLIAKNYLSSVKLHNAFKEK----LVIKKYFAITYGR
YDL36_YEAST     KML-------QNNLGFVVNP--CNRLDRLTSGLMFLAKTPKGADNIGDQL----KAREVTKEYVAKVVGE
TRUC_SHIFL      -----------------------HRLDRPTSGVLLMGLSSEAGRLLAQQFEQH----QIQKRYHAIVRGW
TRUC_ECOLI      -----------------------HRLDRPTSGVLLMGLSSEAGRLLAQQFEQH----QIQKRYHAIVRGW
TRUC_ECO57      -----------------------HRLDRPTSGVLLMGLSSEAGRLLAQQFEQH----QIQKRYHAIVRGW
PUS5_CANAL      TALTNEFTKILPSVNSSQFR-LVQRLDRFVTGGLVVARNKKWADKVRKSFFQEG-TLRLTRRYVGLIAQI
PUS3_ARATH      NSMDALAAAALS-FGNDEGPRLVHRLDRETSGLLVMGRTKESIDYLHSVFSDYGRNSSCKQQYWALVIGS
PUS7_ARATH      GILDAEHDL------GTLFP--IHRLDRLVSGLLIAAKADFFRQQIEG--------GMVKKRYIAKVIGV
PUS5_ARATH      TQLQWCFGKNDSYIGSRESPHPVHRLGRGTSGIXXXXXXXXXXXXXXXYFAEGGTGRKLSKIYRALADGI
TRUC_VIBVU      QTLRDQIGQHVFPL---------HRLDRPTSGVLVFALSSEVASQVMPMFAGQ----EMSKTYHAIVRGW
RUSD1_BOVIN     -----------------------HQLDFSTSGALCVALNKAAAGSAYRCFKDRRVT----KAYLALVRGH
Y347_HELPY      DCIQSHFGKNAHP---------AHRLDYETSGLVLAGKTLQSVKDLKALFMQK----KVKKTYLALAHGL
RLUC_RICTY      ---------------------LVHRLDKETSGLLLIAKNYLSSVKLHDAFKEK----LVIKKYFAITYGR
RIB2_YEAST      KMLERQLGYSVHPC---------NRLDKPTSGLMFLAKTPLG----ADRMGDQMKAREVTKEYVARVKGE
RUSD2_HUMAN     FIL----GKEHQ----LKELHPLHRLDRLTSGVLMFAKTAAVSERIHEQVRDR----QLEKEYVCRVEGE
Y042_HAEIN      ---------------------LVHRLDKVTSGLLILALNAESAAEFSRLFSEH----KIHKTYLALSNQK
TRUC_SALTI      -----------------------HRLDRPTSGVLLMGLSSEAGRRLAQQFEQH----HIRKRYHAIVRG-
RUSD4_RAT       KMLHGHKAEPLH---------LCHRLDKETTGVMVLAEKDMAH-----QVQELFRTRQVEKKYWAITVRV
TRUC_SALTY      -----------------------HRLDRPTSGVLLMGLSSEAGRRLAQQFEQH----HIRKRYHAIVWLM
RUSD2_MOUSE     FIL----GKEHQ----LKELHPLHRLDRLTSGVLMFAKTAAVSEKIHEQVRDR----QLEKEYVCRVAGE
Y347_HELPJ      DCIQSHFGKNAHP---------AHRLDYETSGLVLAGKTLQSTKDLKALFMQK----KVKKTYLALAHGL
Y1592_SYNY3     ----------------------------------------------------------------------
PUS3_ORYSJ      --------------GNEEGPKLVHRLDRESSGLLLFGRTKESFTRLHWLFTSNAACEAYMQRYWALVIGT
RUSD1_MOUSE     -----------------------HQLDFSTSGALCVALNKAAAGSAYKCFKERRVT----KAYLALVRGH
RUSD1_HUMAN     -----------------------HQLDFSTSGALCVALNKAAAGSAYRCFKERRVT----KAYLALLRGH
PUS1_ARATH      ---------------------LANRLDRDTSGVMIITKSHKVAAKLVKAFTEH----KIRKSYIALCIGS
RUSD4_DANRE     ---IAECLPLLAKITDNMRPGLCHKLEKETTGVLILAKTEEAAEHVQTLIQSH----KVEMKYLAITVGV
RUSD1_DANRE     -----------------------HQLDFSTSGALCVALNKAAAGQAYRCFKDRRVT----KAYLALVRGT
PUS1_ORYSJ      ---------------------LANRLDRDTSGLMVITKCNKVAGKLVKAFTEH----KVKKTYLALCIGY
RUSD4_MOUSE     KMLHGHKAEPLH---------LCHRLDKETTGVMVLAEKDMAH-----QVQELFRTRQVEKKYWAITVRV
RUSD4_HUMAN     KMLHGHKAEPLH---------LCHRLDKETTGVMVLADKDMAH-----QVQELFRTRQVVKKYWAITVHV
PUS5_YEAST      ----------------------VHRLDHCVTGGMLIAKTKDGSVKFSRFLQKGGNNGKLQRKYVAIVESS
PUS5_ASHGO      ----------------------VHRLDEPVTGGVLVSRNKRAAAMFSRSLALGGNRGPLTRRYVALL---
PUS4_ORYSJ      DVLASMFEENSS-----EAPRLVHRLDRDCSGILVLGRNQLSTSMLHAIFREDGTQHVLQRKYVALVIGT
RUSD4_BOVIN     KLCISDVLPVLAKIGPKAKPHLCHRLDKETTGVMVLAEKEVAH-----QVQELFRTRQVTKKYWAITVRV
MLRR1_PLAF7     --------------------GLCHRIDLETSGSLIIAKTKEAREFLFDQF----RKRNVYKEYILLCHGR
RLUE_SALTI      ------------------------RLDRDSEGLLVLT-NDGA---LQARLTQPGRTGKI---YYVQVEGI
PUS6_ARATH      ----------------------------------------------------------------------
RUSD3_MOUSE     LPQLSQAGLEHQELQVVRAPG------KEASGLVLLSSCPQTASRLQKFFIHSRRAQRPTATYCAVTDGI
RUSD3_HUMAN     FSVLPELSQSL----GLREQEVVRASGKESSGLVLLSSCPQTASRLQKYFTHARRAQRPTATYCAVTDGI
PUS6_ORYSJ      ----------------------------------------------------------------------
RUSD3_BOVIN     --LLSVLPELSRSLGGEQEVQVVRASGKEASGLVLLSSCSQTASRLQKFFTHSRRARKPTATYCAVTDGI


                         .         *         .         .         .         .         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
RLUD_ZYMMO      PS-LQGHVDAPLARSSVNRQKMAVSDGGKRAVTHYRMITPLKN------ASLIECRLETGRTHQVRVHMS
YLYB_BACSU      ISHDDGTIDAPIGRDKKDRQSMTVTRDGKNAVTHFHVLERF------QDFTLVECQLETGRTHQIRVHMK
Y1629_SYNY3     PKEIQGTVNLPVGRHPGDRQKMGVEKGGREAVTHWRLLERIGNHSWLEF------QLETGRTHQIRVHSK
RLUD_PSEAE      XXXXXXX-DAPIGRHGVQRQKMAVVDAGKVAVSHYRVLERFRAHTHTRV------KLETGRTHQIRVHMS
Y901_CHLAA      PPET-GTIDAPIGRDPRDRLRMAVVPDGRPARTHYRLLDTFGD------YSLLEVQLETGRTHQIRVHLR
RLUD_NITEU      LEK-DGVVDAPIGRHPIHRTRMAVVQNGKPARTHYRVLEKFTAST------LLHCSLETGRTHQIRVHLL
Y1758_AQUAE     VKKDYGAIDTPIARHPVDRKRFWVRKEGKEALTEYWVLKRYEKYE----ITLLKVKIHTGRTHQIRVHFA
RLUD_YERPE      MTA-GGRVDEPISRHSTKRTHMAVHPMGKPATTHYRIMEHFRAHTXXXXXX------ETGRTHQIRVHMS
RLUD_PASMU      MTK-GGMVDQPMARHPTKRTHMAVHPMGKPAVTHYRIMERFRN------YTXXXXXXETGRTHQIRVHMA
RLUD_VIBVU      MTA-GGKVDKPIGRHATKRTLMAVSPMGKPAVTHFRVAEHFREHTR------IRLRLETGRTHQIRVHMS
RLUD_SHIFL      MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_ECOLI      MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_ECOL6      MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_ECO57      MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_SALTY      MTA-GGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_SALTI      MTA-GGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
RLUD_XYLFA      LVS-GGTVNAAIERHPRDRLRMAVSDTGKEAVTHYRLRERFRAHTALE------CRLDTGRTHQIRVHMA
RLUD_XYLFT      LVS-GGTVNAAIERHPRDRLRMEVSDTGKEAVTHYRLRERFRAHTALE------CRLDTGRTHQIRVHMA
RLUD_XANAC      XXXXXXTANAPIDRHPRDRLKMAVRDDGRDAVTHYRLRERFRAHTALE------CRLETGRTHQIRVHMA
RLUD_VIBPA      MTA-GGKVDQPIGRHSTKRTLMAVAPLGKPAVTHYRVAEHFREHTR------IRLRLETGRTHQIRVHMS
RLUD_XANCP      XXXXXXTADAPIDRHPRDRLKMAVRDDGRDAVTHYRLRERFRAHTA------LECRLETGRTHQIRVHMA
Y723_CHLP8      PKAESGTIKTNIGRSHKNRKVMAPYEGGKHAITDYQVVEDLG------YFSLMDVTLHTGRTHQIRVHLQ
RLUD_RALSO      TPEA-GTIDAPIGRDPRDRTRMAIIESGKPARTHFKTLDVVD--LGRAQVSLVQCQLETGRTHQIRVHFE
RLUD_HAEIN      MTK-GGTVDQPMARHATKRTLMAVHPMGKPAVTHYRIMXXXXXXXXXXXXX------ETGRTHQIRVHMA
RLUD_HAEDU      MTQ-GGKVDEPMARHPTKRTAMAVHPMGKPAITHYRIMERFRN------YTXXXXXXETGRTHQIRVHMA
PUS2_ORYSJ      PNPNSGRIEVPIARDPNNRIRMIATPGSRHAASRYKVREVFAG--GGS--ALVEWRLETGRTHQIRAHAK
RLUD_BUCAI      MIA-GGTINKPIMRHYNRRTCMMVHHLGKPSVTHYKVLSRF------KFHTHIAIRLETGRTHQIRVHML
RLUD_NEIMA      VP-FDGKIETQIGRDPHNRLKMAVKFGGKPAVTHVKVLERYLAHS------YIECSLETGRTHQIRVHMR
RLUD_NEIMB      VP-FDGKIETQIGRDPHNRLKMAVKFGGKPAVTHVKVLERYLTHS------YIECSLETGRTHQIRVHMR
PUS2_ARATH      PSPPQGRIEIPIGRDSSNRIRMAAXXXXXXXXXXYKVIETFAG--GGS--ALVEWRLETGRTHQIRAHAK
RLUD_BUCBP      VIS-GGTIVKSIIRNPIKRTTMIVNKCGKRAITHYRILKRFTHHTHLKII------LETGRTHQIRTHML
RLUD_VIBCH      MT-AGGMIDKPIGRHSTKRTLMSVSPMGKHAVTHYRV------AXXXXXXXXXXXXXXXXXXXQIRVHMA
RLUD_BLOFL      FTSNAGVVNQPMRRHFAKRTFMSVHYTGKSAVTYYSVVEEFKAHSRVRI------NLKTGRTHQIRVHMA
YHCT_BACSU      LRTKKGTINSPIGRDRSHPTRRRVSPGGQTAVTHFKVMAS----NAKERLSLVELELETGRTHQIRVHLA
RLUD_BUCAP      -NMISGIVNYPIMRHPFKRICMTTDSLGKKSITHYKIINRF------KFHTHVSFRLETGRTHQIRVHML
YJBO_BACSU      MAQMEGTVDAPIGRHPDSIIERTVTPDGQKAVTHFYVT------CANDDMTSVALQLETGRTHQIRVHMS
Y1567_MYCBO     PDPSSGTIDAPIGRHRGHEWKFAITKNGRHSLTHYDTLEAFVA------ASLLDVHLETGRTHQIRVHFA
Y1540_MYCTU     PDPSSGTIDAPIGRHRGHEWKFAITKNGRHSLTHYDTLEAFVA------ASLLDVHLETGRTHQIRVHFA
RLUD_BORBU      FNSFFGSIESFIDRDKHNRKKFSVKDRGKKALTEYRLLLNF-----GEY-SLLALKPKTGRTHQLRVHMK
Y505_ZYMMO      PEKNEGIIDLPLLKSPKSGWRIVADDKGKRAVTHWEILAKNKGR------SLVAFRPETGRTHQLRVHAA
RLUC_SALTI      WQSHVKTVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
RLUC_SALTY      WQSHVKTVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
Y292_MYCPN      LDSLSGTISAPLERVGNNKVMWKVGNSSNKAKN---AFTKFTVLNQNEKAALIKCELLTGRTHQIRVHLQ
RLUC_ECOL6      WQSYVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
RLUC_SHIFL      WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
RLUC_ECOLI      WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
RLUC_PASMU      WQSHCKVVKAPLLKNELSSGERIVREQGKPSETRFSIEERY------EYATLVKASPVTGRTHQIRVHTQ
RLUC_ECO57      WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
RLUC_VIBPA      WKSSCKVVNAPLLKN-EVNSIVRVNPNGKPSETRFKILEKF------EQATLIQASPITGRTHQIRVHTQ
RLUA_SHIFL      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHML
RLUA_ECOLI      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHML
RLUA_ECOL6      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHML
Y745_HELPJ      LKEEKMSVECYLTRNPNNRLKMIALKAAKKEKSRYSKSEFTSLLTSQNGMDLIGAKLFTGRTHQIRAHLE
RLUC_HAEIN      WQSHIKVIQASLLKNELSSGERIVREQGKPSETRFSIEERYIN------ATLVKASPVTGRTHQIRVHTQ
Y745_HELPY      LKEEKMSVECYLTRNPNNRLKMIALKAVKKEKSRYSKSEFISLLTSQNNLNLIGAKLFTGRTHQIRAHLE
RLUC_VIBVU      WKNSCKVVNAPLLKN-EVNSIVRVNPNGKPSETRFKVIEKFPQ------ATLVQASPITGRTHQIRVHTQ
RLUC_VIBCH      WDAECKVVNAPLLKN-EVNSIVRVNPNGKPSETRFRILEKFAE------ATLVQASPVTGRTHQIRVHTQ
RLUA_SALTI      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPI-----TGRSHQLRVHML
RLUC_HAEDU      WQAHINVIKAPLLKNESGERIVKVSEQGKPSETRFSIEERYPN------ATLIKASPITGRTHQIRVHTQ
RLUA_SALTY      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYNVVEFAADNTARVVLKPI-----TGRSHQLRVHML
RLUA_ECO57      PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHML
RLUC_YERPE      WQSHCKAIQAPLLKNQSGERVVKVSSEGKPSETRFKIEERF------EHATLVKASPVTGRTHQIRVHAL
TRUC_YERPE      VLE-GGTVDAMAEELDKIADKFAKSDKAPQSVSHYEALAQVEGRYETARYSLVALKPETGRKHQLRRHMA
RLUA_PASMU      LEEDQGEVNLPLDWENRPRQKICF-ERGKPALTLYEVLARYPNNTTRVKLTPI-----TGRSHQLRLHML
RLUC_BUCBP      WPDILKSISKPLLKTSSRKNKNIVKPKGKESITHFNIKKKYTKNT------LISITPITGRTHQIRVHLL
RLUA_VIBVU      VEADSGMIDLPICDWPNRPMQKVCHEHGKPSQTAFQVAKREVHANGAQ-TTIMRLLPVTGRSHQLRVHMQ
RLUA_VIBCH      MEQNEGEVNLPLDWPNRPKQKVCFEEG-RDSLTRYQVVKR---EEKTTVVRLIPI---TGRSHQLRVHMQ
RLUC_BUCAP      PLSLRKVSEPLLKTHKNKQRKILINKEGKPAETYFKIKKQYL------FTTLVSITPKTGRTHQIRVHTL
RLUA_YERPE      LAQDEGLIDLPICDWPNRPKQKVCYETGKSAQTEYQVISRDDDGSTRVKLSPI-----TGRSHQLRVHML
RLUA_VIBPA      VEQEEGEIDLPLDWPNRPLQKVCFEDG-KPSKTLFQVAKREEQEDGTK-TTIVRLLPITGRSHQLRVHMQ
RLUA_HAEIN      LENDYGEVNLPMENRPRQRLDFVL---GKRAVTKFEVLARLPNNS-----TRVKLTPVTGRSHQLRLHML
RLUA_HAEDU      GDRVTGEINFPLDWENRPRQKICY-ERGKKATTHYEVLEHLANNTTRVKFTPI-----TGRSHQLRVHSL
PUS4_ARATH      PPRQRGQISAPLRKDDGKSERITVNDNGELVSTQHAITEYRVIESSPHGYTWLELRPLTGRKHQLRVHCA
TRUC_HAEDU      IAE-KGEIDYPLKVIDKIADKFSQPKAAQQAVTFYQNLAKVTGKYATTRYSLVALSPKTGRKHQLRRHMK
PUS7_ORYSJ      FPDGEQTVNANV--HFNAREGRSVCDGDGKAPIGKQACTKFQRICTDGIHSIVLCKPVTGRTHQIRVHLK
RLUC_BUCAI      PDHIKKISEPLLKIQFKNKQKMVLIDKGKPSETYFQIKKKF---SSSTLLSIIP---KTGRTHQIRVHAL
TRUC_VIBCH      IEEAN-VLDYPLKEEDKIADKFAKQDKAQSAVTAYRPLAKVTGKFATTRYCLMEMQPKTGRKHQLRRHMA
Y209_MYCGE      FNALTGSINAPLARVNNNK----VMXXXXXXXXXXXXXXXXXVINQNEKAALISLELLTGRTHQIRVHLK
RLUC_PSEAE      GKK---NVRAPLLKNNRSGERMVVNVEGKDALTEFRVLRRF-----GDFATLVEARPITGRTHQIRVHAK
TRUC_PECCC      VLD-DGVIDALTEELDKIADKFTNPDKAPQAVTHYRSLAVAIGRYPTARYSLMELKPQTGRKHQLRRHMS
Y956_HELPJ      IEEER-EINAPILTIKTTKAFSKISKKGQEAVTIITPLKIINKKT------LLKVGIKTGRTHQIRVHLK
RUSD4_XENTR     PSPREGILDIPIQKHPRFRERVRVPRSAHEAVTRYRTLGAASG------ASLVELHPITGVKHQLRVHLA
RLUC_RICCN      PIKNVGEVRSNIEKSKGSTPKITDIDSGKLAITYYKVLKSLDNN-----LFLIEFTPVTGRMHQLRLHAK
Y548_MYCPN      PFNFKGTQKAYWAKDAYVTVKAKPFPNAKPITTIFENSKYLTKLD----LSLLTIRLVSGKTHQIRACLN
RLUC_RICBR      PIKDQGEVKTNIEKSKGSIPKITINDNGKLAITYYKLLKSLTNN-----LFLVEFIPITGRMHQLRLHAK
Y956_HELPY      IEEER-EINAPILTFKTTKAFSKISKKGQEAVTIITPLKIINKKT------LLKVGIKTGRTHQIRVHLK
TRUC_VIBPA      IEE-EGVLDLKVELDKIADKFASQEKEAQEAVTAYKPLAKVTGKFPTTRYCLMEMKPKTGRKHQLRRHMA
YA32_SCHPO      PNSGEVICDAPLLTVAPTLGLNRIHPDGKEASTVFKRI-AFDGHT-----SLVLCKPLTGRTHQLRVHLQ
RLUC_RICFE      PIKNVGEVRSNIEKSKGSTPKITYSENGKLAITYYKLLKSLDNN-----LFLIEFTPVTGRMHQLRLHAK
PUS6_YEAST      ETTFEDTSKVTVEMTPPKRQFPVGLSTSKDAITKFYPIRYFSHADE----TVVACKPITGRTHQIRIHLA
PUS5_ORYSJ      LENDEVMITQPIGRYPGVAEGLAACSSGKPAMSKVRVLERLKIHNH----TLIQVEIHSGRPHQIRIHLA
TRUC_ECOL6      LME-EAVLDYPLEELDKIADKFAREDGPQPAVTHYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
YK27_CAEEL      FPDEEQVCEQPIGPLVISMGIQCVRPDGKDAKSRFRKLWS----DGTQ--SVVQVHIETGRTHQIRVHSQ
Y370_MYCGE      FN------------HLGLQTAYWKKDNNNGIVTKWKKISTFFENSAQKDMSLITIRLISGRTHQIRACLN
TRUC_PASMU      EGRIDYPLKVQLDK---IADKFAQDDKAQEAVTDYLGLAKVVKKYPTTRYSLVRLIPHTGRKHQLRRHMK
TRUC_HAEIN      KERIDYPLKIQLDK---IADKFSQEDKEQEAITDYEGLKIVAGRYQTARYSLVKLIPHTGRKHXLRXHMK
RLUC_RICPR      PVKNVGTVKSNIGKSKRRLSKIANSDDGKLAITYYXXXXXXXXXXXX-----IEFMPVTGRMHQLRLHAQ
YDL36_YEAST     FPETEVIVEKPLKLIEPRLALNAVCQMDEKGAKHAKTV--FNRISYDGKTSIVKCKPLTGRSHQIRVHLQ
TRUC_SHIFL      LME-EAVLDYPVEELDKIADKFAREDGPQPAVTHYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
TRUC_ECOLI      LME-EAVLDYPVEELDKIADKFAREDGPQPAVTHYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
TRUC_ECO57      LME-EAVLDYPVEELDKIADKFAREDGPQPAVTHYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
PUS5_CANAL      PESTQGTIDFPI----QALEKYRGKNKSREAVTHYKLIPSFPVFQQGPILPII-LELETGRKNQIRDHII
PUS3_ARATH      PKEKEGLISAPLSKDDGKTDRVVLAQGSQDAITEYKVLPKINGCSWVELRPI------TSRKHQLRVHCA
PUS7_ARATH      FPEDEMIVDANINYNGRSTAEDANSSGDDKKVKGKPACTKFTRIDTNGTHSLVSCEPVTGRTHQIRVHLQ
PUS5_ARATH      VEEDEVVIKQPIGRYPGVAQGLYVASPGKPAFSKVFVLE----RDREKNCSLVKVEIQSGRPHQIRIHLA
TRUC_VIBVU      IEE-EGELDLKVELDKIADKFASQEKEAQDAITLYKPLAKVTSKFPTTRYGLMELKPKTGRKHQLRRHMA
RUSD1_BOVIN     VQESRMTISYAIGKHTMCIEGTQGCENPKPSLTELVVLEH--GLYAGDPVSKVLLQPLTGRTHQLRVHCS
Y347_HELPY      VEKSM-KIDKPILTPQNIQKDLHIRSKGKQSITLVEPLSYNPFLD----ISLLKITPLTGRTHQIRLHLS
RLUC_RICTY      PVKNVGIVKSNIGKSKGRMFKITDSDNGKLAITYYXXXXXXXXXXXX-----IEFMPVTGRMHQLRLHAQ
RIB2_YEAST      FPIGIVEVDKPVRSVNPKVALNAVCEMSDENAKHAKTVFQRVSYDGQ--TSIVKCKPLTGRTHQIRVHLQ
RUSD2_HUMAN     FPTEEVTCKEPILVVSYKVGVCRVDPRGKPCETVFQRL-SYNGQS-----SVVRCRPLTGRTHQIRVHLQ
Y042_HAEIN      PKKKQGLIIGDMKKAREGAWKLC-QTKDNPAITRFESVSCEPN------LRLFILKPQTGKTHQLRVAMK
TRUC_SALTI      -----WLIDDAVLDYPLVEERDKIADAPQPAVTQYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
RUSD4_RAT       PLPSAGVVDIPIMEKEVAHHKMTLRDNGKVAVTQYQVL------SSTPSSALVELQPVTGIKHQLRVHLA
TRUC_SALTY      DDAV---LDYPVEERDKIADKFAREDAPQPAVTQYRGLATVTGRYPTTRYGLVELEPKTGRKHQXXXXXX
RUSD2_MOUSE     FPDKEVICKEPILVVSYKVGVCRVDPRGKPCETVFQRL-SYNGRS-----SVVQCRPLTGRTHQIRVHLQ
Y347_HELPJ      VDKINKPILTPQNIQKDLRIRSQISPLGKPSITLVEPLSYNPFLD----ISLLKITPLTGRTHQIRLHLS
Y1592_SYNY3     -------------------------------------------------------EIRTGRPHQIRIHLA
PUS3_ORYSJ      PKEREGIISAPLSKDDGKAERVILADGAQEAVTAYRVMPTIHGCSWIELRPL------TGRKHQLRVHCA
RUSD1_MOUSE     VQESQVTINYAIGRHTMCIEGTHGCENPKPSLTELLVLEH--GLYAGDPVSKVLLKPLTGRTHQLRVHCS
RUSD1_HUMAN     IQESRVTISHAIGRHTMCIEGSQGCENPKPSLTDLVVLEH--GLYAGDPVSKVLLKPLTGRTHQLRVHCS
PUS1_ARATH      PNWRRVTVSSGHGRSKHGAWRVAALDVGRPGGSFVRDMETTFXXXXXXXXXXXXCELESGRTHQIRLHCQ
RUSD4_DANRE     PVPSEGVIDIPVIERPQPHFKMALEDGXXXXXXXYQVLDNTSG------CSLVELQPLTGVKNQLRVHMA
RUSD1_DANRE     VTEENLSLDFAIGKNTTEGKTHMMCTEGTEGCENPKPCQTEVGTYDGDQVTKVLLQPLTGRTHQLRVHCS
PUS1_ORYSJ      PEKIK--ICSGHGRSKHGAWRVAMSDVGRDMSTRFEVLGIFREPSNFEVIILVRAYPQSGRTHQIRLHCQ
RUSD4_MOUSE     PLPSAGVVDIPIKQGPQQHHKMTLSDNGKVAVTQYQXXXXXXXXXXXEL------QPVTGIKHQLRVHLS
RUSD4_HUMAN     PMPSAGVVDIPIGQQQHHKMTLSMDDGAQVAVTQYQVLSSTLSS------ALVELQPITGIKHQLRVHLS
PUS5_YEAST      -GRFNKPNNYEIKYGP--KYNFLISHGGREITKFKEVDE-----------NCIVLQLVTGKKHQIRNHVS
PUS5_ASHGO      -----------------AREAKGLPSEGRDMITDYKRLEN----------DLVLLQLQTGRKHQIRKQMA
PUS4_ORYSJ      PRHPKGLLSAPLAKQDGKSERLTIRASSQDALTEYRVIESCP--QGYTWLELFP---RTGRKHQ------
RUSD4_BOVIN     PVPEAGVVDIPIQQHHHKMKMVRVRSNAQLAVTQYQVXXXXXXXXXXEL------QPITGIKHQLRVHMS
MLRR1_PLAF7     IKKKKGFINKSIQTHEYSHFSLVVKTGGTDAYTEYNCVKVY---------TLCNVKIHTGRTHQIRVHMR
RLUE_SALTI      PDN--AALQA-------LRTGVTLNDGGIEIVAEWLWPRTPPIRERKNITSWLKVTLYEGRNHQVRRMTA
PUS6_ARATH      --------------------------------------------------------LLTGKTHQIRAQLA
RUSD3_MOUSE     PEPSEGTVCMPLKMEQMNDVDLAVQEGVKRTLSRFHVMATGRG------CALVQLQPLTVFPNQLQVHMA
RUSD3_HUMAN     PAASEGKIQAALKLEHKAPSRKDILEGVKKTLSHFRVVATGSG------CALVQLQPLTVFSSQLQVHMV
PUS6_ORYSJ      --------------------------------------------------------LLTGKTHQIRAQLA
RUSD3_BOVIN     PVTSEGKIQAALKLEHQSPSRKDIMEGVKRTLSHFRVVATGSG------CALVQLQPLTVFPSQLQAHMA


                         .         .         .         .         *         .         .:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
RLUD_ZYMMO      SIGHSLLGDPVYGRSKKAHHALLQSLA------FQRQALHAAHLGFIHPISGKQVDFDAEMPQDMQLL--
YLYB_BACSU      YIGFPLAGDPKYGPR-KT-------------IDFNGQALHAGVLGFDHPRTGEYVEFEAPLPEDMAEL--
Y1629_SYNY3     QMGHPLVGDNLY------------TSPGSVNVNLPGQALHAHQLSLIHPVSGEIITAIAPMPAHFEKL--
RLUD_PSEAE      HIGYPLVGDPVYGGRFRIPASQTLVQ---TLREFPRQALHARFLELDHPATGVRMKWESPLPEDFLWLLS
Y901_CHLAA      HLGYPIVGDPVYGP-------------RRSHLHLSRQFLHAAYLGLVHPRSGRWQEFTAPLPADLQ----
RLUD_NITEU      SIGHPLAGDPVYG------RTSPDPSTADAVVRLPRQALHAWQLELTHPHSGQILLWESPLPDDMAALLQ
Y1758_AQUAE     SIGHPVLGDRTYG----FKSSSVPKELLSLMGEC--NMLIAYHLGFYHPTKGEWMVFEIEEPETFK----
RLUD_YERPE      HINHPLVGDQLYGPRPPKGASD---SFIAILRGFDRQALHATMLRLYHPIRGIQMEWHAALPEDMVELIN
RLUD_PASMU      HIAHPLLGDQTYGPRPPKNASE---ELMQTLRDFKRQALHAIMLRLAHPITGELMEWHAPLPTDFVELVE
RLUD_VIBVU      YLQHPLLGDAAYGGRARIPAG-ASEDVTAMIRNFDRQALHAVMLRFEHPITGEEMEFHAPVPDDMVELTE
RLUD_SHIFL      HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
RLUD_ECOLI      HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
RLUD_ECOL6      HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
RLUD_ECO57      HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
RLUD_SALTY      HITHPLVGDQVYGPRPPKGASE---EFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAPIPQDMVDLID
RLUD_SALTI      HITHPLVGDQVYGPRPPKGASE---EFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAPIPQDMVDLID
RLUD_XYLFA      HLRHPIVGDRLYGG--SLKLPKVGTDALVVLRGFKRQALHAEVLEFLHPVGALPVRIVAPVPEDLCQLLA
RLUD_XYLFT      HLRHPIVGDRLYGGSLKLPKG--GTDALVALRGFKRQALHAEVLEFLHPVRALPVRIVAPVPEDLCQLLA
RLUD_XANAC      HLKSPIVGDPLYGGALKLPKG-ATDELVHELRTFKRQALHAETLEFLHPVSGEPVRASAPVPADLQRLMT
RLUD_VIBPA      YLQHPLLGDTAYGARIPTGASQELTD---MIRGFDRQALHAVMLRFEHPITGEELEFHAPVPDDMVAMTE
RLUD_XANCP      HLKSPIVGDPLYGGALKLPKG-ATDTLVAELRGFKRQALHAETLEFLHPVSGEPIRASAPVPEDLQRLMS
Y723_CHLP8      HLGHSILGDETYGGATPRTLSKSEPFTRNLLELMSRQALHAQTLRFRQPTTGEPLSFSAPLPEDLEKIRT
RLUD_RALSO      SEGHPLLGDPVYTRNFRRGRPQ---TIKAPLAPFARQALHAVRLGLVHPASGQSVHWHAGVPDDLAELMD
RLUD_HAEIN      HIAHPLLGDQTYGPRPPKNASE---DFMEVLRNFKRQALHAVMLRLAHPITGEMMEWYAPLPDDFVELLN
RLUD_HAEDU      HIAHPLLGDQLYG----GRPRPPKGSSEAFLTVLQRQALHATMLRLEHPINGELIECHAPLPADFVELIE
PUS2_ORYSJ      YLGIPLLGDETYGGTKSMALSLLRPDLSNMISKIDRPCLHAALLGFKHPHSGKILEFSCPPPDD------
RLUD_BUCAI      HIKYPLVGDPCYS-GFKIQSNYRKDKKTNKIYKFPRQALHANHLSLHHPIKKNVMSWTVPLPQDIQEL--
RLUD_NEIMA      EANHPLAGDPVYG----NPRHPCGDTVKEAVKSLGRQALHAYRLSFTHPESGETVSFEAPIPDDIYHLLS
RLUD_NEIMB      EANHPLAADPVYG----NPRHPCGDTVKEAVKSLGRQALHAYRLSFTHPESGETVSFEAPIPNDIYHLLS
PUS2_ARATH      YMGVPLLGDEVYGGTKSMALSLLQKRVSRSISRMDRPCLHAIVLGFTHPCTGEIVKFSCPPPSDLAEIVG
RLUD_BUCBP      YINFPLVGDKTYGNKFKF-YKNISLTLLEQVKKFPRQALHASRLCLYHPVTKHLMEWNSTLPRDMLNLIA
RLUD_VIBCH      YLQHPLLGDTAYGGRARIPKGATE-ELTEMIRDFDRQALHAVMLKFEHPVTGEELEFHAPVPDDMVEMTL
RLUD_BLOFL      YINHPLVGDQKYKGNFSVDIKKMSDELNNYLLDFNRQALHACTLQLLHPITQVQMKWNAPLPQDILQLIA
YHCT_BACSU      SLGHPLTGDSLYGGGSKL---------------LNRQALHANKVQAVHPITDELIVAEAPFPADMKNL--
RLUD_BUCAP      HXXXXXXXXXXXXXYFQENRNIYRK------FNLFRQALHADYIEFIHPFTQKVMSWSASLPQDMK----
YJBO_BACSU      YLGHPLCGDTLYG---------------GTRQEIGRQALHSEHLSFIHPLTQENMRFHAPLPQDMSKL--
Y1567_MYCBO     ALHHPCCGDLVYGADPKL----------AKRLGLDRQWLHARSLAFAHPADGRRVEIVSPYPADLQ----
Y1540_MYCTU     ALHHPCCGDLVYGADPKL----------AKRLGLDRQWLHARSLAFAHPADGRRVEIVSPYPADLQ----
RLUD_BORBU      YLNFPILGDEVYG---------------------------------------------------------
Y505_ZYMMO      GLGLPIVGDPFYGSHKDENISRM-----------------------------------------------
RLUC_SALTI      YAGHPIAFDDRYGDR------EFDQQLTEAGTGLKRLFLHAAALKFTHPGTGDVMRIEAPMDKQLKR---
RLUC_SALTY      YAGHPIAFDDRYGDR------EFDQQLTEAGTGLKRLFLHAAALKFTHPGTGEVMRIEAPMDNALKR---
Y292_MYCPN      FIKHPVYNDPLYG----LKSEQ--------ATEYG-QYLHAQQISFIHPTLNKEMGFEAQL---------
RLUC_ECOL6      YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKR---
RLUC_SHIFL      YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKR---
RLUC_ECOLI      YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKR---
RLUC_PASMU      YAGHPIALDDKYGKHFDEQMTQL---------GLTRLFLHAFSIRFEHPKTGETLRINAPLDPEMKKILG
RLUC_ECO57      YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDDGLKR---
RLUC_VIBPA      YTGHPIAWDDRYGDR--------RFDAYTGQLGLDRLFLHAANIKFQHPSNDEWMEINAPMESKLEKVLV
RLUA_SHIFL      ALGHPILGDRFYA----------SPEARAMAP---RLLLHAEMLTITHPAYGNSMTFKA--PAD------
RLUA_ECOLI      ALGHPILGDRFYA----------SPEARAMAP---RLLLHAEMLTITHPAYGNSMTFKA--PAD------
RLUA_ECOL6      ALGHPILGDRFYA----------SPEARAMAP---RLLLHAEMLTITHPAYGNSMTFKA--PAD------
Y745_HELPJ      YLNRHIIGDNLYGLNGVLSKEEI------------RIMLHAYLIEFKHPRSEQKLRFKVPLLKDM-----
RLUC_HAEIN      YAGHPIALDDKYGKDFDKQMNEL---------GLNRLFLHAFSIRFEHPKNGETLRFNASLDHQMKAI--
Y745_HELPY      YLNRHIIGDNLYGLNGALPKEEI------------RIMLHAYLIEFKHPRSEQKLRFKVPLLKDM-----
RLUC_VIBVU      YSGHPIAWDDRYGDR--------RFDAYTAQHGLNRLFLHAANIRFTHPATEQPMEINAPMGEQLEKVVQ
RLUC_VIBCH      YMGHPIAWDDRYGDR--------RFDAYTAQFGIERLFLHAANIQFVHPASEKKLEIHAPLEAHLEQ---
RLUA_SALTI      ALGHPILGDQFYA---SPEALSLAP----------RLQLHAEMLTITHPAYGNSMTFK--VPAD------
RLUC_HAEDU      YAGHPIACDDRYGDQ--------AFDAKLKQAGLNRLFLHAHSIRFEHPKTAEQMFITAPLDHHLKTILA
RLUA_SALTY      ALGHPILGDRFYA---SPEALSLAP----------RLQLHAEMLTITHPAYGNSMTFK--VPAD------
RLUA_ECO57      ALGHPILGDRFYA----------SPEARAMAP---RLLLHAEMLTITHPAYGNSMTFKA--PAD------
RLUC_YERPE      HAGHPIAFDDRYG--YREFDQQLQG------TGXXXXXXXXXXXXXEHPNTGETMRIEAPLDNQLRHCLL
TRUC_YERPE      HIRHPIIGDSTHG--------DLRQNRGVAQFGCSRLMLHASHLHLNHPVTGEALTWDSGIAPHLERVEF
RLUA_PASMU      ALGHPILGDKFYAP---PQAKALSP----------RLCLHAEQLAFRHPITQEWLSFSA-----------
RLUC_BUCBP      HLNYPIVLDAKYG---------------------------------------------------------
RLUA_VIBVU      ALGHPIVGDEFYA-------------QGDAFTFSERLELHAAELSFYHPKS-------------------
RLUA_VIBCH      SLGHPIVGDDLYAP----------PE---AVEFADRLQLHAAELCFYHP---------------------
RLUC_BUCAP      HAGHPILFDKRYGKNIKNK------------TKINRLLLHATSINFIHPETGK-----------------
RLUA_YERPE      AMGHPILGDGFYAPEAKAMASRLQ--------------LHAQQLCITHPEFG------------------
RLUA_VIBPA      ALGHPIVGDEFYATEEAKVFSE-------------RLELHASELSFYHPKS-------------------
RLUA_HAEIN      ALGHPILGDKFYS---HPQAKVMSP----------RLCLHAEELTITHPITGETMTFNA-----------
RLUA_HAEDU      ALGHPIIGDKFYA---NPLAKSLAP----------RLCLHAESLTIAHPISAELMTFNT-----------
PUS4_ARATH      EVGTPIVGDYKYG---------------------------------------------------------
TRUC_HAEDU      HLFHPIMGDTKYGDLHQNRRLTEK-------TGCNRLMLHARLLHFTHPKT-------------------
PUS7_ORYSJ      HIGYPIANDEVYSENFSPRSSK------------------------------------------------
RLUC_BUCAI      HAGHPIFFDKRYG------KNDLDADIKNN-HKINRLLLHSSGVHFIHPKNGNKIYIKAPLDIDFQ----
TRUC_VIBCH      HLRHPIVGDTTHGDGVHNRLFREHFSAQ-------RLMLHASELRFMHPYTQQPLVIRAGL---------
Y209_MYCGE      FIQHPVYNDPLYGIKSEKK-------------DSYGQFLHANRICFIHPTLNKPMDFHAPL---------
RLUC_PSEAE      HAGHAIAGDPKYGDE----------DFSREIRELGRLFLHAAQLRVPLPD-GQVLELEA-----------
TRUC_PECCC      HIHHPIIGDTAHGDLRHNRGME-------SHFSCGRLMLHASELQLNHPVSGQ-----------------
Y956_HELPJ      HINHPIIGDTLY----------------------------------------------------------
RUSD4_XENTR     GLNCPILGDHKYS-HWGRLAPQKPPD--SVLRALGTLSLHLHAVQLTLPSS-------------------
RLUC_RICCN      LLGCPILGDDKYG---------------------------------------------------------
Y548_MYCPN      LLNTQLVGDRKY------QLLQFKNRNR----DFKHQALHA-----------------------------
RLUC_RICBR      LLGCPIFGDNKYG------NDKLMPYSKYMF-------LHANNIVLSKKVFGKEVNLEAKLPSYFNRV--
Y956_HELPY      HINHPIIGDTLY----------------------------------------------------------
TRUC_VIBPA      HLRHPIVGDTSHGDGKHNKLFRNEFDSH-------RLLLHASELRFVHPFTNEELVMKASI---------
YA32_SCHPO      YLGYPIANDPIYGPSLGKNGEGSNESVIMRLSEIGKTETASPLLQYE-----------------------
RLUC_RICFE      LLGCPIVGDDKYG---------------------------------------------------------
PUS6_YEAST      RLGHPIVNDSVYCSHITKYPERLK----------------------------------------------
PUS5_ORYSJ      YIGHPLVDDPLYGIGGQPKFDEPEPTSTAVPGDCGYH-LHAHWLVLCHPTTNEMIKITAPLP--------
TRUC_ECOL6      XXXXPIIGDSKHGDLRQNRSG-------AEHFGLQRLMLHASQLSLTHPFTGEPLAIHAGL---------
YK27_CAEEL      FLGHPIAGDQIY----------------------------------------------------------
Y370_MYCGE      LFSNQLVGDKKYSIQFKNRNNKYK-----------HQALHAYELVFPKLETSK-----------------
TRUC_PASMU      HLFHPILGDTQYGDLHQNRALTTH-------TGVQRLMLHAERLIFTHPITQQQITICAGV---------
TRUC_HAEIN      HVFHPIXGDTQYGDLHQN---------RALMSHLGRLFLHSDSLSFIHPITKEQITITAGLDEQWQQL--
RLUC_RICPR      LLGCPILGDDKYG------NKEIMPYSKYMF-------LHANNIYLSETIVGKEIKLEAKLP--------
YDL36_YEAST     YLGHPIANDPIY----------------------------------------------------------
TRUC_SHIFL      XXXXPIIGDSKHGDLRQNRSG-------AEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGL---------
TRUC_ECOLI      XXXXPIIGDSKHGDLRQNRSG-------AEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGL---------
TRUC_ECO57      XXXXPIIGDSKHGDLRQNRSG-------AEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGL---------
PUS5_CANAL      QFGVPLLNDDNFS-DFKLN-SEIPKDVNSKLYKSNQIALHSGLVIMENNGTSQ-----------------
PUS3_ARATH      ELGTPIVGDYKYG---------------------------------------------------------
PUS7_ARATH      YTGHPIANDPLY----------------------------------------------------------
PUS5_ARATH      YMGHPLVGDPLYGGQPKCFDPDLVDDAAAFAEDGG-----------------------------------
TRUC_VIBVU      HLRHPIVGDTTHGDGKHNKLFREEFDA-------PRLLLHASELRFVHPYTQQEV---------------
RUSD1_BOVIN     ALGHPIVGDLTYG---------------------------------------------------------
Y347_HELPY      SVDHRIVGEGLYG---------------------------------------------------------
RLUC_RICTY      LLGCPILGDDKYG------NKEVMPYSKYMF-------LHANNIYLSESIVGKEIKLEAKLP--------
RIB2_YEAST      YLGFPIANDPIYS----------NPDIWG--PDLGRGGLQNY----------------------------
RUSD2_HUMAN     FLGHPILNDPIY----------------------------------------------------------
Y042_HAEIN      SLGSPILGDGLYG---------------------------------------------------------
TRUC_SALTI      XXXXPIIGDSKHGDLRQNRSAAEHFACR-------RLMLHASRLELTHPFTGQPLIIQAGL---------
RUSD4_RAT       FLDCPILGDHKYSDWNRLAPQKL---SAGTLKKLGLQQLHARQLIL------------------------
TRUC_SALTY      XXXXPIIGDSKHGDLRQNRSAAEHFACR-------RLMLHASRLELTHPFTGQPLIIQAGL---------
RUSD2_MOUSE     FLGHPILNDPIY----------------------------------------------------------
Y347_HELPJ      SVDHRIVGEGLYG---------------------------------------------------------
Y1592_SYNY3     SLGYPLLGDRLYGP------GGVPINCRTARPSDGGYTLHSYQLGFLHLHTQQAIKLTAPLPPEL-----
PUS3_ORYSJ      ELGTPIVGDYKYG---------------------------------------------------------
RUSD1_MOUSE     ALGHPIVGDLTYG---------------------------------------------------------
RUSD1_HUMAN     ALGHPVVGDLTYG---------------------------------------------------------
PUS1_ARATH      YLGIPIRGDVKYHGVYEWNGRTFE-----------GHELHAECLSLDHPVTGDSIVIRAPLP--------
RUSD4_DANRE     ALTCPILGDHKYS-HWSKLAPQKLPE--------------------------------------------
RUSD1_DANRE     AIGHPIVGDYTY---------SLRTD-----NSPYRMMLHAYFL--------------------------
PUS1_ORYSJ      YLGFPIRGDVKYSGVIEWNG-----------VDYDGHALHAESLSFVHPVTGLPVTFRSPLPS-------
RUSD4_MOUSE     FLDCPILGDHKYSDWTRLAPQKL---SAGTLKKLGLQQLHARQLIL------------------------
RUSD4_HUMAN     FLDCPILGDHKY----------------------------------------------------------
PUS5_YEAST      QINQPILNDKRHGSTVNFPEDQIALHSACIITKIGLQT-KTHLIPMEHNNTGQL----------------
PUS5_ASHGO      QVGQPVVNDKMYG---------------------------------------------------------
PUS4_ORYSJ      ----------------------------------------------------------------------
RUSD4_BOVIN     FLDCPILGDHKY----------------------------------------------------------
MLRR1_PLAF7     HIGHPLVSDKKY----------------------------------------------------------
RLUE_SALTI      HVGHPTL---------------------------------------------------------------
PUS6_ARATH      ACGAPLVGDSMYMP--------------------------------------------------------
RUSD3_MOUSE     LQLCPILGDHTYAARVGTVLGQ------------------------------------------------
RUSD3_HUMAN     LQLCPVLGDHMYSARVGTVLGQ------------------------------------------------
PUS6_ORYSJ      AIGTPIVGDSAY----------------------------------------------------------
RUSD3_BOVIN     LQLCPVLGDHTYSARVGTVLGQ------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ALTATE
RLUD_ZYMMO      ------
YLYB_BACSU      ------
Y1629_SYNY3     ------
RLUD_PSEAE      LL----
Y901_CHLAA      ------
RLUD_NITEU      AI----
Y1758_AQUAE     ------
RLUD_YERPE      ALKA--
RLUD_PASMU      ALKA--
RLUD_VIBVU      TL----
RLUD_SHIFL      VMRA--
RLUD_ECOLI      VMRA--
RLUD_ECOL6      VMRA--
RLUD_ECO57      VMRA--
RLUD_SALTY      AMRA--
RLUD_SALTI      AMRA--
RLUD_XYLFA      VL----
RLUD_XYLFT      AL----
RLUD_XANAC      VL----
RLUD_VIBPA      AL----
RLUD_XANCP      AL----
Y723_CHLP8      VMTASQ
RLUD_RALSO      AL----
RLUD_HAEIN      ALKA--
RLUD_HAEDU      AL----
PUS2_ORYSJ      ------
RLUD_BUCAI      ------
RLUD_NEIMA      VL----
RLUD_NEIMB      VL----
PUS2_ARATH      LL----
RLUD_BUCBP      LL----
RLUD_VIBCH      AL----
RLUD_BLOFL      IL----
YHCT_BACSU      ------
RLUD_BUCAP      ------
YJBO_BACSU      ------
Y1567_MYCBO     ------
Y1540_MYCTU     ------
RLUD_BORBU      ------
Y505_ZYMMO      ------
RLUC_SALTI      ------
RLUC_SALTY      ------
Y292_MYCPN      ------
RLUC_ECOL6      ------
RLUC_SHIFL      ------
RLUC_ECOLI      ------
RLUC_PASMU      AL----
RLUC_ECO57      ------
RLUC_VIBPA      GL----
RLUA_SHIFL      ------
RLUA_ECOLI      ------
RLUA_ECOL6      ------
Y745_HELPJ      ------
RLUC_HAEIN      ------
Y745_HELPY      ------
RLUC_VIBVU      SL----
RLUC_VIBCH      ------
RLUA_SALTI      ------
RLUC_HAEDU      KLRA--
RLUA_SALTY      ------
RLUA_ECO57      ------
RLUC_YERPE      AL----
TRUC_YERPE      PLTASQ
RLUA_PASMU      ------
RLUC_BUCBP      ------
RLUA_VIBVU      ------
RLUA_VIBCH      ------
RLUC_BUCAP      ------
RLUA_YERPE      ------
RLUA_VIBPA      ------
RLUA_HAEIN      ------
RLUA_HAEDU      ------
PUS4_ARATH      ------
TRUC_HAEDU      ------
PUS7_ORYSJ      ------
RLUC_BUCAI      ------
TRUC_VIBCH      ------
Y209_MYCGE      ------
RLUC_PSEAE      ------
TRUC_PECCC      ------
Y956_HELPJ      ------
RUSD4_XENTR     ------
RLUC_RICCN      ------
Y548_MYCPN      ------
RLUC_RICBR      ------
Y956_HELPY      ------
TRUC_VIBPA      ------
YA32_SCHPO      ------
RLUC_RICFE      ------
PUS6_YEAST      ------
PUS5_ORYSJ      ------
TRUC_ECOL6      ------
YK27_CAEEL      ------
Y370_MYCGE      ------
TRUC_PASMU      ------
TRUC_HAEIN      ------
RLUC_RICPR      ------
YDL36_YEAST     ------
TRUC_SHIFL      ------
TRUC_ECOLI      ------
TRUC_ECO57      ------
PUS5_CANAL      ------
PUS3_ARATH      ------
PUS7_ARATH      ------
PUS5_ARATH      ------
TRUC_VIBVU      ------
RUSD1_BOVIN     ------
Y347_HELPY      ------
RLUC_RICTY      ------
RIB2_YEAST      ------
RUSD2_HUMAN     ------
Y042_HAEIN      ------
TRUC_SALTI      ------
RUSD4_RAT       ------
TRUC_SALTY      ------
RUSD2_MOUSE     ------
Y347_HELPJ      ------
Y1592_SYNY3     ------
PUS3_ORYSJ      ------
RUSD1_MOUSE     ------
RUSD1_HUMAN     ------
PUS1_ARATH      ------
RUSD4_DANRE     ------
RUSD1_DANRE     ------
PUS1_ORYSJ      ------
RUSD4_MOUSE     ------
RUSD4_HUMAN     ------
PUS5_YEAST      ------
PUS5_ASHGO      ------
PUS4_ORYSJ      ------
RUSD4_BOVIN     ------
MLRR1_PLAF7     ------
RLUE_SALTI      ------
PUS6_ARATH      ------
RUSD3_MOUSE     ------
RUSD3_HUMAN     ------
PUS6_ORYSJ      ------
RUSD3_BOVIN     ------