[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37664.1

[Show Plain Result]


## Summary of Sequence Search
    1::279
    1::279     e-155 100%  279 aa  Y426_RHOPS RecName: Full=Putative phosphotransferase RPD_0426;     
    1::279     e-150  96%  279 aa  Y300_RHOPT RecName: Full=Putative phosphotransferase Rpal_0300;    
    1::279     e-150  96%  279 aa  Y298_RHOPA RecName: Full=Putative phosphotransferase RPA0298;      
    1::279     e-145  94%  279 aa  Y395_RHOP2 RecName: Full=Putative phosphotransferase RPB_0395;     
    1::279     e-139  89%  279 aa  Y380_RHOP5 RecName: Full=Putative phosphotransferase RPE_0380;     
    2::277     e-138  89%  279 aa  Y294_RHOPB RecName: Full=Putative phosphotransferase RPC_0294;     
    1::279     e-135  85%  279 aa  Y161_BRASB RecName: Full=Putative phosphotransferase BBta_0161;    
    1::279     e-134  85%  279 aa  Y199_BRASO RecName: Full=Putative phosphotransferase BRADO0199;    
    6::280     e-132  86%  280 aa  Y112_NITHX RecName: Full=Putative phosphotransferase Nham_0112;    
    6::277     e-128  83%  280 aa  Y102_NITWN RecName: Full=Putative phosphotransferase Nwi_0102;     
    1::279     e-122  79%  279 aa  Y637_BRAJA RecName: Full=Putative phosphotransferase blr0637;      
    4::281     e-121  81%  283 aa  Y4385_OLICO RecName: Full=Putative phosphotransferase OCAR_4385;   
    6::268     5e-86  55%  273 aa  Y001_RHIEC RecName: Full=Putative phosphotransferase RHE_CH00001;  
    6::268     8e-86  55%  273 aa  Y3935_RHILW RecName: Full=Putative phosphotransferase Rleg2_3935;  
    6::268     2e-85  55%  273 aa  Y001_RHIL3 RecName: Full=Putative phosphotransferase RL0001;       
    6::268     3e-85  55%  273 aa  Y002_RHIE6 RecName: Full=Putative phosphotransferase
    6::268     2e-84  52%  273 aa  Y4488_RHILO RecName: Full=Putative phosphotransferase mlr4488;     
    6::270     6e-84  55%  273 aa  Y001_AGRVS RecName: Full=Putative phosphotransferase Avi_0001;     
    6::268     4e-83  54%  273 aa  Y001_AGRT5 RecName: Full=Putative phosphotransferase Atu0001;      
   12::275     2e-82  54%  279 aa  Y2974_MARMM RecName: Full=Putative phosphotransferase Mmar10_2974; 
    6::268     3e-81  55%  273 aa  Y3350_RHISN RecName: Full=Putative phosphotransferase NGR_c33500;  
    6::268     8e-81  54%  273 aa  Y3209_SINMW RecName: Full=Putative phosphotransferase Smed_3209;   
    6::268     1e-80  54%  273 aa  Y001_RHIME RecName: Full=Putative phosphotransferase R00001;       
    1::277     3e-80  49%  279 aa  Y008_BARBK RecName: Full=Putative phosphotransferase
    1::268     2e-78  51%  280 aa  Y001_BARQU RecName: Full=Putative phosphotransferase BQ00010;      
    6::267     2e-76  52%  272 aa  Y3478_MESSB RecName: Full=Putative phosphotransferase Meso_3478;   
   42::305     8e-76  52%  315 aa  Y001_CAUCR RecName: Full=Putative phosphotransferase CC_0001;      
   10::276     1e-75  50%  280 aa  Y001_HYPNA RecName: Full=Putative phosphotransferase HNE_0001;     
    1::268     2e-74  50%  274 aa  Y001_BART1 RecName: Full=Putative phosphotransferase BT_0001;      
    2::267     3e-73  50%  270 aa  Y2842_SPHAL RecName: Full=Putative phosphotransferase Sala_2842;   
    8::268     6e-73  51%  274 aa  Y001_BARHE RecName: Full=Putative phosphotransferase BH00010;      
    5::267     4e-72  50%  280 aa  Y117_NOVAD RecName: Full=Putative phosphotransferase Saro_0117;    
    5::267     3e-71  49%  278 aa  YD000_ERYLH RecName: Full=Putative phosphotransferase ELI_13000;   
    6::261     3e-71  49%  276 aa  Y853_OCHA4 RecName: Full=Putative phosphotransferase Oant_0853;    
    6::261     4e-71  49%  279 aa  Y2113_BRUC2 RecName: Full=Putative phosphotransferase BCAN_A2113;  
    6::261     4e-71  49%  279 aa  Y2068_BRUA2 RecName: Full=Putative phosphotransferase BAB1_2068;   
    6::261     4e-71  49%  279 aa  Y2067_BRUSU RecName: Full=Putative phosphotransferase BR2067;      
    6::261     4e-71  49%  279 aa  Y2060_BRUME RecName: Full=Putative phosphotransferase BMEI2060;    
    6::261     4e-71  49%  279 aa  Y2042_BRUAB RecName: Full=Putative phosphotransferase BruAb1_2042; 
    6::261     4e-71  49%  279 aa  Y1987_BRUO2 RecName: Full=Putative phosphotransferase BOV_1987;    
    6::261     7e-71  49%  279 aa  Y2129_BRUMB RecName: Full=Putative phosphotransferase BMEA_A2129;  
    5::267     2e-67  47%  274 aa  Y2832_SPHWW RecName: Full=Putative phosphotransferase Swit_2832;   
   35::294     8e-62  46%  311 aa  Y4549_MAGSA RecName: Full=Putative phosphotransferase amb4549;     
    6::286     2e-61  47%  292 aa  Y2476_ACICJ RecName: Full=Putative phosphotransferase Acry_2476;   
   21::292     2e-59  43%  297 aa  Y003_GRABC RecName: Full=Putative phosphotransferase
    7::266     6e-58  45%  275 aa  Y3615_RHORT RecName: Full=Putative phosphotransferase Rru_A3615;   
    5::263     3e-52  42%  270 aa  Y324_NEOSM RecName: Full=Putative phosphotransferase NSE_0324;     
    9::276     2e-51  40%  279 aa  Y316_ANAMM RecName: Full=Putative phosphotransferase AM316;        
    7::267     2e-51  38%  272 aa  Y486_WOLPP RecName: Full=Putative phosphotransferase WP0486;       
    9::276     2e-51  40%  279 aa  Y235_ANAMF RecName: Full=Putative phosphotransferase AMF_235;      
    8::272     1e-50  37%  273 aa  Y205_EHRRW RecName: Full=Putative phosphotransferase
    6::270     1e-50  38%  273 aa  Y005_RICRS RecName: Full=Putative phosphotransferase A1G_00005;    
    6::270     1e-50  38%  273 aa  Y001_RICRO RecName: Full=Putative phosphotransferase RrIowa_0001;  
    6::270     1e-50  38%  273 aa  Y001_RICCN RecName: Full=Putative phosphotransferase RC0001;       
    8::272     3e-50  37%  273 aa  Y202_EHRRG RecName: Full=Putative phosphotransferase
    6::270     3e-50  38%  273 aa  Y001_RICAE RecName: Full=Putative phosphotransferase RAF_ORF0001;  
    7::268     3e-50  38%  269 aa  Y450_GEOSL RecName: Full=Putative phosphotransferase GSU0450;      
    7::267     3e-50  36%  276 aa  Y4470_WOLWR RecName: Full=Putative phosphotransferase WRi_004470;  
    7::267     3e-50  36%  276 aa  Y341_WOLPM RecName: Full=Putative phosphotransferase WD_0341;      
    2::267     3e-50  39%  269 aa  Y3384_GEOMG RecName: Full=Putative phosphotransferase Gmet_3384;   
    6::270     3e-50  37%  273 aa  Y001_RICFE RecName: Full=Putative phosphotransferase RF_0001;      
    7::267     4e-50  36%  272 aa  Y633_WOLTR RecName: Full=Putative phosphotransferase Wbm0633;      
    6::263     4e-50  39%  273 aa  Y001_RICM5 RecName: Full=Putative phosphotransferase RMA_0001;     
    8::266     6e-50  37%  273 aa  Y895_EHRCR RecName: Full=Putative phosphotransferase ECH_0895;     
    6::270     1e-49  37%  273 aa  Y001_RICTY RecName: Full=Putative phosphotransferase RT0001;       
    6::270     1e-49  38%  273 aa  Y005_RICAH RecName: Full=Putative phosphotransferase A1C_00005;    
    5::266     2e-49  39%  274 aa  Y343_PELUB RecName: Full=Putative phosphotransferase SAR11_0343;   
    6::271     3e-49  38%  274 aa  Y005_RICPU RecName: Full=Putative phosphotransferase RPR_00005;    
    6::270     3e-49  37%  273 aa  Y001_RICPR RecName: Full=Putative phosphotransferase RP001;        
    8::271     4e-49  36%  273 aa  Y3081_DESHY RecName: Full=Putative phosphotransferase DSY3081;     
    8::266     5e-49  36%  273 aa  Y207_EHRCJ RecName: Full=Putative phosphotransferase Ecaj_0207;    
    8::271     1e-48  36%  273 aa  Y4252_DESHD RecName: Full=Putative phosphotransferase Dhaf_4252;   
    6::263     1e-48  38%  273 aa  Y005_RICB8 RecName: Full=Putative phosphotransferase A1I_00005;    
    6::263     3e-48  37%  273 aa  Y001_RICBR RecName: Full=Putative phosphotransferase RBE_0001;     
    4::261     8e-47  38%  269 aa  Y4292_GEOUR RecName: Full=Putative phosphotransferase Gura_4292;   
    4::261     2e-46  39%  269 aa  Y410_GEOSF RecName: Full=Putative phosphotransferase Geob_0410;    
    4::263     5e-46  36%  269 aa  Y997_GEOLS RecName: Full=Putative phosphotransferase Glov_0997;    
    2::263     5e-46  35%  270 aa  Y242_GEOBB RecName: Full=Putative phosphotransferase Gbem_0242;    
    2::263     6e-46  35%  270 aa  Y226_GEOSM RecName: Full=Putative phosphotransferase GM21_0226;    
    9::265     1e-45  38%  280 aa  Y961_ANAPZ RecName: Full=Putative phosphotransferase APH_0961;     
    6::270     3e-45  35%  273 aa  Y005_RICCK RecName: Full=Putative phosphotransferase A1E_00005;    
    4::269     1e-44  34%  280 aa  Y2958_PELPD RecName: Full=Putative phosphotransferase Ppro_2958;   
    4::272     4e-44  34%  281 aa  Y1093_BDEBA RecName: Full=Putative phosphotransferase Bd1093;      
    8::269     1e-43  32%  277 aa  Y3020_ALKMQ RecName: Full=Putative phosphotransferase Amet_3020;   
    7::265     7e-43  32%  273 aa  Y585_SYMTH RecName: Full=Putative phosphotransferase STH585;       
    6::262     1e-42  35%  275 aa  Y743_LACBA RecName: Full=Putative phosphotransferase LVIS_0743;    
    8::268     4e-42  31%  277 aa  Y1257_ALKOO RecName: Full=Putative phosphotransferase Clos_1257;   
  118::394     4e-42  36%  403 aa  PDRP1_ARATH RecName: Full=Pyruvate, phosphate dikinase regulatory
   13::273     3e-41  34%  280 aa  Y1326_LACJO RecName: Full=Putative phosphotransferase LJ_1326;     
    7::263     5e-41  34%  266 aa  Y2242_CLOPE RecName: Full=Putative phosphotransferase CPE2242;     
    7::263     5e-41  34%  266 aa  Y076_CLOPS RecName: Full=Putative phosphotransferase CPR_0076;     
    7::270     1e-40  30%  271 aa  Y1520_STRU0 RecName: Full=Putative phosphotransferase SUB1520;     
   14::281     1e-40  34%  285 aa  Y1256_LACDA RecName: Full=Putative phosphotransferase Ldb1256;     
   13::273     1e-40  34%  280 aa  Y1123_LACGA RecName: Full=Putative phosphotransferase LGAS_1123;   
    6::261     2e-40  33%  274 aa  Y1494_LISIN RecName: Full=Putative phosphotransferase lin1494;     
    6::261     2e-40  33%  274 aa  Y1476_LISMF RecName: Full=Putative phosphotransferase
    6::261     2e-40  33%  274 aa  Y1457_LISMO RecName: Full=Putative phosphotransferase lmo1457;     
   14::281     2e-40  34%  285 aa  Y1174_LACDB RecName: Full=Putative phosphotransferase LBUL_1174;   
   13::270     2e-40  32%  277 aa  Y442_CARHZ RecName: Full=Putative phosphotransferase CHY_0442;     
    6::261     3e-40  33%  274 aa  Y1472_LISW6 RecName: Full=Putative phosphotransferase lwe1472;     
    7::262     4e-40  35%  268 aa  Y2438_PELCD RecName: Full=Putative phosphotransferase Pcar_2438;   
   45::272     4e-40  36%  279 aa  Y1306_LACH4 RecName: Full=Putative phosphotransferase lhv_1306;    
    6::265     4e-40  35%  265 aa  Y1143_LACSS RecName: Full=Putative phosphotransferase LSA1143;     
    9::264     4e-40  33%  272 aa  Y1055_STRSV RecName: Full=Putative phosphotransferase SSA_1055;    
   11::265     7e-40  35%  280 aa  Y872_LACSS RecName: Full=Putative phosphotransferase LSA0872;      
    8::266     7e-40  33%  273 aa  Y1193_STAS1 RecName: Full=Putative phosphotransferase SSP1193;     
    8::271     2e-39  32%  271 aa  Y1353_STAHJ RecName: Full=Putative phosphotransferase SH1353;      
   44::271     2e-39  37%  278 aa  Y1206_LACAC RecName: Full=Putative phosphotransferase LBA1206;     
    8::269     2e-39  31%  280 aa  Y2411_CLOD6 RecName: Full=Putative phosphotransferase CD2411;      
    2::264     2e-39  33%  272 aa  Y1974_LACPL RecName: Full=Putative phosphotransferase lp_1974;     
    1::272     3e-39  36%  272 aa  Y2169_STAEQ RecName: Full=Putative phosphotransferase SERP2169;    
    1::272     3e-39  36%  272 aa  Y2159_STAES RecName: Full=Putative phosphotransferase SE_2159;     
    7::269     3e-39  32%  270 aa  Y1026_ENTFA RecName: Full=Putative phosphotransferase EF_1026;     
    7::262     4e-39  33%  270 aa  Y812_STRGC RecName: Full=Putative phosphotransferase SGO_0812;     
    8::263     6e-39  33%  272 aa  Y1664_STAA8 RecName: Full=Putative phosphotransferase
    8::263     6e-39  33%  272 aa  Y1620_STAAC RecName: Full=Putative phosphotransferase SACOL1620;   
    8::263     6e-39  33%  272 aa  Y1565_STAAT RecName: Full=Putative phosphotransferase
    8::263     6e-39  33%  272 aa  Y1523_STAA3 RecName: Full=Putative phosphotransferase
    8::263     6e-39  33%  272 aa  Y1466_STAAE RecName: Full=Putative phosphotransferase NWMN_1466;   
    6::263     8e-39  31%  276 aa  Y1738_LACCB RecName: Full=Putative phosphotransferase LCABL_17380; 
    8::263     8e-39  33%  272 aa  Y1655_STAA2 RecName: Full=Putative phosphotransferase SaurJH1_1655;
    8::263     8e-39  33%  272 aa  Y1640_STAAR RecName: Full=Putative phosphotransferase SAR1640;     
    8::263     8e-39  33%  272 aa  Y1621_STAA9 RecName: Full=Putative phosphotransferase SaurJH9_1621;
    8::263     8e-39  33%  272 aa  Y1563_STAAM RecName: Full=Putative phosphotransferase SAV1563;     
    8::263     8e-39  33%  272 aa  Y1550_STAA1 RecName: Full=Putative phosphotransferase SAHV_1550;   
    6::263     8e-39  31%  276 aa  Y1522_LACC3 RecName: Full=Putative phosphotransferase LSEI_1522;   
    8::263     8e-39  33%  272 aa  Y1515_STAAW RecName: Full=Putative phosphotransferase MW1515;      
    8::263     8e-39  33%  272 aa  Y1501_STAAS RecName: Full=Putative phosphotransferase SAS1501;     
    8::263     8e-39  33%  272 aa  Y1435_STAAB RecName: Full=Putative phosphotransferase SAB1435c;    
    8::263     8e-39  33%  272 aa  Y1392_STAAN RecName: Full=Putative phosphotransferase SA1392;      
    8::266     1e-38  34%  272 aa  Y1250_STAES RecName: Full=Putative phosphotransferase SE_1250;     
    8::266     1e-38  34%  272 aa  Y1129_STAEQ RecName: Full=Putative phosphotransferase SERP1129;    
   12::271     1e-38  32%  271 aa  Y181_STAS1 RecName: Full=Putative phosphotransferase SSP0181;      
    9::268     1e-38  33%  269 aa  Y1110_PEDPA RecName: Full=Putative phosphotransferase PEPE_1110;   
   89::362     3e-38  35%  377 aa  PDRP2_ARATH RecName: Full=Pyruvate, phosphate dikinase regulatory
    7::264     5e-38  35%  266 aa  Y1243_HALOH RecName: Full=Putative phosphotransferase Hore_12430;  
    3::261     6e-38  34%  276 aa  Y2419_ENTFA RecName: Full=Putative phosphotransferase EF_2419;     
    2::267     8e-38  32%  269 aa  Y3950_CLOB6 RecName: Full=Putative phosphotransferase CLJ_B3950;   
    8::260     1e-37  33%  269 aa  YSI3_STAAU RecName: Full=Putative phosphotransferase in Sigma70
    4::266     2e-37  33%  270 aa  Y699_LACS1 RecName: Full=Putative phosphotransferase LSL_0699;     
    6::269     2e-37  33%  270 aa  Y2715_BACLD RecName: Full=Putative phosphotransferase
    2::267     2e-37  31%  269 aa  Y863_CLOBK RecName: Full=Putative phosphotransferase CLD_0863;     
    2::267     2e-37  31%  269 aa  Y4116_CLOBJ RecName: Full=Putative phosphotransferase CLM_4116;    
    2::267     2e-37  31%  269 aa  Y3856_CLOBL RecName: Full=Putative phosphotransferase CLI_3856;    
    2::267     2e-37  31%  269 aa  Y3704_CLOB1 RecName: Full=Putative phosphotransferase CLB_3704;    
    2::267     2e-37  31%  269 aa  Y3611_CLOBH RecName: Full=Putative phosphotransferase
    2::267     2e-37  31%  269 aa  Y3095_CLOBM RecName: Full=Putative phosphotransferase CLK_3095;    
   10::265     2e-37  31%  273 aa  Y1513_SYNWW RecName: Full=Putative phosphotransferase Swol_1513;   
    7::261     4e-37  33%  268 aa  Y4901_CLOB8 RecName: Full=Putative phosphotransferase Cbei_4901;   
    7::264     5e-37  32%  270 aa  Y1359_THEP3 RecName: Full=Putative phosphotransferase Teth39_1359; 
    7::264     5e-37  32%  270 aa  Y1350_THEPX RecName: Full=Putative phosphotransferase Teth514_1350;
    7::272     7e-37  34%  281 aa  Y5851_SORC5 RecName: Full=Putative phosphotransferase sce5851;     
   13::272     7e-37  36%  276 aa  Y442_STAHJ RecName: Full=Putative phosphotransferase SH0442;       
    7::250     3e-36  34%  270 aa  Y1866_LISMO RecName: Full=Putative phosphotransferase lmo1866;     
  140::416     3e-36  31%  426 aa  PDRP1_MAIZE RecName: Full=Pyruvate, phosphate dikinase regulatory
    7::263     4e-36  31%  272 aa  Y3504_CLOBB RecName: Full=Putative phosphotransferase CLL_A3504;   
    8::264     6e-36  33%  270 aa  Y3704_LYSSC RecName: Full=Putative phosphotransferase Bsph_3704;   
  158::434     6e-36  30%  471 aa  PDRP1_ORYSJ RecName: Full=Probable pyruvate, phosphate dikinase
  158::434     6e-36  30%  471 aa  PDRP1_ORYSI RecName: Full=Probable pyruvate, phosphate dikinase
   13::277     2e-35  31%  279 aa  Y3210_CHLSY RecName: Full=Putative phosphotransferase Chy400_3210; 
   13::277     2e-35  31%  279 aa  Y2965_CHLAA RecName: Full=Putative phosphotransferase Caur_2965;   
    7::264     3e-35  33%  270 aa  Y980_THETN RecName: Full=Putative phosphotransferase TTE0980;      
    7::261     4e-35  30%  272 aa  Y3298_CLOBA RecName: Full=Putative phosphotransferase CLH_3298;    
    6::264     5e-35  34%  266 aa  Y2484_GEOKA RecName: Full=Putative phosphotransferase GK2484;      
    6::265     7e-35  33%  270 aa  YQFL_BACSU RecName: Full=Putative phosphotransferase yqfL;       
    7::264     1e-34  30%  271 aa  Y1946_OCEIH RecName: Full=Putative phosphotransferase OB1946;      
    6::264     2e-34  35%  266 aa  Y2421_GEOTN RecName: Full=Putative phosphotransferase GTNG_2421;   
   28::291     3e-34  29%  294 aa  Y606_MOOTA RecName: Full=Putative phosphotransferase Moth_0606;    
   46::274     3e-34  31%  283 aa  Y1369_DESPS RecName: Full=Putative phosphotransferase DP1369;      
   10::267     3e-34  31%  270 aa  Y1373_BACHD RecName: Full=Putative phosphotransferase BH1373;      
    6::262     6e-34  33%  266 aa  Y2417_GEOSW RecName: Full=Putative phosphotransferase GWCH70_2417; 
    6::265     7e-34  32%  270 aa  Y2354_BACA2 RecName: Full=Putative phosphotransferase RBAM_023540; 
    7::250     7e-34  33%  270 aa  Y1885_LISW6 RecName: Full=Putative phosphotransferase lwe1885;     
    4::263     1e-33  31%  271 aa  Y122_CLOTE RecName: Full=Putative phosphotransferase CTC_00122;    
    7::250     3e-33  33%  270 aa  Y1895_LISMF RecName: Full=Putative phosphotransferase
    1::267     5e-33  30%  271 aa  Y1687_BACSK RecName: Full=Putative phosphotransferase ABC1687;     
    6::269     6e-33  32%  270 aa  Y823_BACC2 RecName: Full=Putative phosphotransferase BCG9842_B0823;
    6::269     6e-33  32%  270 aa  Y4413_BACC4 RecName: Full=Putative phosphotransferase
    6::269     1e-32  32%  270 aa  Y4293_BACCR RecName: Full=Putative phosphotransferase BC_4293;     
    7::250     2e-32  33%  270 aa  Y1980_LISIN RecName: Full=Putative phosphotransferase lin1980;     
    6::269     2e-32  32%  270 aa  Y4147_BACWK RecName: Full=Putative phosphotransferase
    6::269     3e-32  31%  270 aa  Y4558_BACAC RecName: Full=Putative phosphotransferase BAMEG_4558;  
    6::269     3e-32  31%  270 aa  Y4540_BACAA RecName: Full=Putative phosphotransferase BAA_4540;    
    6::269     3e-32  31%  270 aa  Y4520_BACAN RecName: Full=Putative phosphotransferase
    6::269     3e-32  31%  270 aa  Y4429_BACC7 RecName: Full=Putative phosphotransferase
    6::269     3e-32  31%  270 aa  Y4407_BACC3 RecName: Full=Putative phosphotransferase BCA_4407;    
    6::269     3e-32  31%  270 aa  Y4376_BACC1 RecName: Full=Putative phosphotransferase BCE_4376;    
    6::269     3e-32  31%  270 aa  Y4318_BACC0 RecName: Full=Putative phosphotransferase BCAH820_4318;
    6::269     3e-32  31%  270 aa  Y4044_BACCZ RecName: Full=Putative phosphotransferase BCE33L4044;  
    6::269     3e-32  31%  270 aa  Y4034_BACHK RecName: Full=Putative phosphotransferase BT9727_4034; 
    6::269     3e-32  31%  270 aa  Y3887_BACAH RecName: Full=Putative phosphotransferase BALH_3887;   
    4::277     5e-32  28%  294 aa  Y2049_PROAC RecName: Full=Putative phosphotransferase PPA2049;     
    8::274     9e-32  29%  276 aa  Y1185_STACT RecName: Full=Putative phosphotransferase Sca_1185;    
    7::261     3e-31  30%  276 aa  Y347_SYNWW RecName: Full=Putative phosphotransferase Swol_0347;    
    6::269     4e-31  32%  270 aa  Y3022_BACCN RecName: Full=Putative phosphotransferase Bcer98_3022; 
   10::268     4e-31  37%  274 aa  Y1750_BORA1 RecName: Full=Putative phosphotransferase BAV1750;     
    7::251     2e-29  26%  276 aa  Y1715_STRA3 RecName: Full=Putative phosphotransferase gbs1715;     
    7::251     4e-29  26%  276 aa  Y1683_STRA1 RecName: Full=Putative phosphotransferase SAK_1683;    
    7::251     4e-29  26%  276 aa  Y1671_STRA5 RecName: Full=Putative phosphotransferase SAG1671;     
    9::264     5e-29  37%  273 aa  Y1381_ACIAC RecName: Full=Putative phosphotransferase Aave_1381;   
   10::268     1e-28  38%  275 aa  Y2621_BORBR RecName: Full=Putative phosphotransferase BB2621;      
   10::268     1e-28  38%  275 aa  Y1543_BORPA RecName: Full=Putative phosphotransferase BPP1543;     
    9::263     3e-28  37%  272 aa  Y1520_METPP RecName: Full=Putative phosphotransferase Mpe_A1520;   
   10::268     3e-28  38%  275 aa  Y1435_BORPE RecName: Full=Putative phosphotransferase BP1435;      
   12::267     1e-27  36%  276 aa  Y2880_ACISJ RecName: Full=Putative phosphotransferase Ajs_2880;    
   12::267     1e-27  36%  276 aa  Y2367_DIAST RecName: Full=Putative phosphotransferase Dtpsy_2367;  
    6::264     3e-27  36%  273 aa  Y5065_DELAS RecName: Full=Putative phosphotransferase Daci_5065;   
    9::264     4e-27  38%  273 aa  Y2834_LEPCP RecName: Full=Putative phosphotransferase Lcho_2834;   
   12::268     7e-27  39%  277 aa  Y3310_AZOSE RecName: Full=Putative phosphotransferase AZOSEA33100; 
    9::264     7e-27  36%  273 aa  Y2400_POLNA RecName: Full=Putative phosphotransferase Pnap_2400;   
    6::272     1e-26  34%  273 aa  Y827_NEIMA RecName: Full=Putative phosphotransferase NMA0827;      
    6::272     1e-26  34%  273 aa  Y567_NEIM0 RecName: Full=Putative phosphotransferase NMCC_0567;    
    6::272     1e-26  34%  273 aa  Y562_NEIMF RecName: Full=Putative phosphotransferase NMC0562;      
    6::272     1e-26  34%  273 aa  Y619_NEIMB RecName: Full=Putative phosphotransferase NMB0619;      
    9::262     2e-26  37%  270 aa  Y2204_METFK RecName: Full=Putative phosphotransferase Mfla_2204;   
    6::265     3e-26  32%  272 aa  Y2529_DESPS RecName: Full=Putative phosphotransferase DP2529;      
    9::266     3e-26  37%  273 aa  Y2049_VEREI RecName: Full=Putative phosphotransferase Veis_2049;   
   18::279     3e-26  36%  281 aa  Y1351_HERAR RecName: Full=Putative phosphotransferase HEAR1351;    
   10::264     7e-26  34%  274 aa  Y4168_PSEAB RecName: Full=Putative phosphotransferase PA14_41680;  
   10::264     7e-26  34%  274 aa  Y3560_PSEA8 RecName: Full=Putative phosphotransferase PLES_35601;  
    1::258     7e-26  37%  267 aa  Y2039_RALEH RecName: Full=Putative phosphotransferase H16_A2039;   
   10::264     7e-26  34%  274 aa  Y1769_PSEAE RecName: Full=Putative phosphotransferase PA1769;      
   12::268     1e-25  39%  277 aa  Y2168_AZOSB RecName: Full=Putative phosphotransferase azo2168;     
    8::264     2e-25  33%  272 aa  Y2122_HAHCH RecName: Full=Putative phosphotransferase HCH_02122;   
   37::292     2e-25  39%  301 aa  Y1865_RALEJ RecName: Full=Putative phosphotransferase Reut_A1865;  
    9::266     2e-25  36%  273 aa  Y1815_VARPS RecName: Full=Putative phosphotransferase Vapar_1815;  
   10::272     3e-25  34%  273 aa  Y333_NEIG2 RecName: Full=Putative phosphotransferase NGK_0333;     
   10::272     3e-25  34%  273 aa  Y202_NEIG1 RecName: Full=Putative phosphotransferase NGO0202;      
   18::272     4e-25  38%  282 aa  Y997_NITMU RecName: Full=Putative phosphotransferase Nmul_A0997;   
   18::272     4e-25  36%  282 aa  Y2042_JANMA RecName: Full=Putative phosphotransferase mma_2042;    
    7::269     6e-25  36%  271 aa  Y2037_BURCJ RecName: Full=Putative phosphotransferase
    7::262     1e-24  36%  271 aa  Y1974_BURM1 RecName: Full=Putative phosphotransferase
   15::270     1e-24  38%  279 aa  Y1420_RALSO RecName: Full=Putative phosphotransferase RSc1420;     
    7::269     1e-24  36%  271 aa  Y6074_BURCA RecName: Full=Putative phosphotransferase Bcen_6074;   
    7::269     1e-24  36%  271 aa  Y5313_BURS3 RecName: Full=Putative phosphotransferase
    7::269     1e-24  36%  271 aa  Y2023_BURCC RecName: Full=Putative phosphotransferase
    7::269     1e-24  36%  271 aa  Y2003_BURCH RecName: Full=Putative phosphotransferase
    7::269     2e-24  35%  271 aa  Y2036_BURCM RecName: Full=Putative phosphotransferase Bamb_2036;   
    7::269     2e-24  35%  271 aa  Y1905_BURA4 RecName: Full=Putative phosphotransferase
    1::275     3e-24  31%  277 aa  Y4515_VIBVY RecName: Full=Putative phosphotransferase VVA0515;     
    1::275     3e-24  31%  277 aa  Y4006_VIBVU RecName: Full=Putative phosphotransferase VV2_0006;    
    6::261     3e-24  36%  270 aa  Y1452_RALME RecName: Full=Putative phosphotransferase Rmet_1452;   
   13::275     5e-24  31%  277 aa  Y3786_VIBCH RecName: Full=Putative phosphotransferase VC_A0986;    
   13::275     5e-24  31%  277 aa  Y3745_VIBCM RecName: Full=Putative phosphotransferase VCM66_A0945; 
   13::275     5e-24  31%  277 aa  Y252_VIBC3 RecName: Full=Putative phosphotransferase VC0395_0252;  
   16::288     7e-24  36%  290 aa  YDIA_ENTAG RecName: Full=Putative phosphotransferase in ppsA-aroH
    7::262     9e-24  35%  271 aa  Y2719_BURXL RecName: Full=Putative phosphotransferase Bxeno_A2719; 
    7::262     9e-24  35%  271 aa  Y2439_BURPP RecName: Full=Putative phosphotransferase Bphyt_2439;  
   12::220     9e-24  41%  272 aa  Y1758_DECAR RecName: Full=Putative phosphotransferase Daro_1758;   
    9::217     1e-23  38%  273 aa  Y3043_POLSJ RecName: Full=Putative phosphotransferase Bpro_3043;   
   14::276     1e-23  32%  278 aa  Y2500_ACIB5 RecName: Full=Putative phosphotransferase AB57_2500;   
   14::276     1e-23  32%  278 aa  Y2163_ACIBT RecName: Full=Putative phosphotransferase A1S_2163;    
    7::262     1e-23  35%  271 aa  Y1909_BURVG RecName: Full=Putative phosphotransferase
   14::276     1e-23  32%  278 aa  Y1578_ACIBS RecName: Full=Putative phosphotransferase ABSDF1578;   
   14::276     1e-23  32%  278 aa  Y1392_ACIBY RecName: Full=Putative phosphotransferase ABAYE1392;   
   14::276     1e-23  32%  278 aa  Y1301_ACIB3 RecName: Full=Putative phosphotransferase ABBFA_001301;
   14::276     2e-23  31%  278 aa  Y2422_ACIAD RecName: Full=Putative phosphotransferase ACIAD2422;   
   13::275     3e-23  32%  277 aa  Y4424_VIBSL RecName: Full=Putative phosphotransferase VS_II1224;   
    8::262     4e-23  32%  272 aa  Y2038_PSEU5 RecName: Full=Putative phosphotransferase PST_2038;    
    8::262     1e-22  32%  272 aa  Y1868_PSEF5 RecName: Full=Putative phosphotransferase PFL_1868;    
   13::275     1e-22  30%  278 aa  Y4373_VIBPA RecName: Full=Putative phosphotransferase VPA0373;     
   10::264     2e-22  35%  273 aa  Y3710_CHRVO RecName: Full=Putative phosphotransferase CV_3710;     
    4::255     3e-22  31%  258 aa  Y617_THIDA RecName: Full=Putative phosphotransferase Tbd_0617;     
    7::262     3e-22  35%  271 aa  Y2043_BURTA RecName: Full=Putative phosphotransferase BTH_I2043;   
   18::280     3e-22  31%  282 aa  Y1334_PSYA2 RecName: Full=Putative phosphotransferase Psyc_1334;   
   18::280     3e-22  31%  282 aa  Y1035_PSYCK RecName: Full=Putative phosphotransferase Pcryo_1035;  
    8::262     4e-22  32%  272 aa  Y1741_PSEE4 RecName: Full=Putative phosphotransferase PSEEN1741;   
    7::262     5e-22  36%  271 aa  Y5572_BURM9 RecName: Full=Putative phosphotransferase
    8::262     5e-22  31%  272 aa  Y4621_PSEFS RecName: Full=Putative phosphotransferase PFLU4621;    
    7::262     5e-22  36%  271 aa  Y3839_BURMS RecName: Full=Putative phosphotransferase
    7::262     5e-22  36%  271 aa  Y3811_BURM7 RecName: Full=Putative phosphotransferase
    8::262     5e-22  32%  272 aa  Y3659_PSEP1 RecName: Full=Putative phosphotransferase Pput_3659;   
    8::265     5e-22  35%  274 aa  Y2669_LARHH RecName: Full=Putative phosphotransferase LHK_02669;   
    7::262     5e-22  36%  271 aa  Y2566_BURP1 RecName: Full=Putative phosphotransferase
    7::262     5e-22  36%  271 aa  Y2476_BURP0 RecName: Full=Putative phosphotransferase
    7::262     5e-22  36%  271 aa  Y2420_BURP6 RecName: Full=Putative phosphotransferase
    7::260     5e-22  35%  270 aa  Y2383_ALTMD RecName: Full=Putative phosphotransferase MADE_02383;  
    7::262     5e-22  36%  271 aa  Y2143_BURPS RecName: Full=Putative phosphotransferase BPSL2143;    
    7::262     5e-22  36%  271 aa  Y1539_BURMA RecName: Full=Putative phosphotransferase BMA1539;     
    9::217     6e-22  36%  273 aa  Y2190_RHOFD RecName: Full=Putative phosphotransferase Rfer_2190;   
    8::262     6e-22  32%  272 aa  Y1592_PSEPG RecName: Full=Putative phosphotransferase PputGB1_1592;
    8::271     6e-22  31%  273 aa  Y1428_SODGM RecName: Full=Putative phosphotransferase SG1428;      
    8::262     8e-22  32%  272 aa  Y2081_PSEPK RecName: Full=Putative phosphotransferase PP_2081;     
    8::262     8e-22  31%  272 aa  Y1769_PSEPF RecName: Full=Putative phosphotransferase Pfl01_1769;  
    8::265     1e-21  33%  277 aa  Y2063_CHRSD RecName: Full=Putative phosphotransferase Csal_2063;   
    5::275     1e-21  35%  277 aa  Y1825_ERWT9 RecName: Full=Putative phosphotransferase ETA_18250;   
    9::271     2e-21  32%  275 aa  Y869_NITEC RecName: Full=Putative phosphotransferase Neut_0869;    
   13::275     2e-21  29%  278 aa  Y6516_VIBHB RecName: Full=Putative phosphotransferase VIBHAR_06516;
    5::260     2e-21  34%  270 aa  Y1743_PSEA6 RecName: Full=Putative phosphotransferase Patl_1743;   
    8::262     3e-21  31%  272 aa  Y1599_PSEPW RecName: Full=Putative phosphotransferase
    8::262     9e-21  35%  270 aa  Y2716_SHEWM RecName: Full=Putative phosphotransferase Swoo_2716;   
    7::259     1e-20  29%  269 aa  Y1317_IDILO RecName: Full=Putative phosphotransferase IL1317;      
    9::263     2e-20  33%  271 aa  Y628_DICNV RecName: Full=Putative phosphotransferase DNO_0628;     
    8::270     2e-20  29%  272 aa  Y1428_ALCBS RecName: Full=Putative phosphotransferase ABO_1428;    
    7::268     2e-20  32%  270 aa  Y2545_AERS4 RecName: Full=Putative phosphotransferase ASA_2545;    
    8::262     5e-20  32%  270 aa  Y2298_SHEFN RecName: Full=Putative phosphotransferase Sfri_2298;   
    4::264     6e-20  28%  271 aa  Y1485_LEGPA RecName: Full=Putative phosphotransferase lpp1485;     
    4::264     1e-19  28%  271 aa  Y949_LEGPC RecName: Full=Putative phosphotransferase LPC_0949;     
    8::261     1e-19  33%  270 aa  Y2550_SHEPA RecName: Full=Putative phosphotransferase Spea_2550;   
    8::260     1e-19  34%  270 aa  Y2244_SHEPC RecName: Full=Putative phosphotransferase
    8::260     1e-19  34%  270 aa  Y1764_SHESW RecName: Full=Putative phosphotransferase
    4::264     1e-19  28%  271 aa  Y1528_LEGPH RecName: Full=Putative phosphotransferase lpg1528;     
   10::217     1e-19  34%  273 aa  Y2421_STRM5 RecName: Full=Putative phosphotransferase Smal_2421;   
    4::264     1e-19  28%  271 aa  Y1498_LEGPL RecName: Full=Putative phosphotransferase lpl1498;     
    7::268     2e-19  30%  270 aa  Y2692_AERHH RecName: Full=Putative phosphotransferase AHA_2692;    
    8::260     2e-19  34%  270 aa  Y2602_SHEB9 RecName: Full=Putative phosphotransferase Sbal195_2602;
    8::260     2e-19  34%  270 aa  Y2489_SHEB5 RecName: Full=Putative phosphotransferase Sbal_2489;   
    8::260     2e-19  34%  270 aa  Y2482_SHEB8 RecName: Full=Putative phosphotransferase Shew185_2482;
    8::260     2e-19  34%  270 aa  Y1862_SHEB2 RecName: Full=Putative phosphotransferase Sbal223_1862;
    7::259     2e-19  31%  269 aa  Y3013_COLP3 RecName: Full=Putative phosphotransferase CPS_3013;    
    8::262     2e-19  31%  272 aa  Y2326_AZOVD RecName: Full=Putative phosphotransferase Avin_23260;  
    8::262     2e-19  28%  272 aa  Y2089_PSEU2 RecName: Full=Putative phosphotransferase Psyr_2089;   
    8::262     2e-19  29%  272 aa  Y2060_PSE14 RecName: Full=Putative phosphotransferase PSPPH_2060;  
    8::250     3e-19  32%  271 aa  YPNA_THIRO RecName: Full=Putative phosphotransferase in pntA-hypC2
   13::269     3e-19  29%  277 aa  Y1750_PHOPR RecName: Full=Putative phosphotransferase PBPRA1750;   
    7::266     4e-19  32%  269 aa  Y4058_PSEHT RecName: Full=Putative phosphotransferase PSHAb0558;   
    8::262     4e-19  28%  272 aa  Y2291_PSESM RecName: Full=Putative phosphotransferase PSPTO_2291;  
    8::264     4e-19  32%  274 aa  Y1889_ALHEH RecName: Full=Putative phosphotransferase Mlg_1889;    
    8::260     7e-19  31%  270 aa  Y2645_SHEON RecName: Full=Putative phosphotransferase SO_2645;     
   10::264     7e-19  31%  273 aa  Y219_HALHL RecName: Full=Putative phosphotransferase Hhal_0219;    
    8::262     7e-19  30%  272 aa  Y2084_PSEMY RecName: Full=Putative phosphotransferase Pmen_2084;   
   10::239     9e-19  32%  273 aa  Y2212_XANOR RecName: Full=Putative phosphotransferase XOO2212;     
   10::239     9e-19  32%  273 aa  Y2080_XANOM RecName: Full=Putative phosphotransferase XOO2080;     
    8::260     9e-19  30%  270 aa  Y2010_SHEDO RecName: Full=Putative phosphotransferase Sden_2010;   
    8::271     9e-19  32%  273 aa  Y1852_ERWCT RecName: Full=Putative phosphotransferase ECA1852;     
    8::260     9e-19  31%  270 aa  Y1735_SHESA RecName: Full=Putative phosphotransferase
    8::260     9e-19  31%  270 aa  Y1666_SHESR RecName: Full=Putative phosphotransferase Shewmr7_1666;
    8::260     9e-19  31%  270 aa  Y1591_SHESM RecName: Full=Putative phosphotransferase Shewmr4_1591;
    8::275     1e-18  32%  277 aa  Y2157_KLEP3 RecName: Full=Putative phosphotransferase KPK_2157;    
    8::275     1e-18  32%  277 aa  Y2128_KLEP7 RecName: Full=Putative phosphotransferase
   10::217     1e-18  33%  273 aa  Y2974_STRMK RecName: Full=Putative phosphotransferase Smlt2974;    
    8::260     1e-18  34%  270 aa  Y1548_SHELP RecName: Full=Putative phosphotransferase Shew_1548;   
    9::272     2e-18  30%  275 aa  Y2358_NITEU RecName: Full=Putative phosphotransferase
    8::271     3e-18  32%  273 aa  Y2177_YERE8 RecName: Full=Putative phosphotransferase YE2177;      
   97::262     3e-18  36%  270 aa  Y1704_SHEHH RecName: Full=Putative phosphotransferase Shal_1704;   
    8::260     4e-18  34%  270 aa  Y1870_SHESH RecName: Full=Putative phosphotransferase Ssed_1870;   
    8::275     6e-18  31%  277 aa  YDIA_SALTY RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALTI RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALSV RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALPK RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALPC RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALPB RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALPA RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALNS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALHS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  32%  277 aa  YDIA_SALG2 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALEP RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALDC RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALCH RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-18  31%  277 aa  YDIA_SALA4 RecName: Full=Putative phosphotransferase ydiA;       
   10::217     6e-18  34%  273 aa  Y594_XYLFM RecName: Full=Putative phosphotransferase Xfasm12_0594; 
   67::267     7e-18  34%  270 aa  Y622_DEIGD RecName: Full=Putative phosphotransferase Dgeo_0622;    
   89::239     7e-18  40%  273 aa  Y2203_XANC5 RecName: Full=Putative phosphotransferase XCV2203;     
   89::239     7e-18  40%  273 aa  Y2042_XANAC RecName: Full=Putative phosphotransferase XAC2042;     
    8::275     7e-18  31%  277 aa  Y1727_CITK8 RecName: Full=Putative phosphotransferase CKO_01727;   
   10::217     1e-17  32%  273 aa  Y1260_XYLFA RecName: Full=Putative phosphotransferase XF_1260;     
    8::271     1e-17  31%  273 aa  Y739_YERPP RecName: Full=Putative phosphotransferase YPDSF_0739;   
    8::271     1e-17  31%  273 aa  Y2410_YERPE RecName: Full=Putative phosphotransferase
    8::271     1e-17  31%  273 aa  Y2394_YERPB RecName: Full=Putative phosphotransferase YPTS_2394;   
    8::271     1e-17  31%  273 aa  Y2319_YERPS RecName: Full=Putative phosphotransferase YPTB2319;    
    8::271     1e-17  31%  273 aa  Y1864_YERPN RecName: Full=Putative phosphotransferase YPN_1864;    
    8::271     1e-17  31%  273 aa  Y1842_YERPY RecName: Full=Putative phosphotransferase YPK_1842;    
    8::271     1e-17  31%  273 aa  Y1754_YERPA RecName: Full=Putative phosphotransferase YPA_1754;    
    8::275     1e-17  32%  277 aa  Y1744_ENT38 RecName: Full=Putative phosphotransferase Ent638_1744; 
    8::271     1e-17  31%  273 aa  Y1736_YERP3 RecName: Full=Putative phosphotransferase
    8::275     2e-17  31%  277 aa  YDIA_SHIBS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     2e-17  31%  277 aa  YDIA_SHIB3 RecName: Full=Putative phosphotransferase ydiA;       
    8::262     2e-17  30%  270 aa  Y2073_SHEAM RecName: Full=Putative phosphotransferase Sama_2073;   
    8::275     2e-17  31%  277 aa  YDIA_ECOL5 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     2e-17  31%  277 aa  YDIA_ECO7I RecName: Full=Putative phosphotransferase ydiA;       
   89::239     2e-17  40%  273 aa  Y2165_XANCP RecName: Full=Putative phosphotransferase XCC2165;     
   89::239     2e-17  40%  273 aa  Y2016_XANCB RecName: Full=Putative phosphotransferase
   89::239     2e-17  40%  273 aa  Y1953_XANC8 RecName: Full=Putative phosphotransferase XC_1953;     
   28::291     3e-17  30%  293 aa  Y2629_PHOLL RecName: Full=Putative phosphotransferase plu2629;     
   12::275     3e-17  30%  277 aa  Y2103_ENTS8 RecName: Full=Putative phosphotransferase ESA_02103;   
    8::275     4e-17  30%  277 aa  YDIA_ESCF3 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_SHISS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_SHIFL RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_SHIF8 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_SHIDS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOUT RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOSM RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOSE RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOLI RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOLC RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOL6 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOK1 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOHS RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECODH RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECOBW RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO8A RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO81 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO5E RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO57 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO55 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO45 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO27 RecName: Full=Putative phosphotransferase ydiA;       
    8::275     6e-17  30%  277 aa  YDIA_ECO24 RecName: Full=Putative phosphotransferase ydiA;       
   10::217     6e-17  32%  273 aa  Y549_XYLF2 RecName: Full=Putative phosphotransferase XfasM23_0549; 
   10::217     6e-17  32%  273 aa  Y525_XYLFT RecName: Full=Putative phosphotransferase PD_0525;      
    8::275     8e-17  30%  277 aa  YDIA_ECOLU RecName: Full=Putative phosphotransferase ydiA;       
   12::274     2e-16  31%  277 aa  Y1728_DEIRA RecName: Full=Putative phosphotransferase DR_1728;     
    8::262     3e-15  28%  271 aa  Y1884_MARAV RecName: Full=Putative phosphotransferase Maqu_1884;   
    8::210     3e-15  35%  270 aa  Y1850_SHEPW RecName: Full=Putative phosphotransferase swp_1850;    
  145::263     8e-04  31%  503 aa  LEU1_BUCUE RecName: Full=2-isopropylmalate synthase;       
    1::279

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLL
Y426_RHOPS      MLTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLL
Y300_RHOPT      MLTDGSYFHLHLVSDSTGETLITVSRAVTAQYANVTPVEHVYPLVRSQKQLDRVLQEIEEAPGIVLFTLL
Y298_RHOPA      MLTDGSYFHLHLVSDSTGETLITVSRAVTAQYANVTPVEHVYPLVRSQKQLDRVLQEIEEAPGIVLFTLL
Y395_RHOP2      MLTDGSYFHLHLVSDSTGETLITVSRXXXXXXXXXXXXEHVYPLVRSQKQLDRVLQEIEESPGIVLFTLL
Y380_RHOP5      MPTDGSYFHLHLVSDSTGETLITVSRAVSAQYANVSPVEHVYPLVRSQKQLDRVLAEIEEAPGIVLFTLL
Y294_RHOPB      MPTDGSYFHLHLVSDSTGETLITVSRAVAAQYANVSPVEHVYPLVRSQKQLDRVLTEIEEAPGIVLFTLL
Y161_BRASB      MPTTGNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLVRSQKQLDRVLDEIEEAPGIVLFTLL
Y199_BRASO      MPTTGNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLVRSQKQLDRVLDEIEEAPGIVLFTLL
Y112_NITHX      ----GSNFHLHLVSDSTGETLITVSRAVVAQYANVTPVEHVYPLVRSQKQLDRVLAEIEEEPGIVLFTLL
Y102_NITWN      ----GRDFHLHLVSDSTGETLITVSRAVTAQYAGVTPIEHVYPLVRSEKQLDRVLAEIEEAPGIVLFTLL
Y637_BRAJA      MPTSNNYFHLHLVSDSTGETLITVARAVAAQYANVTPVEHVYPLVRSQKQLDRVLDEIEEAPGIVLFTLL
Y4385_OLICO     --TNKSYFHLHMISDSTGETLIMVARAVAAQYANVTPVEHVYPLVRSQKQLDRVLAEIEEAPGIVLFTLL
Y001_RHIEC      -----NFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLIRNRKQLLPVLQAIDDAPGIVLYTIV
Y3935_RHILW     -----NFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLIRNRKQLLPVLQAIDDAPGIVLYTIV
Y001_RHIL3      -----NFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLIRNRKQLLPVLQAIDDAPGIVLYTIV
Y002_RHIE6      -----NFFHLHLISDSTGETLISAGRAASAQFRSAQPIEHVYPLIRNRKQLLPVLQAIDDAPGIVLYTIV
Y4488_RHILO     -----SFFHLHLISDATGETLLAAGRAASAQYKDARAIEHIYPLIRTEKQVAKVFEDIEEEPGIILYTVV
Y001_AGRVS      -----NFFHLHLISDSTGETLISAGRAAAVQFPHSNPIEHVYPLVRNRRQADAVLQSIDKEPGIVLYTIV
Y001_AGRT5      -----SFFHLHLISDSTGETLMSAGRAVSAQFHTSMPVEHVYPMIRNQKQLAQVIDLIDKEPGIVLYTIV
Y2974_MARMM     -------FHIHMVSDSTGETLMEVMRASVAQFEGTTPLEHLYALVRSSKQLDRVLDEVEAYPGVIMYTIV
Y3350_RHISN     -----NYFHLHLVSDSTGETLIXXXXXXXXQFQSSHALEHVYPLIRNKKQLMQVLDAIDGAPGIVLYTIV
Y3209_SINMW     -----NYFHLHLISDSTGETLIXXXXXXXXQFQSSHALEHVYPLIRNRKQLMQVMEAVDGAPGIVLYTIV
Y001_RHIME      -----NYFHLHLISDSTGETLIXXXXXXXXQFQSSHALEHVYPLIRNRKQLMQVMDAVDGAPGIVLYTIV
Y008_BARBK      MKKEKNFFHLYMVSDATGETLISAGKAVASQYPTIQPIEHIYPMIRNKTQLQRVLDEIQREPGIVLYTII
Y001_BARQU      MIREKKSFHLHMLSDATGETLISVGRAVASQYATSQVTEHIYPMIRNETQLRRALDEIQQELGIVLYTXX
Y3478_MESSB     -----SFFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLVRTEKQLEKVFASIDEEPGIVLYTIV
Y001_CAUCR      -----TYFHIHLVSDSTGETLNAMARAVCARFTDILPIEHIYALVRSTRQLDRALEEIAGAPGVVMHTIV
Y001_HYPNA      ------YFNVHLVSDSTGETLNAIQRAACAQFENVQPLEHNYYLVRSERQLERVMKEIEAAPGVVWYTIS
Y001_BART1      MTKEKKSFHLHMLSDATGETLISVGRAVASQYTTYQATEHIYPMIRNKIQLEKALDEIKQEPGIVLYTMI
Y2842_SPHAL     -----SRLHLHLISDSTGETLENIAKAAIAQFDDVEVVRHFWPMVRSESHLDRIMAEVRASPGMILFTLV
Y001_BARHE      -------FHLHMLSDATGETLISVGRAVASQYTMSQATEHIYPMIRNKTQLQRALDEIQQEPGIVLYTXX
Y117_NOVAD      --------HLHLLSDSTGETLEMIAKAALAQFDGADVVRHFWPMVRSMQHLDRIMGEIAANPGLVLYTLV
YD000_ERYLH     --------HLHLLSDSTGETLEMIAKAALAQFENADVVRHFWPMVRSRQHLERIVPELSNNPGLVLFTLV
Y853_OCHA4      -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTIV
Y2113_BRUC2     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2068_BRUA2     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2067_BRUSU     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2060_BRUME     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2042_BRUAB     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y1987_BRUO2     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2129_BRUMB     -----SYFHLHLISDXXXXXXXXXXXXXXXXXXXXXXIEHIYPLIRTEKQLRKVLEGIDAEPGIVLYTVV
Y2832_SPHWW     --------HLHLLSDSTGETLENIAKAGLAQFEGVETIKHFWPMVRSQGHLDRILLEIAQRPGLVIFTLV
Y4549_MAGSA     -------FHLHLVSDATGETVTSVARACLVQFEGVQPIQHNWWLVRTQGQVERVIAGIEDNPGLVFFTLV
Y2476_ACICJ     ---DGKRLNLHLVSDATGDTLNAVARAASVQFEGSDIHLHRWSLIRSRLQLHRVLEGIEAERGPVLCSLL
Y003_GRABC      --------NLHLVSDATGETLNSIARATVSQFEHAQIIYHRWSLIRTRFQLHRVLEGIEAEPGPVLSTLI
Y3615_RHORT     --------HVHLVSDATGETVSNVVRACLAQFEDVRVVQHRWWLLRSPSQVGRVIEGIQRDPGTVVFTVV
Y324_NEOSM      --------NVHLISDYGVDALIAVSRASLERFEHVSAEHHLWPSTTSIEKLQQVFLHIERS-SFVLYSIR
Y316_ANAMM      ---------LHLVSDSTCETVIAVARSAVEHFKSLEVNEFVWSLVGSKRQVDKVMLNINERHNLIMYTVV
Y486_WOLPP      --------NLHLVSDSSGETVISVAKSALKHFRSVETIEYVWSFVKGEEQIDKILEEIEDEHNFVICTIT
Y235_ANAMF      ---------LHLVSDSTCETVIAVARSAVEHFKSLEVNEFVWSLVGSKRQVDKVMLNINERHNLIMYTVV
Y205_EHRRW      --------NLHLISDSTCETVAAVARSALEHFKSVEVNEFVWSCINSYEQIDKIMLTIEKDKNFIMYTMF
Y005_RICRS      ---------IHLVSDSSVQTAKYAANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKHGIVLYTIA
Y001_RICRO      ---------IHLVSDSSVQTAKYAANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKHGIVLYTIA
Y001_RICCN      ---------IHLVSDSSVQTAKYTANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKHGIVLYTIA
Y202_EHRRG      --------NLHLISDSTCETVAAVARSALEHFKSVEVNEFVWSCINSYEQIDKIMLTIEKDKNFIMYTMF
Y001_RICAE      ---------IHLVSDSSVQTAKYTANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKHGIVLYTIA
Y450_GEOSL      --------HIYLLSDATGETVERVVRAALSQFRDVEARFHRVTRIRSREDVIWALEEVLREPGMVVYTLV
Y4470_WOLWR     --------NLHLVSDSSGETVISVAKSALKHFRSVETIEYVWSFVKGEEQIDKILEEINDEHNFVICTIT
Y341_WOLPM      --------NLHLVSDSSGETVISVAKSALKHFRSVETIEYVWSFVKGEEQIDKILEEINDEHNFVICTIT
Y3384_GEOMG     ---NGSMRHIYLFSDATGETVERVLRAALSQFRDVEARIHRMSKIRTREDILSALEDVLKEPGIVIYTLV
Y001_RICFE      ---------IHLVSDSSVQTAKYAANSAFAQFTSIKPKLYHWPMIRNLELLNEVLSKIESKHGLVLYTIA
Y633_WOLTR      --------NLHLVSDSSGETVISVAKSALKHFRSIETVEYVWSFVKEEEQIDKILEEINKKSNFVICTIT
Y001_RICM5      ---------IHLVSDSSVQTAKYAANSAIAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKRGIVLYTIA
Y895_EHRCR      --------NLHLISDSTCETVASVARSALEHFRSVEVNEFVWSFINNNEQIDKIMSLIEKDKNFIMYTMF
Y001_RICTY      ---------IHLVSDSSVQTVKHAANSALAQFTSIKQKLYHWPMIRNLELLNEVLSKIESKHGIVLYTIA
Y005_RICAH      ---------IHLVSDSSVQTAKYAANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIESKHGIVLYTIA
Y343_PELUB      -------YQIYLISDSTGETLDRVFLAIKAQFKNIKYDVKSYFFTRTENQVSKIMDEAKKNDNIILYTIV
Y005_RICPU      ---------IHLVSDSSVQTAKYAANSALAQFTSVKPKLYHWPMIRNLELLNEVLSKIEYKHGIVLYTIA
Y001_RICPR      ---------IHLVSDSSVQTAKHAANSALAQFTSIKQKLYHWPMIRNCELLNEVLSKIESKHGIVLYTIA
Y3081_DESHY     ---------IYIISDALGETAEYVSRAAAAQFSGIRTKIRKVPYVQDEIHIDEILEEAAKEQAIIAYTLV
Y207_EHRCJ      --------NLHLISDSTCETVAAVAKSALEHFRSIEVNEFVWSFINSCEQIDKIMSLIEHDKNFIMYTMF
Y4252_DESHD     ---------IYIISDALGETAEYVSRAAAAQFSGIRTKIRKVPYVQDEIHIDEILEEAAKEQAIIAYTLV
Y005_RICB8      ---------IHLVSDSSVQTAKSAAHSSLAQFTSLKPKLYHWPMIRNSELLKEVLSNIESKHGIVLYTIA
Y001_RICBR      ---------IHLVSDSSVQTAKSAAHSALAQFTSLKPKLYHWPMIRNSELLKEVLSKIESKHGIVLYTIA
Y4292_GEOUR     ---------IYLLSDATGETVERVVRAALTQFKNVDVKLHRMSRLRTREDISLALDEAAKQPGVIFYTLV
Y410_GEOSF      ---------IYLFSDATGETVERVVRAALTQFRNVDVKLHRMSRLRTREDISISLDEAAKQPGVIFYTLV
Y997_GEOLS      ---------IYVLSDSTGETAERVVRAALSQFGGSDVRIVRLAKVCNXXXXXXXXXXXXXDEGLLVYTLV
Y242_GEOBB      -------YHVYLLSDATGETVERVARAALTQFRDVDIRLRRMGQIRNREDILRALDEVDRAPGIIFYTLV
Y226_GEOSM      -------YHVYLLSDATGETVERVARAALTQFRDVDIRLRRMGQIRNREDILRALDEVDRAPGIIFYTLV
Y961_ANAPZ      ---------LHLVSDSTCETVVSVARAAVEHFKSLEVNEFVWSLVGSKSHVDRIISSIDRKRNLIMYTVL
Y005_RICCK      ---------IHLVSDSSVQTAKYAANSALAQFTSIKPKLYHWPMIRNLELLNEVLSKIESKHGIVLYTIA
Y2958_PELPD     ---------IYVISDATGETAERVIRAALSQYDEVRVVRLCQ--IHNENDVQQAMSVAIAEPGMIAYTLV
Y1093_BDEBA     ---DNKTYTIYILSDSTGETAATMIRAALVQYTTKDVNIIRCKNVRTDTQAEAVIEECFERRGMLAYTVA
Y3020_ALKMQ     ---------IYILSDSIGETAEQVAKAAISQFDTEDYEIRRFPFITEKHHIDEMLQEAKKENSVIVFTMV
Y585_SYMTH      ---------IFVVSDSVGETADLVTRAALSQWGQRSVEIRRFPMIDDPQSLREVIDAARQQPTLIVYTII
Y743_LACBA      ---------IFVISDSSGETALTVAQTAVSQYPTIQVSYQRFPFIQTDSILDGILNLAKKQRAMIFHTLV
Y1257_ALKOO     ---------IYVISDSIGETAEQVAKAAVSQFKTEDYEIRRFPYINEKRQILEILEEAKNENAVIAFTIV
PDRP1_ARATH     ---------IYIVSDGTGWTAEHAVNAALGQFDYCCPVNHLFSGIEDGEKLMEIIKQAAREGAMVIYTLA
Y1326_LACJO     --------NLIIISDSVGDTAFNMVQAGAVQYPNVKFNYRRYPFITNREKLEKVFSEITEFENVLIFTLI
Y2242_CLOPE     ------------VSDSIGETAQQVAMAAASQFKDNAEVKRI-PYVKSLEDVEDLMKTIEDCEAMIVSTII
Y076_CLOPS      ------------VSDSIGETAQQVAMAAASQFKDNAEVKRI-PYVKSLEDVEDLIKTIEDCEAMIVSTII
Y1520_STRU0     ---------IFIISDSLGVTARTIAKACIQQFPNHDNWQFEYSNINNKELLDKVLEKAKDKNVCLMFSLV
Y1256_LACDA     --TEKMEVNIIIISDSAGETXXXXXXXXXXXXPDAEVNYRRYPFIVNEKKLAATLEEIEQYPNLVIYSML
Y1123_LACGA     --------NLIIISDSVGDTAFNMVQAGAVQYPDVKFNYRRYPFITNREKLEKVFNEITEFENVLIFTLI
Y1494_LISIN     ---------VYVVSDSTGETAELVTRAALSQFGQTPKFIHRFHHVDSSHMIEEIVDLVAVNNGIIVHTIV
Y1476_LISMF     ---------VYVVSDSTGETAELVTRAALSQFGQTPKFIHRFHHVDSSHMIEEIVDLVAVNNGIIVHTIV
Y1457_LISMO     ---------VYVVSDSTGETAELVTRAALSQFGQTPKFIHRFHHVDSSHMIEEIVDLVAVNNGIIVHTIV
Y1174_LACDB     --TEKMEVNIIIISDSAGETXXXXXXXXXXXXPDAEVNYRRYPFIVNEKKLAATLEEIEQYPNLVIYSML
Y442_CARHZ      ---------VYILSDSIGETGEVVAKAAASQFDSGRVDIRRVPYLSSVREVEEALQEAESAGALVVYTLV
Y1472_LISW6     ---------VYVVSDSTGETAELVTRAALSQFGQTPKFIHRFHHVDSSHMIEEIVDLVAVNNGIIVHTIV
Y2438_PELCD     ---------IYLLSDATGETAEKIVNAVLTQFRDKPVRLRRISNVRNRPAALEGLQEAIKNQGMVVYTVV
Y1306_LACH4     -----------------------------------------YPFITNKDKLDEVLEEIEKYPNLVIYSLV
Y1143_LACSS     ---------IFIISDSIGETARTVIAAVNAQFASVTLKIQRFPFITDQKTLTPILQDAHQEQAIIVSTLV
Y1055_STRSV     ---------VYSISDSLGGTSQKLLSAVTAQYPDIINNSYRFPFINKEEELLAILRDAIKDDALVISTLV
Y872_LACSS      -----------VLSDSVGQTXXXXXXXXXXXYPNVKPDIIRFPFVHSVDKLTDVLSKAVPEETIVVHTLA
Y1193_STAS1     -----------VASDSVGETAELVARACISQFNPKQCESEIYPYIEALENVDEVISVAKDTEAIVVYTLV
Y1353_STAHJ     -----------IASDSIGETAELVARACISQF-NPKECKHEYPYIETKEDIDEVIQVANDRNAIIVYTLV
Y1206_LACAC     -----------------------------------------YPFITNLEKLDEVLKEIEKYPNLVIFSLV
Y2411_CLOD6     ---------IYAVSDSVGETAQQVAKACMSQYVNETYEIKRFPYMINKGVLLETLENAKAENALIVYTLV
Y1974_LACPL     -----SAIKVFILSDSIGETAHNVALAAAAQFSDYDIRYQRFPFVRTDSLLQTVLSQALKEHAAIFHTFV
Y2169_STAEQ     MKDNNEVLKLFIVSDSIGETAQRMIHATLTQFPDLTQVEKKFPYIKDEQEFLNVLQLAKEQNAIVATTLV
Y2159_STAES     MKDNNEVLKLFIVSDSIGETAQRMIHATLTQFPDLTQVEKKFPYIKDEQEFLNVLQLAKEQNAIVATTLV
Y1026_ENTFA     ---------VYTISDSLGETSQKLLAAASAQYPDISFLNRYFSFVTTEEELLEILKDALKDKALVVSTLV
Y812_STRGC      ---------VYSVSDSLGGTSQKLLSAVTAQYPDIINNSYRFPFINKEEELLDILRDAIKDDALVISTLV
Y1664_STAA8     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1620_STAAC     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1565_STAAT     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1523_STAA3     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1466_STAAE     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1738_LACCB     --------NLYIMSDSVGETGLRLAQAVAAQFPNFEAHYVRFPFIHTEEKIYSALDEAKKENALAIMTFV
Y1655_STAA2     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1640_STAAR     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1621_STAA9     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1563_STAAM     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1550_STAA1     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1522_LACC3     --------NLYIMSDSVGETGLRLAQAVAAQFPNFEAHYVRFPFIHTEEKIYSALDEAKKENALAIMTFV
Y1515_STAAW     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1501_STAAS     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1435_STAAB     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1392_STAAN     -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y1250_STAES     -----------VASDSIGETAELVARAGVSQF-NPKQCKHEYPYIESFENVDEVIQVAKDTNAIIVYTLI
Y1129_STAEQ     -----------VASDSIGETAELVARAGVSQF-NPKQCKHEYPYIESFENVDEVIQVAKDTNAIIVYTLI
Y181_STAS1      ---------LFVISDSIGETAQRMIHATLTQFPDISQIEKKYPFIKNEEELMHILNRAKELNAVVVTTLV
Y1110_PEDPA     --------NIYILSDSVGDTGDQVAHAAAAQFLDVEFNFARHPFIHTISLLDSILNKAVREDAMVFSTFV
PDRP2_ARATH     ---------IYLVSDGTGWTAEHSVNAALGQFEDFSLNRHLFSWVEDEERLIEIIKQAAKEGAMCFYTLA
Y1243_HALOH     ---------IFIVSDSIGETAQYVVDATVSQFNGYLDSKR-FSYVQTTRELNNIIKKATEQKTLIAYTLI
Y2419_ENTFA     ---------IFVISDSAGETASKLAAASMAQYPTVDFTLIRRTFVKDEDKLVQALEDAKKAEAMVLHTII
Y3950_CLOB6     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIENNEAMIISTIV
YSI3_STAAU      -----------VASDSIGETAELVARAGISQFNPKQCKNELYPYIESFEDVDEVIQVAKDTNAIIVYTLI
Y699_LACS1      -----SITNIFVISDSVGETGLSLITAGTVQFPNSKFNIRRFPLTKTISLLQGILNKAKRENAIILHTFV
Y2715_BACLD     ---------IYVVSDSVGETAELVVKAAISQFNGSSEQTNIIPYVEDRGTIKEVISLAEADGGIICFTLV
Y863_CLOBK      -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y4116_CLOBJ     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y3856_CLOBL     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y3704_CLOB1     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y3611_CLOBH     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y3095_CLOBM     -------FKIYAVSDSIGETAEQVANATAYQFGSSVKVERV-PYVKTFEDVNNLISIIKNNEAMIISTIV
Y1513_SYNWW     -----------IVSDSIGETAEMVVRAAASQFNSGNMEIRQVPNISDTETLEEIINQAAASNFIIAYTLV
Y4901_CLOB8     ------------VSDSIGETANQVAVAAASQFTEKVDVKRI-PYVKSLEDVEDVMNIANECEXXXXXXXX
Y1359_THEP3     ---------IYLVSDSNVDTAENIASIAAAHFDTFIEKIKKYPYVGDKNQIEEIIMEANDANSIIIHTMV
Y1350_THEPX     ---------IYLVSDSNVDTAENIASIAAAHFDTFIEKIKKYPYVGDKNQIEEIIMEANDANSIIIHTMV
Y5851_SORC5     ---------IDVLSDSTGETAEKAVRAALLQYPDAGVQIRLHTRVRTPEVARPVLERAAQEGALVVFTVV
Y442_STAHJ      ---------LFIVSDSIGETAQRMIHATLTQFPDLHNVEKKFPYIKDEEEFLNILNLAREQHAIVATTLV
Y1866_LISMO     ---------IYVISDAIGETAQHIIRAVTAQFSLNKPADRRHAFIRDESALLETLEEAKATDGIVVQTLV
PDRP1_MAIZE     ---------IYIVSDGTGWTAEHSVNAALGQFENCAVNTHLFSLIDDMDRLIEVIKQAAKEGALVLYTLA
Y3504_CLOBB     ------------ISDSIAETAHQVTLAVAAQFKEKIKIRRV-PYIKTIDEVDCIFPXXXXXXXXXXXXXX
Y3704_LYSSC     -----------VVSDSVGETGDQVAKAVISQFRPENTVIRRFPHIQSEELIRKIVFLAAQQQAFIVYTLV
PDRP1_ORYSJ     ---------IYMVSDGTGWTAEHSVNAALGQFEHCAVNTHLFNGIDDMDRLIEIVKQAAKEGALVLYTLA
PDRP1_ORYSI     ---------IYMVSDGTGWTAEHSVNAALGQFEHCAVNTHLFNGIDDMDRLIEIVKQAAKEGALVLYTLA
Y3210_CHLSY     ---------LYIVSGGAGAVGEQVARLTLSQFEGAEVPLIIIPNVRDLSQIAEVVERAAHQNGTILHTLM
Y2965_CHLAA     ---------LYIVSGGAGAVGEQVARLTLSQFEGAEVPLIIIPNVRDLSQIAEVVERAAHQNGTILHTLM
Y980_THETN      ---------IYLVSDSNVDTAENIASIAAAHFDTFIEKIKKYSYVGDINQIDIVMEAANDSNSIIIHTMV
Y3298_CLOBA     ------------ISDSIAETAHQVTLAVAAQFKEKIKIRRV-PYIKTIDDVDCIFPXXXXXXXXXXXXXX
Y2484_GEOKA     ---------VYVVSDSGGETAELVVKAAASQF-HASPIQKRVPYVEDKTTLAEVVALAKMNRAIIAFTLV
YQFL_BACSU      ---------IYVVSDSVGETAELVVKAALSQFNGSADDTHVIPYVEDIGTINEVISLAKADGGIICFTLV
Y1946_OCEIH     ---------IYVLSDSVGETAELVVKAGLSQFKNGDYKIQRVPYVEDKETVDEFLALAKDTVSIVGFTLV
Y2421_GEOTN     ---------VYVVSDSGGETAELVVKAAASQYASPVQVKRV-PYVEDKTTLAEVVALAKMNQAIIAFTLV
Y606_MOOTA      ---------IYVISDSLGETAEYVARAAASQFDGGGLDIRRVPYVTDLDHLEEVVNEAAQEQGIIAFTXX
Y1369_DESPS     ------------------------------------------PHIRTESQVDHLLDRVKDVESLIAHTIV
Y1373_BACHD     ---------VYVVSDSVGETAELVVKAAASQFSGAGIEVRRIPYVEDKETVDEVIQLAKQADAIIAFTLV
Y2417_GEOSW     ---------VYVVSDSGGETAELVVRAAASQFYNSHIQLKRVPYVEDKTMLAEVVALAKMNQAIIAFTLV
Y2354_BACA2     ---------IYVVSDSVGETAELVVKASLSQFNGSADDTHIIPYVEDIGTINEVVSLAKADGGIICFTLV
Y1885_LISW6     ---------IYVISDAIGETAQHIIRAVTAQFSLNKPADRRHAFIRDXXXXXXXXXXXXXXDGIVVQTLV
Y122_CLOTE      ---------IYAVSDSIGETAEQVSKATARQFKERVDVKRV-TYIRTFEAVDDFINSIKDPENSMLITVV
Y1895_LISMF     ---------IYVISDAIGETAQHIIRAVTAQFSLNKPADRRHAFIRDXXXXXXXXXXXXXXDGIVVQTLV
Y1687_BACSK     MTNDTERLVVYIVSDSVGETAELVVKAAVSQFSGSNVELRRIPYVEDKGTIQEVVQIARKAKALIAFTLV
Y823_BACC2      ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4413_BACC4     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4293_BACCR     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y1980_LISIN     ---------IYVISDAIGETAQHIIRAVTAQFSLNKPADRRHAFIRDXXXXXXXXXXXXXXDGIVVQTLV
Y4147_BACWK     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4558_BACAC     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4540_BACAA     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4520_BACAN     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4429_BACC7     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4407_BACC3     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4376_BACC1     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4318_BACC0     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4044_BACCZ     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y4034_BACHK     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y3887_BACAH     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNQALICFTLV
Y2049_PROAC     -----SPLEIHVIADSTGETAVRLARAARSQFEGVHWHIVRHPMIGTVPEMVSALEAVSEAHEAVVHTLV
Y1185_STACT     -----------IASDSVGETAEQVAKACVSQFNSKNFKSEIYPYIETIENVDEVIEIAKENENIVVFTLV
Y347_SYNWW      --------HIFAVSDSVGETAEKIAVASVLQF-NLDRNITRFSRVTKEEQVEKIIDQAVENDAIIIYTIV
Y3022_BACCN     ---------VYVVSDSVGETADLVVRAAMGQFPFAPDIRRV-PYVEDTGTLKEVISIAKSNRALICFTLV
Y1750_BORA1     ---------VYIVSDSTGITAETFSQSVLSQFDQVDFKPIRLPFIDTLQKAEETAERINKNPPIVFSTLV
Y1715_STRA3     ---------IFIISDSLGETAKAIAKACLSQFPGHDDWHQCFSYINSQERLEQVFEEASQKTVFMMFSLV
Y1683_STRA1     ---------IFIISDSLGETAKAIAKACLSQFPGHDDWHFQFSYINSQERLEQVFEEASQKTVFMMFSLV
Y1671_STRA5     ---------IFIISDSLGETAKAIAKACLSQFPGHDDWHFQFSYINSQERLEQVFEEASQKTVFMMFSLV
Y1381_ACIAC     ------------ISDGTGITAETFGNAILAQF-DIKPRHVRLPFIDTEDKAHQAVRELEGKKPIVFTTLV
Y2621_BORBR     ---------VYIVSDSTGITAETFSHSVLSQFVNFKPVRFIDTLDKAREVVARINRNALEAPPIVFSTLV
Y1543_BORPA     ---------VYIVSDSTGITAETFSHSVLSQFVNFKPVRFIDTLDKAREVVARINRNALEAPPIVFSTLV
Y1520_METPP     ------------VSDGTGITAETFGNSILAQFS-AKPRHVRRPFIDTPDKAYQVVREINDTAGIVFITLI
Y1435_BORPE     ---------VYIVSDSTGITAETFSHSVLSQFVNFKPVRFIDTLDKAREVVARINRNALEAPPIVFSTLV
Y2880_ACISJ     ------------ISDGTGITAETFGNAILAQF-DIRPRHVRLPFIDTEDKAHQVVRELEGKKPIVFTTLV
Y2367_DIAST     ------------ISDGTGITAETFGNAILAQF-DIRPRHVRLPFIDTEDKAHQVVRELEGKKPIVFTTLV
Y5065_DELAS     ---------IFVISDGTGITAETFGTAIMAQFDTKSRLVRI-PFVDTMDKVHQAVRQIESHKPIVFTTLV
Y2834_LEPCP     ------------VSDGTGITAETFGNSILAQFA-IKPRHVRRPFIDNAEKADQVITEIEGKRPIVFITIV
Y3310_AZOSE     ------------ISDGTGITAETLGHSLLAQFPGARFRQVRVPFVDDDKALDRQIRETAVTDGIVFSTLV
Y2400_POLNA     ------------ISDGTGITAETFGNAILAQF-EISPRHVRLPFIDTVDKAHQAIRELEGKRPIVFTTLV
Y827_NEIMA      --------HVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y567_NEIM0      --------HVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y562_NEIMF      --------HVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y619_NEIMB      --------HVFYISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y2204_METFK     ------------ISDGTGITAESVGHLLA-HFPTVSFKHIRLPFTDSEQKVQEALLKIAETEKIVVMTLV
Y2529_DESPS     --------HIYYVSENTGLLAKDSGKSLLCQFPGVEFQEELLPFIRTKDDAQRTINAIREKCGIIFSTIF
Y2049_VEREI     ------------VSDGTGITAETFGNAILAQF-EMKPRHVRLPFVDTVDKAHQAVREVEGKKPIVFTTLV
Y1351_HERAR     ------------ISDGTGITAETFGHSVLTQFDKQIRLPFIDTLDKAHDALRKIAYELDGQRPIIFSTLV
Y4168_PSEAB     ------------ISDGTGITAETLGQSLLAQFENISFVKLTRPYIDTEEKARAMVQQINESDGAR--PII
Y3560_PSEA8     ------------ISDGTGITAETLGQSLLAQFENISFVKLTRPYIDTEEKARAMVQQINESDGAR--PII
Y2039_RALEH     ---------MFIVSDGTGITAETFSHSILAQFEMRFRKVRM-PFVDTPEKAHIAVGKINEAPPIVFTTLV
Y1769_PSEAE     ------------ISDGTGITAETLGQSLLAQFENISFVKLTRPYIDTEEKARAMVQQINESDGAR--PII
Y2168_AZOSB     ------------ISDGTGITAETLGHSLLAQFPEARIRQVRAPFIDDDKAIDNQIREAARNDGIVFSTLV
Y2122_HAHCH     ------------ISDGTGITAEALGQSLLAQFEFIETLPYIDSLEKARKAVARIASEIDGNKPVIFDTIV
Y1865_RALEJ     -----------IVSDGTGITAETFSHSILAQFEMRFRKVRM-PFVDTPEKAHIAVGKINEAPPIVFTTLV
Y1815_VARPS     ------------ISDGTGITAETFGNAVLAQF-EMKPRHVRLPFTDTVDKAHQAVRQINHTAEIVFTTLA
Y333_NEIG2      ------------ISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y202_NEIG1      ------------ISDRTGLTAENIGEALLNQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQIAFVSVV
Y997_NITMU      ------------LSDRTGITVEMLGHSLLSQFENIPLDEITLPYIDSKAKATSAVRTIDEARPLVFSTLV
Y2042_JANMA     ------------VSDGTGITAETFGHSVLTQF-ELRFKQVRLPFIDTPDKAYDALRKINETFAIIFSTLV
Y2037_BURCJ     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLDKAYATVEKINEAAAIVFTTLV
Y1974_BURM1     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLEKAYATVEKINEAASIVFTTLV
Y1420_RALSO     -----------IVSDGTGITAETFSHSILAQFEMKFRQVRI-PFVDTVDKAHVAVSKINEAFHVIVFTTL
Y6074_BURCA     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLDKAYATVEKINEAAAIVFTTLV
Y5313_BURS3     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLDKAYATVEKINEAAAIVFTTLV
Y2023_BURCC     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLDKAYATVEKINEAAAIVFTTLV
Y2003_BURCH     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLDKAYATVEKINEAAAIVFTTLV
Y2036_BURCM     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRL-PFVDSLEKAYATVEKINDAAAIVFTTLV
Y1905_BURA4     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRL-PFVDSLEKAYATVEKINDAAAIVFTTLV
Y4515_VIBVY     MQTEKQSRDVFYVSDGTAITCETLGHVVLGQFPFVAN-EKTFPFVESEEKLTELIKHIEISKPLVFFSLV
Y4006_VIBVU     MQTEKQSRDVFYVSDGTAITCETLGHVVLGQFPFVAN-EKTFPFVESEEKLTELIKHIEISKPLVFFSLV
Y1452_RALME     -----------IVSDGTGITAETFSHSILAQFEMRFRKVRM-PFVDTPDKAHVAVGKINEAPPIVFTTLV
Y3786_VIBCH     ------------VSDGTAITCETLGHVVLGQFA-VQPNEKTFPFVESDEKLSELLKQIQRSKPLVFFSMV
Y3745_VIBCM     ------------VSDGTAITCETLGHVVLGQFA-VQPNEKTFPFVESDEKLSELLKQIQRSKPLVFFSMV
Y252_VIBC3      ------------VSDGTAITCETLGHVVLGQFA-VQPNEKTFPFVESDEKLSELLKQIQRSKPLVFFSMV
YDIA_ENTAG      MTTDRSVFY---ISDGTAITAEVLGHAVLSQFVNITSVENVQRALAVKAQINALYQQSGVRP-LVFFSIV
Y2719_BURXL     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSTEKAYATLEKINEARPIVFTTLV
Y2439_BURPP     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSTEKAYATLEKINEARPIVFTTLV
Y1758_DECAR     ------------VSDGTGLTVEALGHSLMTQFEDIEFKQIRIPFLTSVEQAQEAVARINESDGIVFTTLV
Y3043_POLSJ     ------------ISDGTGITAETFGNAILAQF-EFKPRHVRLPFIDSVDKAHQAIREVEGKRPIVFTTLV
Y2500_ACIB5     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTLVFDTLV
Y2163_ACIBT     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTLVFDTLV
Y1909_BURVG     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFVDSLEKAYSTVEKINEAAAIVFTTLV
Y1578_ACIBS     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTLVFDTLV
Y1392_ACIBY     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTLVFDTLV
Y1301_ACIB3     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTLVFDTLV
Y2422_ACIAD     ------------ISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMNIVEEINQCQSLVFDTLV
Y4424_VIBSL     ------------VSDGTAITCETLGHVVLGQFP-FEANEKTFPFVESEDKLSDLLKEIEISEPLVFFSIV
Y2038_PSEU5     ------------ISDGTGITAETLGQSLLAQFENITFTKLTRPYIDTAEKARAMVQQINEKDGIIFDTLV
Y1868_PSEF5     ------------ISDGTGITAETLGQSLLAQFENVTFSKFTRPYIDSMEKARAMVQQINEKDGIIFDTIV
Y4373_VIBPA     ------------VSDGTAITCETLGHVVLGQFPFI-PNEKTFPFVESQDKVADVVKEIETSKPLVFFSIV
Y3710_CHRVO     ------------ISDRTGITAESLGHTLLTQFDALDFQRETVPFVDTVEKARALAERISEAERDHLRPLV
Y617_THIDA      -------YSVFCVSDHTGLTIEAVAKSVLAQFPRIEFSLITLPFIDDXXXXXXXXXXXXXXXXXXXFSSL
Y2043_BURTA     -----------IVSDGTGITAETFAHSILSQFDQKFRLVRV-PFIDSIEKAYGTVQKIDDAAQIVFTTLV
Y1334_PSYA2     ------------ISDGTAITAETLGRAILSQFASVPFETRVLPYVDNLERAEDAVVQINQRDGL-LPLVF
Y1035_PSYCK     ------------ISDGTAITAETLGRAILSQFASVPFETRVLPYVDNLERAEDAVVQINQRDGL-LPLVF
Y1741_PSEE4     ------------ISDGTGITAETLGQSLLAQFESIPFNKFTRPYIDTLDKARAMVQQINERDGVIIFDTI
Y5572_BURM9     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y4621_PSEFS     ------------ISDGTGITAETLGQSLLAQFENITFAKFTRPYIDSVDKARAMVQQINEKDGFIIFDTI
Y3839_BURMS     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y3811_BURM7     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y3659_PSEP1     ------------ISDGTGITAETLGQSLLAQFESIPFNKFTRPYIDSPDKARAMVQQINERDGVIIFDTI
Y2669_LARHH     ----------YFVSDRTGITAESLGNALLTQFDMLEFKRETIPFIDTADKAMAVAEQIRQRAQSDHFRLV
Y2566_BURP1     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y2476_BURP0     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y2420_BURP6     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y2383_ALTMD     ------------ISDGTAITAEVFGHALLSLFP-VSFNHNTIPFVETEEQAHKVLQQISESRPLVFYTIV
Y2143_BURPS     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y1539_BURMA     -----------IVSDGTGITAETFAHSILSQFDQIDSIEKAYDTVR---KINDAAQHDGRRP-IVFTTLV
Y2190_RHOFD     ------------ISDGTGITAETFGNAILAQFE--TNFRHVLPFTDSVDKAHQAVREINHAKSIVFTTLV
Y1592_PSEPG     ------------ISDGTGITAETLGQSLLAQFESIPFNKFTRPYIDSPDKARTMVQQINERDGVIIFDTI
Y1428_SODGM     ------------ISDGTAITAEVVGHSVLSQFPLTTAL-YTLPFVESETRARAVREQINQQSGVVFYSIV
Y2081_PSEPK     ------------ISDGTGITAETLGQSLLAQFESIPFNKFTRPYIDSPDKARVMVQQINERDGVIIFDTI
Y1769_PSEPF     ------------ISDGTGITAETLGQSLLAQFENITFSKFTRPYIDSVEKARAMVQQINETDGFIIFDTI
Y2063_CHRSD     ------------ISDGTGITAETLGRSLLAQFEGVDLTLVVKPYIDTLEKLAAIIAQTADRDGIVIDTIV
Y1825_ERWT9     --TERSVFY---ISDGTAITAEVLGHAVMSQFVTLPFVETVQRAQAVKAQINALYQQSGLRPFISIVTPV
Y869_NITEC      ------------LSDRTGITAETLGHSLLTQFDGIEWKKHYASFLDSAAKVQEIIDRIEGQPSLVFSTLL
Y6516_VIBHB     ------------VSDGTAITCETLGHVVLGQFSLI-PNEKTFPFVESEDKVADVIKEIEISKPLVFFSIV
Y1743_PSEA6     ----------YYISDGTAITSEVFGHALLSLFT--IEFEHIVPFVETEEQAKQVVKKISESRPLVFYTIV
Y1599_PSEPW     ------------ISDGTGITAETLGQSLLAQFDSIPFNKFTRPYIDTPDKARTMVQQINERDGMIIFDTI
Y2716_SHEWM     ------------ISDGTAITAEVFGHAVLSQF----PVEFTIPFVETESKANEVKAQINDC----FITTG
Y1317_IDILO     ------------ISDGTALTAEAFGHALLSMFP-VNFEHKTLPFIDNQEKANEVCKTIKKAPPLIFHTFV
Y628_DICNV      ------------ISDRTGITVESMGDALLNQF-EVNLKRENHPFIDSPEKAHQLVNIINATAESALRPLV
Y1428_ALCBS     ------------LSDGTGITAETLGHSMLSQFGSIEFIQVTLPFVQSDEQTREAVARIEDGAKPVVFSTL
Y2545_AERS4     ------------VSDGTAITAEVFGHAVLSQFPLVFE-QVTIPFVETLEKARQVRARIDEQTGLILFHTI
Y2298_SHEFN     ------------ISDGTAITAEVFGHAVLSQF----PIEFTIPFVETIQKAQKVKQQINDERPLVFHSII
Y1485_LEGPA     --------YVFMLSDGTGITAETLGNSLITQFENIQFEKITIPYIDSTHRAESVVLRINQTKPLVFMTLV
Y949_LEGPC      --------YVFMLSDGTGITAETLGNSLITQFENIQFEKITIPYIDSTHRAESVVLRINQTKPLVFMTLV
Y2550_SHEPA     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETQEKAEAVKAQINDC----FITTG
Y2244_SHEPC     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAEQVKRQINDC----FITTG
Y1764_SHESW     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAEQVKRQINDC----FITTG
Y1528_LEGPH     --------YVFMLSDGTGITAETLGNSLITQFENIQFEKITIPYIDSTHRAESVVLRINQTKPLVFMTLV
Y2421_STRM5     ------------VSDGTGITAETIGHSLLTQFSGFSFITDRMSFVDDPEKAREACSRIQAAGERVRPIVV
Y1498_LEGPL     --------YVFMLSDGTGITAETLGNSLITQFENIQFEKITIPYIDSTHRAESVVLRINQTKPLVFMTLV
Y2692_AERHH     ------------VSDGTAITAEVFGHAVLSQFP-LAFEQITIPFVETLEKARQVRMRIDEQTGVILFHTI
Y2602_SHEB9     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLTKAEQVKRQINDC----FITTG
Y2489_SHEB5     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLTKAEQVKRQINDC----FITTG
Y2482_SHEB8     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLTKAEQVKRQINDC----FITTG
Y1862_SHEB2     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLTKAEQVKRQINDC----FITTG
Y3013_COLP3     ------------ISDGTAITSEVFGHALLSEHHTISFIETTEKALAAKERINKATSR-GGKPALVFHTFV
Y2326_AZOVD     ------------ISDGTGITAETLGQSLLAQFENISFTKLTRPYIDTAEKARGMVQQINERDGAIIFDTV
Y2089_PSEU2     ------------ISDGTGITAETLGQSLLAQFENITFNKFTRPYIDSVEKARAMVQQINNAADIIFDTIV
Y2060_PSE14     ------------ISDGTGITAETLGQSLLAQFENITFNKFTRPYIDSVEKARAMVQQINNAADIIFDTIV
YPNA_THIRO      ------------VSESTGITAETLGHSLLSQFDTIDFEQVYMPYINTDKALTQRMQEAADRDGIVFATML
Y1750_PHOPR     ------------VSDGTAITSETLGHAVLGQFP-IEIHQTTHPFIETNKQVKTLVNQSHEKTGIKPLVFY
Y4058_PSEHT     ------------ISDGTAITSEVFGHATLSLF----PVEFNHPFVETEEKAHQIKELINEKP-LIFFTFV
Y2291_PSESM     ------------ISDGTGITAETLGQSLLAQFENITFNKFTRPYIDSVEKARAMVQQINNAADIIFDTIV
Y1889_ALHEH     ---------VYFISDRTGITAEALGHSLLTQFS-IDFEQRTIPFVDTEEKAAQVVEQLNVASQIVFSTVV
Y2645_SHEON     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAENVKRQINDERPLVFHSIV
Y219_HALHL      ------------VSDRTGITAEALGHSLMTQFS-VTTEQATIPFVDTXXXXXXXXXXXDDHPPIVFSTII
Y2084_PSEMY     ------------ISDGTGITAETLGQSLLAQFENIQFTKLTRPYIDSIDKARAMVQQIDERDGAR--PII
Y2212_XANOR     ------------VSDGTGITAETIGHSLLTQFSGFNFVTDRMSFIDAEKARDAAMRVRAAGERYQVRPVV
Y2080_XANOM     ------------VSDGTGITAETIGHSLLTQFSGFNFVTDRMSFIDAEKARDAAMRVRAAGERYQVRPVV
Y2010_SHEDO     ------------ISDGTAITAEVFGHAVLSQFPEALTIPFVETLVKAEKQINDCFITTGERP-LVFHSIV
Y1852_ERWCT     ------------VSDGTAITAEVLGHAVLSQFP-VNTVSYTLPFVESEVRAKAVCEQINQQTGVVFYSIV
Y1735_SHESA     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAENVKRQINDERPLVFHSIV
Y1666_SHESR     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAENVKRQINDERPLVFHSIV
Y1591_SHESM     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETLAKAENVKRQINDERPLVFHSIV
Y2157_KLEP3     --------HVFYISDGTAITAEVLGHAVMSQFVTLPFVENISRARAVKEQIDAIYQQTGIRP-LVFYSIV
Y2128_KLEP7     --------HVFYISDGTAITAEVLGHAVMSQFVTLPFVENISRARAVKEQIDAICQQTGIRP-LVFYSIV
Y2974_STRMK     ------------VSDGTGITAETIGHSLLTQFSGFSFITDRMSFVDDPEKAREACARIQAAGERVRPIVV
Y1548_SHELP     ------------ISDGTAITAEVFGHAVLSQF----PVEFTIPFVETTQKAEAVKAQINDC----FITTG
Y2358_NITEU     ------------LSDRTGITAETLGHSLLTQFDGIEWKKHYASFLDSAAKAQAVIEQIEGQPALVFSTLL
Y2177_YERE8     ------------ISDGTAITAEVLGHAVLSQFP-VKATTFTLPFVESATRAQEVCEKINEETGVVFYSII
Y1704_SHEHH     ----------------------------------------------------------------------
Y1870_SHESH     ------------ISDGTAITAEVFGHAVLSQF----PVEFTIPFVETEAKAHDVKLQINDC----FITTG
YDIA_SALTY      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALTI      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALSV      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALPK      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALPC      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALPB      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALPA      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALNS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALHS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALG2      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALEP      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALDC      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALCH      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
YDIA_SALA4      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
Y594_XYLFM      ------------VSDGTGITAETIGHSLLTQFSGFTFVERMVFIDDAEKARDASQRILAASERYRVRPIV
Y622_DEIGD      ---------------------------------------------------------------LIFTTIT
Y2203_XANC5     ----------------------------------------------------------------------
Y2042_XANAC     ----------------------------------------------------------------------
Y1727_CITK8     --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYQQTGVRP-LVFYSIV
Y1260_XYLFA     ------------VSDGTGITAETIGHSLLTQFSGFTFVERMVFIDDAEKARDASQRILAASQRYRVRPIV
Y739_YERPP      ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y2410_YERPE     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y2394_YERPB     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y2319_YERPS     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y1864_YERPN     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y1842_YERPY     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y1754_YERPA     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
Y1744_ENT38     --------HVFYISDGTAITAEVLGHAVMSQFP-VAINSITLPFVENEEQIDAIFQQTGTRP-LVFYSIV
Y1736_YERP3     ------------ISDGTAITAEVLGHAVLSQFP-INVTTFTLPFVENAKQINEIYQDTGVRP-LVFYSII
YDIA_SHIBS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_SHIB3      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
Y2073_SHEAM     ------------ISDGTAITAEVFGHAVLSQF----PMEFTIPFVETNAKAEAVKKQINDSRPLVFHSIV
YDIA_ECOL5      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO7I      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
Y2165_XANCP     ----------------------------------------------------------------------
Y2016_XANCB     ----------------------------------------------------------------------
Y1953_XANC8     ----------------------------------------------------------------------
Y2629_PHOLL     ------------ISDGTAITAEVLGHAVLSQFP-IKITSYTLPFVASETRAEEIKQQINQIRPLVFYSII
Y2103_ENTS8     ------------ISDGTAITAEVLGHAVMSQFP-VSINSITLPFVENEEQIDAIYQQTGVRPLVFYSIVL
YDIA_ESCF3      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_SHISS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_SHIFL      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_SHIF8      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_SHIDS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOUT      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOSM      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOSE      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOLI      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOLC      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOL6      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOK1      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOHS      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECODH      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECOBW      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO8A      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO81      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO5E      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO57      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO55      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO45      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO27      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
YDIA_ECO24      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
Y549_XYLF2      ------------VSDGTGITAETIGHSLLTQFSGFTFVERMVFIDDAEKARDASQRILAASERYRVRPIV
Y525_XYLFT      ------------VSDGTGITAETIGHSLLTQFSGFTFVERMVFIDDAEKARDASQRILAASERYRVRPIV
YDIA_ECOLU      --------HVFYISDGTAITAEVLGHAVMSQFP-VTISSITLPFVENESQIDAIYHQTGVRP-LVFYSIV
Y1728_DEIRA     -----------IVSDHTGLTAENIARALLTHFPG-QPLRYLRRPFTSDXXXXXXXXXXXERP-LIFTTTT
Y1884_MARAV     ------------ISDGTGLTAEALGHALLAQFEKIEFERVTVPYIDDEEKARDLVSRINKASEIVFDTIV
Y1850_SHEPW     ------------ISDGTAITAEVFGHAVLSQF----PLEFTIPFVETEKKAEAVKAQINDC----FITTG
LEU1_BUCUE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
Y426_RHOPS      ESELVNRLEAKCQQINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
Y300_RHOPT      ETELVNRLEAKCQEINSPSLSIIGPVMQLFEAYLGASTMGRVGAQHTLNAEYFQRIDALNYSMMHDDGQH
Y298_RHOPA      ETELVNRLEAKCQEINSPSLSIIGPVMQLFEAYLGASTMGRVGAQHTLNAEYFQRIDALNYSMMHDDGQH
Y395_RHOP2      EGELVARLEAKCQEINSPSLSIIGPVMQLFEAYLGASTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
Y380_RHOP5      EQDLVERLEKKCQDINIPSLSIIGPVMQLFQAYLGSSTTGRVGAQHTLNAEYFKRIDALNYSMMHDDGQH
Y294_RHOPB      EKDLVGRLEAKCEEINIPSLSIIGPVMQLFQAYLGSSTTGRVGAQHTLNAEYFKRIDALNYSMIHDDGQH
Y161_BRASB      EKDLVSRLEAKCQQINIPSLSIIGPVMQLFEAYLGASTAGRVGAQHVLNAEYFARIDALNYTMLHDDGQM
Y199_BRASO      EKDLVSRLEAKCQQINIPSLSIIGPVMQLFEAYLGASTAGRVGAQHVLNAEYFARIDALNYTMLHDDGQM
Y112_NITHX      EKDLVERLEAKCQEINSPSLSIIGPVMQLFQAYLGAATIGRVGAQHTLNADYFRRIDALNYTMMHDDGQH
Y102_NITWN      EKDVAVRLEARCQEINCPSLSIIGPVMQLFQAYLGADTTGRVGAQHTLNADYFKRIDALNYTMMHDDGQH
Y637_BRAJA      EKDLVSRLEDKCKGINVPSLSIIGPVMQLFEAYLGAATTGRVGAQHVLNAEYFKRIDALNYTMIHDDGQH
Y4385_OLICO     EKDLVERVEATCKDMNIPSLSIIGPVMELFRAYLGRETSPRVGAQHTLNAEYFNRIDALNYTMMHDDGQH
Y001_RHIEC      DRELANLIDERCVEMGVASVNVLEPVMNAFQIYLGAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQM
Y3935_RHILW     DRELASLIDERCVEMGVASVNVLEPVMNAFQIYLGAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQM
Y001_RHIL3      DRELASLIDERCIEMGVASVNVLEPVMNAFQIYLGAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQM
Y002_RHIE6      DRELASLIDERCTEMGVASVNVLEPVMNAFQIYLGAPSRRRVGAQHVMNAGYFARIEALNFTMDHDDGQM
Y4488_RHILO     DQKLARGIDERCATMGLPCVSVLEPVLTVFQSYLGTPAGRRVGAQHVLDAEYFRRIDALNFTMDHDDGQL
Y001_AGRVS      DPELADFIDRRCIEIGVPSVNVLEPVIGTFQAYLGPLARRRVGAQHVMNADYFARIEALNYTMDHDDGQM
Y001_AGRT5      DQQLAEFLDLRCHAIGVPCVNVLEPIIGIFQTYLGAPSRRRVGAQHALNADYFARIEALNFAMDHDDGQM
Y2974_MARMM     NADLRRELETRCVELGVPAIAILDPMLATLSAYLGRPVASRAGAQRSLDADYYRRIDALNYAMAHDDGQG
Y3350_RHISN     DRELAGMIDQRCREIGVPCVSVLDPIIELFQSYLGSPSRRRSGAQHVMDADYFARIEALNFTMDHDDGQM
Y3209_SINMW     DRELAGLIDQRCREIGVPCVSVLDPIIELFQSYLGSPSRRRSGAQHVMDAEYFARIEALNFTMDHDDGQI
Y001_RHIME      DRELAGLIDQRCREIGVPCVSVLDPIIELFQSYLGSPSRRRSGAQHVMDAEYFARIEALNFTMDHDDGQV
Y008_BARBK      DQEIKQLLSRECTKIGVPCAAVLDPVLNVFQSYLGTPKNLRVSAQHDLNTDYFRRIEALDFTIEHDDGQS
Y001_BARQU      XXXXXXXXXXRCEKMEVPCIDILHPVLDAFQSYLGTPTNLRVSAQHDLNADYFRRIEALDFTIEHDDGKS
Y3478_MESSB     DQKLARQVDERCQAMGLPCVSVLEPVLAVFQSYLGTPAGRRVGAQHVLDAEYFRRIDALNFTMEHDDGQL
Y001_CAUCR      DPGLRAALEEGCRKLEMPCIAALDPVISAMSRYLGARISTRVGAQHALTNDYFDRIEALDYAIAHDDGQG
Y001_HYPNA      DGALRGRLEAFCRERSIPTLPVLDPSIAMLSRHLGVAPNNRVAGQHALDEDYFERMEAINFTLAHDDGQN
Y001_BART1      DEEXXXXXXXXXXXXXXXXXXXXHPVLNAFQSYLGTPTHLRVSAQHDLNADYFRRIEALDFTIEHDDGQS
Y2842_SPHAL     NGELRSSLERRARMLDLPTVAALDAVTDALSRMLGQEAKARPGRQHVLDAAYFARVEAIQFTVAHDDGIG
Y001_BARHE      XXXXXXXXXXXXXXXEIPCIDILHPVLNAFKSYLGIPTNLRVSAQHGLNADYFRRIEALDFTIEHDDGQS
Y117_NOVAD      NAETRERLEQRCAALGLPSVAALDAVTDALQQQLGIQAKGRPGRQHMMDEAYFARVDAIQFTIAHDDGVG
YD000_ERYLH     NAETRRALRDHCRRLSLPAVDALDEVTAALEVQLGQEAHGRPGRQHKMDEAYFKRVEAIQFTIAHDDGVG
Y853_OCHA4      DQKLAAIIDDSCAEMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFTMEHDDGQL
Y2113_BRUC2     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2068_BRUA2     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2067_BRUSU     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2060_BRUME     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2042_BRUAB     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y1987_BRUO2     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2129_BRUMB     DQKLAAIIDESCADMGVPSVSVLEPVLNTFQSYLGAPAHRRASAQHVLNADYFRRIDALNFMMEHDDGQL
Y2832_SPHWW     NNDIRTRLESRCHALGLPSVSALDPVIDXXXXXXXXXXXXRPGRQHILDAAYYARVEAIQYTIAHDDGIA
Y4549_MAGSA     DGAVRGLLEEACRHRGIPCISLLDPVMAGLSAFLGVEVTALPGRQYQLDAEYFRRIDAMQFTLSHDDGQL
Y2476_ACICJ     DQALRHELDEACQRLGLRILHVLDPVFDLLAEELGTPTRPTPGRQYVLDADYFRRIDAMHFVLSHDDGQA
Y003_GRABC      EPGLRSELENFCSRIGIAVVHVLDPVLSLLQHHIGEQAIARPGRQYVLDADYFRRIDAMHFVLAHDDGQA
Y3615_RHORT     DPEIRRALEEACRLINIPCVALLDPVMDALALVLETKGNQQPGRQYTLDEGYFSRIEAMHFALALDDGQS
Y324_NEOSM      ERIIRDTLKDFCQKRKIPCIAVLSRVIRELSSYLGIEPIHTSKEEYTFNEDYFARIDAMNYVLTHDDGQN
Y316_ANAMM      DDDLRKYLKEKATAQSVRCIPVLAHVIREISCYLQV-TKDPNAHPHKLGDEYFNRIDAINYTISHDDGQN
Y486_WOLPP      DDGLRKYLKDNCIKLKIPYRAILSHIIREISSYLEIEKDEKLDLYTEINNEYFQRIEAINYTINHDDGQN
Y235_ANAMF      DDDLRKYLKEKATAQSVRCIPVLAHVIREISCYLQV-TKDPNAHPHKLGDEYFNRIDAINYTISHDDGQN
Y205_EHRRW      DDDIRKYLKQKAGIHEIPCIPILSHVIREISCYLNIKKDPYINTSIGLDDEYFTRIDAINYTIAHDDGQN
Y005_RICRS      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y001_RICRO      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y001_RICCN      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y202_EHRRG      DDDIRKYLKQKAGIHEIPCIPILSHVIREISCYLNIKKDPYINTSIGLDDEYFTRIDAINYTIAHDDGQN
Y001_RICAE      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y450_GEOSL      DTELAQLLRDEAEAHGLDAIDLISPLLFKLSDFFGEAPQKEPGLLHQINSEYHKRVDAVDFTVKHDDGQD
Y4470_WOLWR     DDELRKYLKDNCIKLKIPYRAILSHIIREISSYLEIEKDEKLDLHTEINNEYFQRIEAINYTINHDDGQN
Y341_WOLPM      DDELRKYLKDNCIKLKIPYRAILSHIIREISSYLEIEKDEKLDLHTEINNEYFQRIEAINYTINHDDGQN
Y3384_GEOMG     DAELAQLLRDEAEAHGLDALDLISSLLFKLSDFFGVAPQNEPGLLYELNTEYHKRIEAVDFTVKHDDGQD
Y001_RICFE      DQELRKALTKFCYELKIPCISVIGKIIKEISVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y633_WOLTR      NDKLRKYLKDNCVKLKIPYRAILSHIMREISSYLEIEKDEKFDLHTEINNEYFQRIEAINYTINHDDGQN
Y001_RICM5      DQELRKALTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y895_EHRCR      DDELRRYLKQKAGAQEIPCIPVLSHVIREISCYLHIKKDPYISTNIGLDDEYFTRIDAINYTIAHDDGQN
Y001_RICTY      DQELRKALTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y005_RICAH      DQELRKALTKFCYELKIPCISVIGKIIKEMSVFSCIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y343_PELUB      DTSLAKFLANKGDEKKIPCFSVLGNLIMNFSKLLNQKASHVPSGQHALNEEYYERIEAIQFTMAHDDGNL
Y005_RICPU      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y001_RICPR      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQM
Y3081_DESHY     VKKLRNYLEKKAQDYELRTVDILGPLIKMLADQTGLLPSYTPNVTHILDEQYFRKVDAIEFAVKYDDGKD
Y207_EHRCJ      DDDIRRYLKQKAEVQEIPCIPVLSRVIRELSCYLHVKKDPYVNTGMGLDDEYFTRIDAINYTIAHDDGQN
Y4252_DESHD     VKKLRNYLEEKAKDYGLRTVDILGPLIKMLADQTGLLPSYTPNVTHILDEQYFRKVDAIEFAVKYDDGKD
Y005_RICB8      DQELRKTLTKFCYELKIPCISVIGKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQL
Y001_RICBR      DQELRKTLTKFCYELKIPCISVISKIIKEMSVFSGIEIEKEQNYNYKFDKTYFDTLNAIDYAIRHDDGQL
Y4292_GEOUR     DNVLAQYLHNEANLRELEAIDLITPLLFKLASLLGIPPQKEPGLLYQLNTEYYKRMEAVDFTVKQDDGQE
Y410_GEOSF      DNELAQYLEANLRQLEA--IDLITPLLYRLASLLGIQPQKEPGLLYQLNSEYYKRMEAVDFTVKQDDGQE
Y997_GEOLS      DSSLAVAVHTIAEEHGLMAFDLLSPLLHSLSVFLGTVAQSTPGLLHQIDTDYFRRMEAVNFTVKHDDGQE
Y242_GEOBB      NTELAQFVRNEVEARQLEAVDLITPLLYKLAEFLEMRPQKLPGLQYEMNSEYYRRMEAVDFTVKQDDGQE
Y226_GEOSM      NTELAQFVRNEVEARQLEAVDLITPLLYKLAEFLEMRPQKLPGLQYEMNSEYYRRMEAVDFTVKQDDGQE
Y961_ANAPZ      DDDLREYLKKKAEAYNIRCIPILSHIIREISCYLSVAKDPNAHP-HRLSDEYFNRIEAINYTIAHDDGQS
Y005_RICCK      DQELRKTLTKFCYELXXXXXXXXXXXXXEMSVFSDIEIEKEQNFNYKFDKTYFDTLNAIDYAIRHDDGQM
Y2958_PELPD     DPSLSQKVAQLAEDHGMYAVDLLGGLIYSLSCFLGATSQAKPGLLHRIDTDYFKRMEAVNFTVTHDDGQD
Y1093_BDEBA     SQGLRAKIREMASGKGIPYFDLLGPLLSTLDTFFGQHSEDTVGALRAVDERYFKRIEAIEYTVKHDDGKT
Y3020_ALKMQ     VEELRNYIMEEAEKMQIRSIDIMSPVLHAMGGALTTTPKREPGLIRRLDEKYFRKVEAIEFAVKYDDGKD
Y585_SYMTH      VPEIRKELQRLVDMWDIPAVDIMGPMLDGISRLLGAPEKLEPGRIHRLDDDYFRRIEAVEFAVKYDDGKD
Y743_LACBA      SPKLSQHVREFAAMNHLQQFDCIQPAMDVMHQATGLEPEGVPGLVHNLNDTYFDRIAAMEFAVTYDDGKD
Y1257_ALKOO     ISELREFLIEEAVHLNIPYADVITPILSAMESVLEIPAKKEPGLIRKLDERYFRKVEAIEFAVKYDDGKD
PDRP1_ARATH     DPSMAEATMRACKLWKIPSLDILGPITESISSHLGTNPSGRGITNSSLNEDYFKRIEAIEFTIKHDDGAL
Y1326_LACJO     HEDEQLAVIKFAREHNMKYVDLLSGVIDNIHALTGEEPKHEIGAVHHMGQNYFDRISAMEFAVMYDDGKD
Y2242_CLOPE     TVNVREYLTQKCIEKNINIINVLGPIINVASTILNKYPDYNPGAMWNTDETYYKRIEAMEFAMQYDDSKD
Y076_CLOPS      TVNVREYLTQKCIEKNINIINVLGPIINVASTILNKYPDYNPGAMWNTDETYYKRIEAMEFAMQYDDSKD
Y1520_STRU0     DDDLARYAQERSEEEHFVYVDLLSNVIKAMSKLSGVEPLGQPGLLRKLDKHYFKRVEAIEFAVKYDDGKD
Y1256_LACDA     DEKLQLPIIKFAREHKARYIDILSPIIEAISQTTHMKPTGLVGANHQLTNKYFNRISAMEFAVMYDDGKD
Y1123_LACGA     HEDEQLAAIKFAREHNMKYVDLLSGVIENIHSLTGEEPKHEIGAVHHMGQNYFDRISAMEFAVMYDDGKD
Y1494_LISIN     LESVREELNKTAQAFGVPIIDLFGPLLNQLEETYKIKPLSEPGRVRSMDEAYFNKVAAIEFAVENDDGRN
Y1476_LISMF     LESVREELNKTAQAFGVPIIDLFGPLLNQLEETYKIKPLSEPGRVRSMDEAYFNKVAAIEFAVENDDGRN
Y1457_LISMO     LESVREELNKTAQAFGVPIIDLFGPLLNQLEETYKIKPLSEPGRVRSMDEAYFNKVAAIEFAVENDDGRN
Y1174_LACDB     DEKLQLPIIKFAREHKARYIDILSPIIEAISQTTHMKPTGLVGANHQLTNKYFNRISAMEFAVMYDDGKD
Y442_CARHZ      RPDLKEYLEKRAHELSLPHVDIMGPMLEGLKQITKQNPKYQPGLIRKMDEAYFSKVEAIEFAVKYDDGKE
Y1472_LISW6     LESVREELNKTAQAFGVPIIDLFGPLLNQLEETYKIKPLSEPGRVRSMDEAYFNKVAAIEFAVENDDGRN
Y2438_PELCD     NRELAQYIKDECEVRGLMAFDLVTPLLSQFSQFFGRTPGQTPGLLHDMDEEYFRRIEAVEFTVKHDDGQE
Y1306_LACH4     KDEMQMPVIKFAREHNIQCVDIFSPVVEAIKQTTHMTPDQKIGAQHSLNQKYFDRISAMEFAVMYDDGKD
Y1143_LACSS     NHTLQETVTQFCQAKHLTLIDLLSPLTTAISERSQTASLETPGSLRKLDEHYFHRISAMEFAVRYDDGQD
Y1055_STRSV     DSKLAAVAREFSQANGLAYLDLMHPFFEIIREKTGTSPIEVPGTLHRLDTEYFNKISAIEFAVKYDDGKA
Y872_LACSS      TTGLSEIAQNYCDAKKIASFDMMSPLTKLITAKTSLAPSGEAGALHHLNDRYFDRISAMEFAVMYDDGKD
Y1193_STAS1     KPEIRKYMEAKLAEFKIKAVDIMGPLMNILLDQIDEKPYFEPGLVHQLDEAYFKKIDAIEFAVKYDDGKD
Y1353_STAHJ     KPEMKTYMESKIGTNKLRSIDIMGPLMGYLKDAFEENPYNQPGRVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1206_LACAC     KDEMQIPVIKFARDHNIQCVDIFSPVVEAIQQTTHMIPDQKIGAQHSLNQKYFDRISAMEFAVMYDDGKD
Y2411_CLOD6     DEELCSIVERYCEREGLSCIDLMTDILREISKRTGRKPKREAGIIRKLDESYFKRVEAIEFAVKYDDGKD
Y1974_LACPL     DRRLSQIVNQFCEAHELPYYDVITPALDTFSQITHVQPSNHPGTVHALNTNYFDRINAIEFAVTYDDGKN
Y2169_STAEQ     -SESFNALGHQANEHQIPYVDYMSELISIIKQHTHAKPLMESGALRKLNDEYFKRIEAIEYSVKYDDGKH
Y2159_STAES     -SESFNALGHQANEHQIPYVDYMSELISIIKQHTHAKPLMESGALRKLNDEYFKRIEAIEYSVKYDDGKH
Y1026_ENTFA     SKQLITAAKEFSERTGLLYLDLMAPFFELIQAKAGVDPIEEPGRRHQLDRAYFDKISAIEFAVKYDDGKN
Y812_STRGC      DGKLASVAREFSQAHGLSYLDLMHPFFEIIKEKTGTDPIEVPGTLHRLDSEYFNKISAIEFAVKYDDGKA
Y1664_STAA8     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1620_STAAC     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1565_STAAT     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1523_STAA3     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1466_STAAE     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1738_LACCB     TSGFAQLATHYAKDQGVIAIDVMSPILSGIKSITHEEPNHVPGAVHDLNERYFDRISAMEFAVLYDDGKD
Y1655_STAA2     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1640_STAAR     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1621_STAA9     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1563_STAAM     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1550_STAA1     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1522_LACC3     TSGFAQLATHYAKDQGVIAIDVMSPILSGIKSITHEEPNHVPGAVHDLNERYFDRISAMEFAVLYDDGKD
Y1515_STAAW     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1501_STAAS     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1435_STAAB     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1392_STAAN     KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1250_STAES     KPEIKKYMISKVNEHALKSVDIMGPLMELLSNSIEETPYYEPGMVHRLDDAYFKKIDAIEFAVKYDDGKD
Y1129_STAEQ     KPEIKKYMISKVNEHALKSVDIMGPLMELLSNSIEETPYYEPGMVHRLDDAYFKKIDAIEFAVKYDDGKD
Y181_STAS1      NPDFNIAGQHLAKKLQIPYIDYMSDLIGIIQQQTQCNPILESGALRKLDENYFKRIEAMEYAVKYDDGKH
Y1110_PEDPA     NPELNQYAADFCNQNTLKYLDVLTPAVNLFAEKTNLAPENKPGRTHSLNAKYFDKISAMEFAVTYDDGKD
PDRP2_ARATH     NPSMAKSAKQACDQLGVLSVDILGPIIEGIASHLGVSTRGAPGRVKTLNDAYFKRIEAIEFTIKQDDGTL
Y1243_HALOH     DPRLREEIATLARKNNIYAVDIMGPMMEAFEEFFQKKPRLQPGLVHRLDKDYFKRVEAMEFTVKYDDSND
Y2419_ENTFA     NDHLVAIANQFFNEHQLFHFDILTPPVAEIERLTGVAPMREPGALHHLNENYFKRIEAMEFAVKYDDGKD
Y3950_CLOB6     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
YSI3_STAAU      KPEMKQYMSEKVAEFQLKSVDIMGPLMDLLSASVEEKPYNEPGIVHRLDDAYFKKIDAIEFAVKYDDGKD
Y699_LACS1      NPELSDYVNNFGKENNLHVIDALTGVVQTLAEITGEKPLNAAGLKHKLNPDYFKRIEALEFAVTYDDGKD
Y2715_BACLD     VPEIREFLIAEAEKANVVYYDIIGPLIEKMESVYGFSAKYEPGRVRQLDEDYFKKVEAIEFAVKYDDGRD
Y863_CLOBK      LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y4116_CLOBJ     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y3856_CLOBL     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y3704_CLOB1     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y3611_CLOBH     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y3095_CLOBM     LVDIREFLVQRCVESGIHISNVLGPCISLVSTILNKTPEYKPGAVWDMDKKYYKKIEAMEFAIRYDDSKD
Y1513_SYNWW     INELADFLKMEARKKGVICVDVLGPVIEAFKSVSDIEPRREPGLLRKVDEMYYRRVEAVEFAVRYDDGKD
Y4901_CLOB8     XXXXXRELTQKAMEKNISVMNVLGPIINVASTILNTHPTYNPGAMRQTDEVYFKRIEAMEFAMQYDDSKD
Y1359_THEP3     VPELKDYLLKKAQKFGIKIVDVMGPVINAIEDSTGISPHTNLAKNN--KEDYLKKIEVIEFAVKYDDGKD
Y1350_THEPX     VPELKDYLLKKAQKFGIKIVDVMGPVINAIEDSTGISPHTNLAKNN--KEDYLKKIEVIEFAVKYDDGKD
Y5851_SORC5     SPELREFVHASTAELNIEAIDLIGSLIVRLGTFLDREPINLPSAMLPLSEEYFRRIEAVEFAVKSDDGKE
Y442_STAHJ      -SESFNALGHQAHEHDIPYVDYMSDLISIIEKVTHSQPLMESGALRKLNDEYFKRIEAIEYSVKYDDGKH
Y1866_LISMO     QAKLAEYATNFCVQNNIPNVDLLHTLTAAVEAKTGLKSKQDPGNMRRLDSNYFDRIAAIEFAVKYDDCKD
PDRP1_MAIZE     DPSMAEATKKACDFWGVPCTDVLRPTVEAIASHIGVAPSGIPRSNGRLSEDYFQRIDAIDFTIKQDDGVL
Y3504_CLOBB     XXVDVRELTKKCYDENIYIMNVLGPIIDSISSMLNTNPEYKPGAMRQIDEIYYKRIEAMEFAMQYDDSKD
Y3704_LYSSC     RQEMRKLLRDLCEQEKIHAVDIIGPALQSMATFMEENPLETPGIVHMLDDDYFKKIEAIEFAVKYDDGRD
PDRP1_ORYSJ     DPSMAEATKKACELWGVPSNDILRPTIEAIASHIGVAPSGSPSRKGQLTEDYFRRIEAIDFTIKQDDGAQ
PDRP1_ORYSI     DPSMAEATKKACELWGVPSNDILRPTIEAIASHIGVAPSGSPSRKGQLTEDYFRRIEAIDFTIKQDDGAQ
Y3210_CHLSY     EPSXXXXXXXXXXXXGVAEIDLVGSVLSRLATVLRKEPLGKPGLYQPRRSAYFERLDAIEYTVAHDDGNK
Y2965_CHLAA     EPSXXXXXXXXXXXXGVAEIDLVGSVLSRLATVLRKEPLGKPGLYQPRRSAYFERLDAIEYTVAHDDGNK
Y980_THETN      VKELKEYLQKKAQKFGIKIVDVMGPVIDAIEDSTGISPHTEL--LRDSKEDYLKKIEVIEFAVKYDDGKD
Y3298_CLOBA     XXVDVRELTKKCYEKNIYIMNVLGPLIDSISSMLNTNPEYKPGAMRQIDEIYYKRIEAMEFAMQYDDSKD
Y2484_GEOKA     VPEMREFLLAEAAREGVVAYDIIGPLIEKMSHLFQLTPRYEPGQVRVLDEDYFKKIEAIEFAVKYDDGRD
YQFL_BACSU      VPEIREYLIAEAEKANVLYYDIIGPLIDKMETAYGLTAKYEPGRVRQLDEDYFKKVEAIEFAVKYDDGRD
Y1946_OCEIH     DPELRAYVNSQAKKLEVEAIDIMGPTMDAMGRVFNRTPRLEAGLVHKLDEDYFKKIEAIEFAVKYDDGRD
Y2421_GEOTN     VPEMREFLLTEAAREGVVAYDIIGPLIEKMSDLFQLKPRYEPGQVRVLDEDYFKKIEAIEFAVKYDDGRD
Y606_MOOTA      XXXXXXXXXXXXXXXXXEAVDLLGPLMDAITRVTGGRPRLEPGLIRRTDEDYFRKMEAIDFAVKYDNGKD
Y1369_DESPS     EPNLRQYLVTKAEEHKIVTIDLMGQVLNKIETFLSIRPLGKPGLYRETHQVDLKQVTAIDFALAHDDGLR
Y1373_BACHD     VPGIRTYLLEKATEAKVETVDIIGPMLEKISSLTKEEPRYEPGIVYRLDEDYFRKVEAIEFAVKYDDGRD
Y2417_GEOSW     VPEMRQFLIEEAAREGVVAYDIIGPLIEKMSDLFKLTPRYEPGQVRVLDEDYFKKIEAIEFAVKYDDGRD
Y2354_BACA2     VPEMRKYLVEQAEKANVLYYDIIGPLIDKMESAYGLTAKYEPGRVRQLDEDYFKKVEAIEFAVKYDDGRD
Y1885_LISW6     QSPLAEYATDFCAQNNIPNIDLLHTLTAAVEAKTGLKSKQDPGNMRRLDSNYFDRIAAIEFAVKYDDCKD
Y122_CLOTE      LVDIREFLVERCIERGIRIVNVLGPCISTASRVLKTTPTYEPGAVWNMDDRYYKKIEAMEFAMRYDDSKD
Y1895_LISMF     QAKLAEYATNFCVQNNIPNVDLLHTLTAAVEAKTGLKSKQDPGNMRRLDSNYFDRIAAIEFAVKYDDCKD
Y1687_BACSK     VPEIRDFLLESAKAANVETVDIIGPVLSKITDLTNAKPRYEPGLIYRLDEDYFRKVEAIEFAVKYDDGRD
Y823_BACC2      KPDMRQYLVTEAAREGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4413_BACC4     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4293_BACCR     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y1980_LISIN     QSKLADYASNFCVKNHLQNVDLLHTLTAAVEAKTGLKSKQDPGNMRRLDSNYFDRIAAIEFAVKYDDCKD
Y4147_BACWK     KPDMRQYLLTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4558_BACAC     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4540_BACAA     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4520_BACAN     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4429_BACC7     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4407_BACC3     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGRVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4376_BACC1     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4318_BACC0     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4044_BACCZ     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y4034_BACHK     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y3887_BACAH     KPDMRQYLVTEAAKEGVEAYDIIGPLIDQIEEITGQVPRYEPGVVRRLDEEYFKKIEAIEFAVKYDDGRD
Y2049_PROAC     LPDMRRMVSDACEEMGIRELDLMGPMLEAMEEASGLDADAVPRRPVGVEADYFTRISAMEFAVRNDDGAI
Y1185_STACT     KPDIKQYMEERLAENKIKHVDIMGPLMSILTDKIDEQPYCEPGIVHKLDEAYFKKIEAIEFAVKYDDGKD
Y347_SYNWW      KPELSRFLDETARIKQVIAVNVMAPLFDAIQFKTGQKPEYITGLTHKMDDQYFNRMKAIEYTIEHDNGQN
Y3022_BACCN     KPDMRQYLLTEAAKEGVEAYDIIGPLIDQIAEITRQVPRYEPGIVRKLDEEYFKKIEAIEFAVKYDDGRD
Y1750_BORA1     NPEIL----ARVRQANGVFLDLFGTFVSHIEQALGLKSSPSIGRSHMQSEKYRNRIDAINFSLAHDDGQF
Y1715_STRA3     DVALASYAQKRCESEHYAYVDLLTNVIQGISRISGIDPLGEPGILRRLDNDYFKRVESIEFAVKYDDGRD
Y1683_STRA1     DVALASYAQKRCESEHYAYVDLLTNVIQGISRISGIDPLGEPGILRRLDNDYFKRVESIEFAVKYDDGRD
Y1671_STRA5     DVALASYAQKRCESEHYAYVDLLTNVIQGISRISGIDPLGEPGILRRLDNDYFKRVESIEFAVKYDDGRD
Y1381_ACIAC     NMSVLRIIQENCQGM---LLDMFGTFIRPLEGELGIKSLHRVGADVSLSKEYTDRIEAINFSLDHDDGQS
Y2621_BORBR     NPEIL----ALVRQSNGVFLDLFGTFVSHIEQALGLKSSHSIGRSHAANSEYRNRIDAINFSLAHDDGQF
Y1543_BORPA     NPEIL----ALVRQSNGVFLDLFGTFVSHIEQALGLKSSHSIGRSHAANSEYRNRIDAINFSLAHDDGQF
Y1520_METPP     DTEVRGIIRSAHCLV----LDMLGTFVEPLEAEFGIKSNHRVGRFDDISKEYTDRIEAINFSLAHDDGQS
Y1435_BORPE     NPEIL----ALVRQSNGVFLDLFGTFVSHIEQALGLKSSHSIGRSHAANSEYRNRIDAINFSLAHDDGQF
Y2880_ACISJ     NMSVLKIIEDGCRGM---LLDMFGTFIRPLESELGVKSHHRVGSDISVSKEYSDRIEAINFSLDHDDGQS
Y2367_DIAST     NMSVLKIIEDGCRGM---LLDMFGTFIRPLESELGVKSHHRVGSDISVSKEYSDRIEAINFSLDHDDGQS
Y5065_DELAS     NQDMLDLIESQCK---GKVFDMFGTFVRPLELELGQKSLHRVGADISESKEYLERMEAINYTLAHDDGQT
Y2834_LEPCP     NDTVREKIGSHS---NALVLDMFRTFVEPLEAELQLTSNHRVGSDVAKSQEYHDRIEAINFSLAHDDGQS
Y3310_AZOSE     NPDPLSGL----REIDALFVDLFEQFINPLEAELGQRSTHTVGRFHGISSDYKARIEAINFAMAHDDGVS
Y2400_POLNA     NMDILAVLKAQC---NGMLLDMFGIFVAPLESELGIKSNHRVGSDASKSKAYDERIEAINFSLAHDDGQS
Y827_NEIMA      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATASEQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y567_NEIM0      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATASEQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y562_NEIMF      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATASEQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y619_NEIMB      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATASGQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y2204_METFK     NTDLRDMLK----QSNAVHLDVFGSFVDPLAEELQEQPSRTSGIAHSLGNSYYERIDAINFTLNHDDGMT
Y2529_DESPS     DPE-INKI---LQHEDVILLNICEPFLTQLEGMLGKNALRASGHSRNVDQQIMSRVDAIHYTISHDDGTA
Y2049_VEREI     NMEVLKTLQDGCQGM---LLDMFGTFVHPLEQELGIKSHHRVGASHS--KEYSDRIAAINFSLAHDDGQS
Y1351_HERAR     KANLSKVV----RQSKGMHMDLIQTFVEPLEQELGVKSTHTIGRSHTSSEEYKNRIEAINFSLAHDDGQS
Y4168_PSEAB     FDTIVNRIRAVLAQSNGFMIDIFATFLSPLEQELSADSSYSVGKSHSINSNYMDRIEAVNFALDNDDGAR
Y3560_PSEA8     FDTIVNRIRAVLAQSNGFMIDIFATFLSPLEQELSADSSYSVGKSHSINSNYMDRIEAVNFALDNDDGAR
Y2039_RALEH     NQEANKALRRAKAMILDMFQTFIEPL----EKELGLKSTHAIGRFHQ-NADYKNRIEAINFSLAHDDGQS
Y1769_PSEAE     FDTIVNRIRAVLAQSNGFMIDIFATFLSPLEQELSADSSYSVGKSHSINSNYMDRIEAVNFALDNDDGAR
Y2168_AZOSB     SPETVEALHKADALFLDLFDRFIGPL----ETELGQRSTHTVGRFHGISLDYKNRIEAINFAMAHDDGVS
Y2122_HAHCH     NSEI----RAEIRKSQGYMIDIFGTFLEPLEQELGSKSTYTVGKSHSINSSYNRRIDAMNYALENDDGAR
Y1865_RALEJ     NQEANKALRRAKAMILDMFQTFIEPL----EKELGLKSTHAIGRFHQ-NADYKNRIEAINFSLAHDDGQS
Y1815_VARPS     NMEVLEVIETGCKGM---LLDMFGTFVRPLEIELAVKSNHRIGSDVSKSKEYDARIAAIDFSLAHDDGQS
Y333_NEIG2      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATVSGQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y202_NEIG1      DDEIRRIIKADAFQIN-----FFETFLGLLEKELNTEATVSGQGHHSIGKRYDARMEAVNFSLNHDDGVS
Y997_NITMU      NPEIINSADA----LHLDCFSIIAPL----EAELGARSSENMGRSHRVSTGYWKRINAINYALEHDDGLS
Y2042_JANMA     KADLSSIV----RQSQGMHMDLIQTFVEPLEQELGVKSTHTIGRSHTSSEEYKNRIEAINFSLAHDDGQS
Y2037_BURCJ     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y1974_BURM1     DSESNEIVKRSNALVLDMFQRFVEPLEQ--ELQLKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y1420_RALSO     VDAEANRI---VHQARATILDMFQTFIEPLERELGLKSSHAIGRFHQ-NADYKNRIEAINFSLAHDDGQS
Y6074_BURCA     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y5313_BURS3     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y2023_BURCC     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y2003_BURCH     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y2036_BURCM     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y1905_BURA4     DSESNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y4515_VIBVY     LPDLKARL------MESPAYDVLESIVQRVKDDIQMEPTPKLQRSRSVGKDYFDRIAAIEYTLAHDDGIS
Y4006_VIBVU     LPDLKARL------MESPAYDVLESIVQRVKDDIQMEPTPKLQRSRSVGKDYFDRIAAIEYTLAHDDGIS
Y1452_RALME     NAESNKAIRRAKAMILDMFQTFIEPL----EKELGLKSTHAIGRFHQ-NADYKNRIEAINFSLAHDDGQS
Y3786_VIBCH     IPEMRTRL----LQAPAHFYDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDYFDRIAAIEYTLAHDDGVS
Y3745_VIBCM     IPEMRTRL----LQAPAHFYDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDYFDRIAAIEYTLAHDDGVS
Y252_VIBC3      IPEMRTRL----LQAPAHFYDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDYFDRIAAIEYTLAHDDGVS
YDIA_ENTAG      TPEIIVQSDGFCQDIVQ---ALVAPLQQ----ELGLSPAPVAHRTHGLDAKYDARIAAIDYTLAHDDGIS
Y2719_BURXL     DSASNQIVKGSNALVLDMFQTFVEPLEQELE--LKSSHAMGRGHQNADTEEYKNRIEAINFSLAHDDGQS
Y2439_BURPP     DSASNQIVKGSNALVLDMFQTFVEPLEQELE--LKSSHAMGRGHQNADTEEYKNRIEAINFSLAHDDGQS
Y1758_DECAR     NPELVHQADAFC-------LSYFDTFLAPLEAELGIKSNHTVGRSHAESSEYKKRIESINYTLAHDDGIT
Y3043_POLSJ     NMEILAVIKTHC---NGMLLDMFGMFVAPLESELGIKSNHRVGSDASKSKEYDDRIEAINFSLAHDDGQS
Y2500_ACIB5     DPEIINTAKAV-------NLDVFEGLISKLEQELGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAR
Y2163_ACIBT     DPEIINTAKAV-------NLDVFEGLISKLEQELGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAR
Y1909_BURVG     DSVSNDIVKRSNALVLDMFQRFVEPLEQELE--LKSSHAMGRGHQNADTEEYKTRIEAINFSLAHDDGQS
Y1578_ACIBS     DPEIINTAKAV-------NLDVFEGLISKLEQELGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAR
Y1392_ACIBY     DPEIINTAKAV-------NLDVFEGLISKLEQELGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAR
Y1301_ACIB3     DPEIINTAKAV-------NLDVFEGLISKLEQELGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAR
Y2422_ACIAD     DPEIINTSKAV-------NLDVFEGLISKLEQVLGTPPTTLVGQTHAVDSEYYKRIDAVHFALDNDDGAL
Y4424_VIBSL     IPEI------KLKLLDAPAYDVLESIVQKVQDDTKMAPKPKLQRSRSVNKDYFDRIAAIEYTLAHDDGIT
Y2038_PSEU5     NQEIRDILA----ESNGFMIDIFSSFLAPLEHELMSRSSYSVGKSHSINTNYMERIEAVNFALDNDDGAR
Y1868_PSEF5     NQDIREILATS----NGFMIDIFSTFLAPLEQELSEHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y4373_VIBPA     ----VPGVREMLLEAPAYSYDVLESIVQKVQDDIQMAPAPKLQRSRSVGKDYFDRIAAIEYTLAHDDGIT
Y3710_CHRVO     FTSIVNPEVREALRLNNVVLSFIGHL----EIELGQKATLTVGKAHGMVNEYDHRIEAVNFSLNHDDGVK
Y617_THIDA      TDPA---LRAHFKDAGLHVFDLFEHVSPAVERVLGEPATPSGGHTHGMASDYEARMDAVNFALRLDDGLS
Y2043_BURTA     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y1334_PSYA2     DTIVSPEIREKINSAHSCNLDMYEGLIGRVAEETGVEPDGHSGHAHNVDSETYKRIDAVHFALDNDDGAR
Y1035_PSYCK     DTIVSPEIREKINSAHSCNLDMYEGLIGRVAEETGVEPDGHSGHAHNVDSETYKRIDAVHFALDNDDGAR
Y1741_PSEE4     VNQDIREVMATS---NGFMIDIFSTFLSPLEQELTAHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y5572_BURM9     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y4621_PSEFS     VNQDIREILATS---NGFMIDIFSTFLAPLEQELSEHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y3839_BURMS     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y3811_BURM7     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y3659_PSEP1     VNQDIREILATS---NGFMIDIFSSFLSPLEQELIAHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y2669_LARHH     FVSIVNPFVREAIQVDDCAM-----VIDFFHAFVGQKATLTVGKSHGIISEYDTRIEAVNFSLNHDDGVK
Y2566_BURP1     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y2476_BURP0     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y2420_BURP6     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y2383_ALTMD     NVD-VRKIISKSVGINYNFLDFVAPL----EKVLGVPSKPEKHRTHSIHTTYDIRIEAVNYALANDDGSN
Y2143_BURPS     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y1539_BURMA     DNEIVKRSNALVLDMFQRFVEPLEQELQLKSSH----AMGRVH-QNADTEEYKTRIEAINFSLAHDDGQS
Y2190_RHOFD     DMEVLKVITDNCHGM---VLDMFSTFVHPLESELNLKSSHRIGTDASKSSAYQSRIEAINFSLAHDDGQS
Y1592_PSEPG     VNQDIREILATS---NGFMIDIFSSFLSPLEQELTAHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y1428_SODGM     TPAVRHIIEESAGFCQDVVQALVGPLQQ----ELGIAPDPVAHRTHGLTAKYDARITAIDYTLAHDDGIS
Y2081_PSEPK     VNQDIREILATS---NGFMIDIFSSFLSPLEQELIAHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y1769_PSEPF     VNQDIREILATS---NGFMIDIFSTFLAPLEQELTEHSSYTVGKSHSINSNYMERIEAVNFALDNDDGAR
Y2063_CHRSD     DQSIRDIIAAA----PGFKVDIFSTFLAPLEEELATHSTYTVGRTHAIGRDYMHRIDAVHFALDNDDGAR
Y1825_ERWT9     IRDIILQSDGFCQDIVQ---SLVGPLQQ----ELGLLPAPVANRTHGLTAKYDARIAAIDYTLAHDDGIS
Y869_NITEC      DPVIL----ASVRQADCYLIDFFESCLGVLETALQQSPVRIPGRSHILDASYFRRIAAIQYALNSDDGSN
Y6516_VIBHB     VPEIREML------LKAPAYDVLESIVQKVQDDIQMEPQPKMQRSRSVSKDYFDRIAAIEYTLAHDDGIT
Y1743_PSEA6     NTE-VRKIISKSVGINYNFLDFVAPL----EIVLGVPSKPEKHRTHSIHEKYDIRIEAVNYALANDDGSN
Y1599_PSEPW     VNQDIREILATS---NGFMIDIFSTFLSPLEQELTAHSSYSVGKSHSINSNYMERIEAVNFALDNDDGAR
Y2716_SHEWM     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEQQLGISATPVVHRTHNMNESYEARIDAINYAMDNDDGQT
Y1317_IDILO     NE----KLKAKITDCGGICYDFLDHFIAPVEKELGVKAEPKTHRTHGVHKNYNFRIDAINYALDNDDGKR
Y628_DICNV      FSSIVD------EEIRNIVKSSAGLHLSFFDAFLGTKELGVSALQFSINTEYDARMESLNFTLNHDDGSS
Y1428_ALCBS     VNTDHRAILHGCDAL---ILDLFGAFLRPLEDELGVRSSHKINQSHAIDAESYRRINAVHFALDNDDGAR
Y2545_AERS4     VDPLVREEVLKAQASGHDFLNFVSPL----EQELGVKAEPRLHRTHGMENRYDDRIEAVNFALANDDGIT
Y2298_SHEFN     NPEIRNVISSECVDYDFLN-TFVAPL----EQHLGVQAKPLLHRTHKSNHGYETRIDAINYTMENDDGQT
Y1485_LEGPA     DPEIRQAIKKAHACVFDLFSIFIGPLENELEEK-SSYTVGRTHGVANVKS-YSHRIEAIDFALSHDDGIK
Y949_LEGPC      DPEIRQAIKKAHACVFDLFSIFIGPLENELEEK-SSYTVGRTHGVANVKS-YSHRIEAIDFALSHDDGIK
Y2550_SHEPA     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEKQLGVAAAPALHRTHKANESYEARIDAINYAMENDDGQT
Y2244_SHEPC     ERPLVSIVKAEIRDIIYSSEGVDYDFLNTFEQHLGVSASPVVHRTHKANHGYEARIDAINFAMDNDDGQT
Y1764_SHESW     ERPLVSIVKAEIRDIIYSSEGVDYDFLNTFEQHLGVSASPVVHRTHKANHGYEARIDAINFAMDNDDGQT
Y1528_LEGPH     DPEIRQAIKKAHACVFDLFSIFIGPLENELEEK-SSYTVGRTHGVANVKS-YSHRIEAIDFALSHDDGIK
Y2421_STRM5     NSCVDQSLSLILAESGALMLDVFAPFIEPLERELSSSRVNRVGQAHGMVDTYHRRINAMNFALTHDDGIA
Y1498_LEGPL     DPEIRQAIKKAHACVFDLFSIFIGPLENELEEK-SSYTVGRTHGVANVKS-YSHRIEAIDFALSHDDGIK
Y2692_AERHH     VDHQVREEVLKAQ---ASSHDFLNTFVSPLEHELGVKAEPRLHRTHGMENRYDDRIEAVNFALANDDGIT
Y2602_SHEB9     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y2489_SHEB5     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y2482_SHEB8     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y1862_SHEB2     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y3013_COLP3     NNENREIIES-CDAVLYNFLEPFVAPLEKELAIKAKPTTHRTHSIHEKSYDY--RIEAVNYALTNDDGSN
Y2326_AZOVD     VNQEIRDILAKS---NGFMIDIFSTFLAPLEHELXXXXXXXXXXXXXXNAHYMERIEAVNFALDNDDGAR
Y2089_PSEU2     NQDIREILATSNGFMIDIFSTFLAPLEQELXXXXXXXXXXXXXIGH--NSNYMERIEAVNFALDNDDGAR
Y2060_PSE14     NQDIREILATSNGFMIDIFSTFLAPLEQELXXXXXXXXXXXXXIGH--NSNYMERIEAVNFALDNDDGAR
YPNA_THIRO      NNEIREILESG----NCYYVELFEGFVEPLSRELGVPPSRKSGRSHAITSYYTKRIEAINFAMANDDGIR
Y1750_PHOPR     -SIVIPDVKVIIEQSNAHFYDVLNVLVEPLKHDLQLEPEPQLQRSHSINASYQDRIAAIEYTLAHDDGIS
Y4058_PSEHT     NYNLTEIISSA----NAVCYDFLTTYSEKIEKELNVAPVPKIHRTHSIHEKYDFRIDAVNYALMNDDGGN
Y2291_PSESM     NQDIREILATSNGFMIDIFSTFLAPLEQELXXXXXXXXXXXXXIGH--NSNYMERIEAVNFALDNDDGAR
Y1889_ALHEH     DAEVRRVLQTTDAVLFDFFDTFIAPL----EQELRMPSSHVIGRSHGVNNMYDVRIDAMNYALNHDDGAV
Y2645_SHEON     KPEIRDIIYSS----EGLDYDFLNTFVAPLEQHLGVSASPVLHRTHKANQGYEARIDAINFAMDNDDGQT
Y219_HALHL      DPEVLAVLR---ESEHIVLFDFFDTFIAPLERELEVPSNHVIGRSHGIDSTYDVRIDAMNFALHHDDGAT
Y2084_PSEMY     FDTIVNRIRAILDTANGFMIDIFSTFLSPLEQELXXXXXXXXXXXXXIHSNYMERIEAVNFALDNDDGAR
Y2212_XANOR     VNSCVDQLSMILAESGALMLDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y2080_XANOM     VNSCVDQLSMILAESGALMLDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y2010_SHEDO     NPDIRNVIYSS----EGMDYDFLNTFVAPLEQHLGIQACPVLHRTHGKNHSYEARIDAINFSMENDDGQT
Y1852_ERWCT     TPTVRNIITSSCQDIVQ---ALVAPLQE----ELNIPPTPVANRTHGLTAKYDARIAAIDYTLAHDDGIS
Y1735_SHESA     KPEIRDIIYSS----EGLDYDFLNTFVAPLEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y1666_SHESR     KPEIRDIIYSS----EGLDYDFLNTFVAPLEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y1591_SHESM     KPEIRDIIYSS----EGLDYDFLNTFVAPLEQHLGVSASPVLHRTHKANHGYEARIDAINFAMDNDDGQT
Y2157_KLEP3     IPEIILQSEGFCQDIVQ---ALVAPLQQ----ELNLDPTPVAHRTHGLNPKYDARIAAIDYTLAHDDGIS
Y2128_KLEP7     IPEIILQSEGFCQDIVQ---ALVAPLQQ----ELNLDPTPVAHRTHGLNPKYDARIAAIDYTLAHDDGIS
Y2974_STRMK     NSCVDQSLSLILADSGALMLDVFAPFIEPLERELASPRLARVGQAHGMVDTYHRRINAMNFALTHDDGIA
Y1548_SHELP     ERPLVSIVKAEIRDIIYSSECIDYDFLNTFEDQLGVKAVPVTHRTHKANHSYEARIDAINYAMENDDGQT
Y2358_NITEU     DPVML----ASIRRADCVLFDFFETCLGTLEAVLQQPPARIPGRSHVLDASYFRRIAAIQYALNSDDGAN
Y2177_YERE8     SPELIQHSEGFCQDIVQ---ALVAPL----QGELGVSPQPVLNRTHGLTGKYDARIAAIDYALAHDDGIS
Y1704_SHEHH     ------------------------------EKQLGIAATPAMHRTHKANEGYEARIDAINYAMENDDGQT
Y1870_SHESH     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFELQLGMKASPVVHRTHKANEGYEARIDAINYTMDNDDGQT
YDIA_SALTY      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALTI      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALSV      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALPK      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALPC      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALPB      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALPA      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALNS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALHS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALG2      LPEIILQSEGFCQDIVQ---ALVAPLQQEMKQ----DPTPIAHRTHGLNPKYDARIAAIDYTLAHDDGIS
YDIA_SALEP      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALDC      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALCH      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SALA4      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
Y594_XYLFM      VNSCVNPLSVILAESGALMLDVFAPFIGLLEHELNTSRHSRVGRAHGMVETYHRRINAMNFALAHDDGV-
Y622_DEIGD      EPAVMRELEAAPARV----FDLLGPGLIALEHEFGEKAARSVGRYHDMHDQYLARMDALDFALATDDGLG
Y2203_XANC5     -------------------LDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y2042_XANAC     -------------------LDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y1727_CITK8     LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGN--LN-KYDARIAAIDYTLAHDDGIS
Y1260_XYLFA     VNSCVNPLSVILAESGALMLDVFAPFIGLLEHELNTSRHSRIGRAHGMVETYHRRINAMNFALAHDDGV-
Y739_YERPP      SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y2410_YERPE     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y2394_YERPB     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y2319_YERPS     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y1864_YERPN     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y1842_YERPY     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y1754_YERPA     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
Y1744_ENT38     IPEIILQSEGFCQDIVQ---ALVAPL----QGELKLDPTPIAHRTHGLNPKYDARIAAIDYTLAHDDGIS
Y1736_YERP3     SREIIQRSEGFCQDIVQ---ALVAPL----QGELGVPPQPVLNRTHGLTEKYDARIAAIDYALAHDDGIS
YDIA_SHIBS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_SHIB3      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
Y2073_SHEAM     KPEIRDVIYSS----EGLDYDFLNTFVAPLEQQLGVSAAPVLHRTHKANHSYEARIDAINFAMENDDGQT
YDIA_ECOL5      LPEIILRSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO7I      LPEIILQSEGFCQDIVQALVAPLQQEMQLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
Y2165_XANCP     -------------------LDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y2016_XANCB     -------------------LDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y1953_XANC8     -------------------LDVFAPFIEPLERELNAPRHSRVGRAHGMVETYHRRINAMNFALSHDDGIA
Y2629_PHOLL     SSGVKNIIEGFCQDIVQ---TLVAPLQQ----ETGLEPKPELNRTHGLTSQYDARIAAIDYALAHDDGIS
Y2103_ENTS8     PEEIILQSQGFCQDIVQALVAPLQEELRLDPSPVAHRTHGLNPAN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_ESCF3      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLTPGN--LN-KYDARIAAIDYTLAHDDGIS
YDIA_SHISS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_SHIFL      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_SHIF8      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_SHIDS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOUT      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOSM      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOSE      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOLI      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOLC      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOL6      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOK1      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOHS      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECODH      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECOBW      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO8A      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO81      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO5E      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO57      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO55      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO45      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO27      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
YDIA_ECO24      LPEIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
Y549_XYLF2      VNSCVNPLSVILAESGALMLDVFAPFIGLLEHELNTSRHSCVGRAHGMVETYHRRINAMNFALAHDDGV-
Y525_XYLFT      VNSCVNPLSVILAESGALMLDVFAPFIGLLEHELNTSRHSCVGRAHGMVETYHRRINAMNFALAHDDGV-
YDIA_ECOLU      LPEIILESEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGL--NPNNLN-KYDARIAAIDYTLAHDDGIS
Y1728_DEIRA     QPDVLEALQTAPAQV----FDLLTENLRLLEGEFAEPPQLGAGGHHDMSEAYLSRMEALDFALATDDGIG
Y1884_MARAV     NGEIISRADGFM-------VDIFGTFLNPLEQELNXXXXXXXXXXXXINGSYERRIHAVNFALDNDDGAR
Y1850_SHEPW     ERPLVSIVKAEIRDIIYSSEGLDYDFLNTFEKQLGMPATPALHRTHKTNDSYEARIEAINYAMENDDGQT
LEU1_BUCUE      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVR
Y426_RHOPS      VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPDRLIQVR
Y300_RHOPT      VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVR
Y298_RHOPA      VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVR
Y395_RHOP2      VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVAGIPIPHQLETLKKPLVVSLHASPERLIQVR
Y380_RHOP5      AEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVPGIPIPHQLESLVKPLVVSLHATPERLIQVR
Y294_RHOPB      VEGLEDADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVPGIAIPHQLETLTKPLVVSLHATPERLIQVR
Y161_BRASB      VDGLEDADVVLVGVSRTSKTPTSIYLANRGVRTANVPLVPGIPIPHQLETLKKPLVVSLHATPERLIQVR
Y199_BRASO      VDGLEDADVVLVGVSRTSKTPTSIYLANRGVRTANVPLVPGIPIPHQLEVLKKPLVVSLHATPERLIQVR
Y112_NITHX      VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVPGIAIPRQLESLRTPLVVSLHAAPERLIQVR
Y102_NITWN      VESLEEADVVLVGVSRTSKTPTSVYLANRGTRTANVPLVPGIAIPRQLETLKNPLVVSLHAAPERLIQVR
Y637_BRAJA      XXXXXXXXXXXXXXSRTSKTPTSIYLANRGIRTANVPLVPGIPVPVQLETLTRPLVVSLHATPERLIQVR
Y4385_OLICO     VEGLEEADVVLVGVSRTSKTPTSIYLANRGIRTANVPLVPGIPIPPQLETLKKPLVVSLHATPERLVQVR
Y001_RHIEC      PDDYNDADVVIIGISRTSKTPTSIYLANRGIKTANIPIVYGVPLPESLLAATKPLIVCLIATTDRISQVR
Y3935_RHILW     PDDYNDADVVIIGISRTSKTPTSIYLANRGIKTANIPIVYGVPLPESLFTTTKPLIVCLIATTDRISQVR
Y001_RHIL3      PDDYNDADVVIIGISRTSKTPTSIYLANRGIKTANIPIVYGVPLPESLFVASKPLIVCLIATTDRISQVR
Y002_RHIE6      PDDYNDADVVIIGISRTSKTPTSIYLANRGIKTANIPIVYGVPLPEGLLVATKPLIVCLIATTDRISQVR
Y4488_RHILO     PANMDDADVVLIGISRTSKTPTSIYLANRGIKTANIPIVLGVPVPESLVSASKPLIVGLIATAERISHVR
Y001_AGRVS      AEDYDQADVVLVGISRTSKTPTSIYLANRGIKTANIPIVPDSPLPESLFAAKGPLIVGLIATSDRISQVR
Y001_AGRT5      PETYDDADVVIIGISRTSKTPTSIYLANRGIKTANIPVVPNVPLPESLYAATRPLIVGLVATSDRISQVR
Y2974_MARMM     -DDFEGADIVLLGVSRTSKTPTSVYLAHRGFRAANIPLVKDVPIPEAVFSLRNPLVVGLTASPERIVQIR
Y3350_RHISN     PADFNEADVVLIGVSRTSKTPTSIYLANRGIKTANIPIVPGVPLPDGLLRATKPLVVGLIASADRLSQVR
Y3209_SINMW     PADFDEADVVLVGVSRTSKTPTSIYLANRGIKTANIPIVPGVSLPEGLLTATKPLIVGLIASAERLSQVR
Y001_RHIME      PSDFNEADVVLVGVSRTSKTPTSIYLANRGIKTANIPIVPGVPLPDALLKATKPLIVGLIASAERLSQVR
Y008_BARBK      SDDLFNADVILVGISRTSKTPTSIYLANRGIKTANVPLIPGIDLPKALLEEKNSLIIGLIASAERISHVR
Y001_BARQU      PKGLSDADVILVGISRTSKTPTSIYLANRGIKTANVPLIPGIGFPEALLEAKNTLIVGLIASAERISHIR
Y3478_MESSB     PHNVEEADIVLVGVSRTSKTPTSIYLANRGIKTANVPIVLDAPLPEPLLNAKRPLVVGLIASAERISQVR
Y001_CAUCR      GQDLTQADVILVGVSRTSKTPTCIYLAHRGVRAANVXXXXXXXXXXELFELKNTLIVGLITSPDRLIQIR
Y001_HYPNA      VESLIGADVILLGVSRTSKTPTCVYLANRKVRAGNIPLVPGVPLPDFMEKMKGPLVVGLKISAERLVQIR
Y001_BART1      SSNLFEADVILVGISRTSKTPTSIYLANRGIKTANVPLIPNIDLPESLLEAKNSLIIGLIASAERISHIR
Y2842_SPHAL     WENWEQADIILAGVSRTSKTPTSIYLANRGFKTANIPIVPESPPPSALFNLKRPMVVGLTTGLDRLVQVR
Y001_BARHE      PNSLSDADVILVGISRTSKTPTSIYLANRGIKTANVPLIPGINLPDTLLGAKNALIIGLIASVERISHIR
Y117_NOVAD      WENWEEADIVLAGVSRSSKTPTSIYLANRGYKVANIPIVVESPPPSMLFSLRRPLVVGLTTSPERLIAVR
YD000_ERYLH     WENWEEADIVLAGVSRSSKTPTSIYLANRGYKVANIPLVMESPPPPALYELKNPMVVGLTTAPERLVQIR
Y853_OCHA4      PYDIEEADVILVGISRTSKTPTSIYLANRGIKATNVPIVLGIPLPEVLFTAKRPLIVGLVATAERISQIR
Y2113_BRUC2     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2068_BRUA2     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2067_BRUSU     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2060_BRUME     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2042_BRUAB     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y1987_BRUO2     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2129_BRUMB     PLDIEEADVIIVGISRTSKTPTSIYLANRGIKAANVPLVLGIPVPEILFAAKRPLIVGLVATAERISQIR
Y2832_SPHWW     SEDWEEADIVLTGVSRSSKTPTSIYLANRGYKVANXXXXXXXXXXXXFYSLVHPLIVGLTTSPERLVQIR
Y4549_MAGSA     IELADQADIVLVGVSRSSKTPTCMYLANRGFKCANYXXXXXXXXXXXXXRAKKPLVVGLTKDPKSLSDIR
Y2476_ACICJ     LRGLAEADVILVGVSRSSKTPTSFYLANRGIKAANVPMVPGIELPGVLDDPPCP-VVGLFIDAEPLIEIR
Y003_GRABC      QVGINEADLCLVGVSRSSKTPTSFYLANRGVKAANIXXXXXXXXXXXXXXXIVP-VIGLTIDPEALIEIR
Y3615_RHORT     LDRLKQAEVVVVGVSRTSKTPTCMFLANKGIRAANVPLVPGIDPPAELMDLAGPLVVGLTRDP-KXXXXX
Y324_NEOSM      TWDLDEANIIIVGPSRTSKSPTSVYLSHLGYRVANIPFVNNIPLPAKLTTLENILIVGLTINPDRLIEIR
Y316_ANAMM      LWDIDQADIIIVGVSRTSKSPTSIYLAYRGYRVVNIPLVCSVQLPVDPATIADKLVVGLTIDADRLIQIR
Y486_WOLPP      IQDIDKADIILVGVSRTSKSPTSMYLAYRGYKVANVPFVSEIPFYVDLAKLRNKLTIGVTIDVRRLIEIR
Y235_ANAMF      LWDIDQADIIIVGVSRTSKSPTSIYLAYRGYRVVNIPLVCSVQLPVDPATIADKLVVGLTIDADRLIQIR
Y205_EHRRW      LWDIDQADIIILGVSRTSKSPTSIYLAYRGYRVVNIPLINSIELSVDLSKMKNKLIVGLTIDIDRLIEIR
Y005_RICRS      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y001_RICRO      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y001_RICCN      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y202_EHRRG      LWDIDQADIIILGVSRTSKSPTSIYLAYRGYRVVNIPLINSIELSVDLSKMKNKLIVGLTIDIDRLIEIR
Y001_RICAE      LNELLEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y450_GEOSL      PRGLAKADFILVGVSRSSKTPLSMYLAHKGYKVANVPIVKGIDPPPELYKVDQKRVVGLIIDAERLVQIR
Y4470_WOLWR     IQDIDKADIILVGVSRTSKSPTSTYLAYRGYKVANIPFVSGVPFYVDLAKLKNKLTIGVTIDVSRLIEIR
Y341_WOLPM      IQDIDKADIILVGVSRTSKSPTSTYLAYRGYKVANIPFVSGVPFYVDLAKLKNKLTIGVTIDVSRLIEIR
Y3384_GEOMG     PRGLSKADFVLVGVSRSSKTPLSMYLAHKGYKVANVPLVKGIDPPAELFKVDQNKIVGLLIDPHRLLEIR
Y001_RICFE      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDLLVVGLVINPNRLIEIR
Y633_WOLTR      IQDIDKSDIILIGVSRTSKSPTSMYLAYRGYKVANIPFVGEIPFYFDLAKLKDKLTIGLTIDVNRLVEIR
Y001_RICM5      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y895_EHRCR      LWDIDQADIIILGVSRTSKSPTSIYLAYRGYRVVNIPLVHSINLSVDLSNMKNKLIVGLTIDIDRLIEIR
Y001_RICTY      INELSESDIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKNIDQLVVGLVINPNRLIEIR
Y005_RICAH      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPSPDFIEKDIDQLVVGLVINPNRLIEIR
Y343_PELUB      VEDVDKADLILLGVSRTSKTPTSIYLANRGYKTLNIPLVNEQSIPESLKNPKLSCVVGLTTEPQRLVDIR
Y005_RICPU      LNELSEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y001_RICPR      INELSESDIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y3081_DESHY     PRGVLLADVVLIGVSRTSKTPLSMYLAHKGIKAANIPLVPEVSPPQELFRVPSQKVIGLTLKPDLLNQIR
Y207_EHRCJ      LWDIDKADIIILGVSRTSKSPTSIYLAYRGYRVVNIPLVNSINLSVDLSSMKNKLIVGLTIDIDRLIEIR
Y4252_DESHD     PRGVLLADVVLIGVSRTSKTPLSMYLAHKGIKAANIPLVPEVSPPQELFRVPSQKVIGLTLKPDLLNQIR
Y005_RICB8      LNELQFADIVLIGPSRTSKTPTSVFLAYNGLKTANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y001_RICBR      LNELQFADIILIGPSRTSKTPTSVFLAYNGLKTANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y4292_GEOUR     PRNLYKADIVLVGVSRTSKTPLSMYLAHKGYKVANVPIVLGIEPPKELYQVEKIRVVGLIIDAKRLVDIR
Y410_GEOSF      PRNLHKADIVLVGVSRTSKTPLSMYLAHKGYKVANVPLVMGIEPPSELYQVDNSRVVGLMIDAQRLVDIR
Y997_GEOLS      NRGLVKADLVLVGVSRSSKTPLSMYLANKGYKVANVPLVKGIDPPEELEAIDPSKVVGLLISPKRLVEIR
Y242_GEOBB      PRNLHKADIVLIGVSRSSKTPLSMYLAHKGYKVANVPIIQGIDPPGELEEVEPERVVGLIIDTQRLVDIR
Y226_GEOSM      PRNLHKADIVLIGVSRSSKTPLSMYLAHKGYKVANVPIIQGIDPPGELEEVEPERVVGLIIDTQRLVDIR
Y961_ANAPZ      LWXXXXXXXXXXXXSRTSKSPTSIYLAYRGYKVVNIPFVHSITLPIDSAALADKLVVGLTIDIDRLIQIR
Y005_RICCK      LNELPEADIILIGPSRTSKTPTSVFLAYNGLKAANIPYVYNCPFPDFIEKDIDQLVVGLVINPNRLIEIR
Y2958_PELPD     TQYLHKADLVLVGASRSSKTPLSMYLAHKGYKVANVPLIIGIDPPVELFQIEQEKVVGLVIDPKRLVEIR
Y1093_BDEBA     FAELDKADIVLVGISRTSKTPLSIFLSHKGWKVANVPLVLDTPLPEELFKIDQRRIVGLIIDMDSLQRIR
Y3020_ALKMQ     SRGLAKADIVLVGISRTSKTPLSMYLAHRNMKVANVPLVPEVTPPKELYEVPSQKIIGLTTNPIKLIEIR
Y585_SYMTH      PRGFLRADAVLIGVSRSSKTPVSMYLAHRRYKVANLPLVPEVSLPKELFLVPPHKVVGLRVSPEKLHQIR
Y743_LACBA      PTGLLKADIVILGVSRTSKTPLSLFLANRNLRVANLPLSPKTQLPDELWQVDPKRIFGLTNRPEILRKIR
Y1257_ALKOO     TRGLKQADIVLTGISRTSKTPLSMYLAHKNLKVANVPLVPEVAPPRELFEINPKKIIGLTTNPVKLIEIR
PDRP1_ARATH     PENLEKADIVLVGVSRTGKTPLSTYLAQKGYKVSNVPIVNGVDLPKTLFEIDPRKVFGLMINPLVLQGIR
Y1326_LACJO     PKGFLEADVVLLGVSRTSKTPLSLFLANKNLKVANLPLVPQTHIPDEIYKINPKKIIGLTNDPSVLNEIR
Y2242_CLOPE     YRGLKNADVVLVGLSRTSKTPLCMYLANKGIKAINIPLVPEVGVPEELYEIDKKKIFGLTINPLQLIEIR
Y076_CLOPS      YRGLKNADVVLVGLSRTSKTPLCMYLANKGIKAINIPLVPEVGVPEELYEIDKKKIFGLTINPLQLIEIR
Y1520_STRU0     PRGILKADLILLGISRTSKTPLSMYLADKHLKVVNIPIVPEVPLPKELNEVSPKKIVGLTNSVERLSQVR
Y1256_LACDA     PRGFLEADVVLLGVSRTSKTPLSLLLANKGLKVANLPLVPQTHIPNEIYQIDPTKIIGLTTDPQVLNRIR
Y1123_LACGA     PKGFLEADVVLLGVSRTSKTPLSLFLANKNLKVANLPLVPQTHIPDEIYKVDPKKIIGLTNDPSVLNEIR
Y1494_LISIN     PRGILQADYVLIGISRTSKTPLSQYLALKGLKIVNIPIVPEAQIPDELFEIDPKKIIGLKISKQKLTKIR
Y1476_LISMF     PRGILQADYVLIGISRTSKTPLSQYLALKGLKIVNIPIVPEAQIPDELFEIDPKKIIGLKISKQKLTKIR
Y1457_LISMO     PRGILQADYVLIGISRTSKTPLSQYLALKGLKIVNIPIVPEAQIPDELFEIDPKKIIGLKISKQKLTKIR
Y1174_LACDB     PRGFLEADVVLLGVSRTSKTPLSLLLANKGLKVANLPLVPQTHIPKEIYQIDPTKIIGLTTDPQVLNRIR
Y442_CARHZ      PRGLLRADLVVIGVSRTSKTPLCMYLAHKGIKAANVPLVPEATPPEELFKIPPHKVVGLTIKPSILFEIR
Y1472_LISW6     PRGILQADYVLIGISRTSKTPLSQYLALKGLKIVNIPIVPEAQIPDELFEIDPQKIIGLKISKQKLTKIR
Y2438_PELCD     VSHLRHADIVLVGVSRTSKTPLSTYLAHHGWKVANVPLVLGIDPPKELFQIDPKRVVGLYIDSQRLVELR
Y1306_LACH4     PKGFLEADVVLLGVSRTSKTPLSLFLANKNLKVANLPLVPETHIPKEIYEIDPKKIIGLTNDPSVLNEIR
Y1143_LACSS     PRGLLEADIVLLGVSRTSKTPLSMYLANQNYRVANLPLIPNVPLPKELFKVPAHKIIGLTMPLSTLLKIR
Y1055_STRSV     PQGFLDSDLVLLGVSRTSKTPLSIYLANKGYKVSNLPLIPEVPLPQVLEKVDPERIIGLLCEPEKLSKIR
Y872_LACSS      PHGFLEADIVLLGVSRTSKTPLSLFLANRNIKVANLPIVPQAHIPDEIWHVDPKKIIGLMNTPEVLNNIR
Y1193_STAS1     PKGLFKADIVLLGISRTSKTPLSQYLAHKSYKVMNIPIVPEVTPPDDLFNIDSSKCIALKISEEKLNRIR
Y1353_STAHJ     PKGLPKADIVLIGVSRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDMLFDIDSSKCIALRISEEKLNRIR
Y1206_LACAC     PKGFLEADVVLLGVSRTSKTPLSLFLANKNLKVANLPLVPETHIPKEIYEIDPKKIIGLTNDPSVLNEIR
Y2411_CLOD6     PRGVLQADIILVGISRTSKTPLSMYLANKNIKVANVPLVPEIPIPKEVFEIDTKKIIGLTNSPEKLNEIR
Y1974_LACPL     PSGFLEADVVLLGVSRTSKTPLSLYLANRNLKVANLPLVPQAQIPDEIWKVDPKKIFGLTNDPEKLNDIR
Y2169_STAEQ     FTDIGEADALIVGVSRTSKTPLSMYLANKGYKIANIPLVPEVAIPDNVFQQKNLKVFGLTASPNYIANIR
Y2159_STAES     FTDIGEADALIVGVSRTSKTPLSMYLANKGYKIANIPLVPEVAIPDNVFQQKNLKVFGLTASPNYIANIR
Y1026_ENTFA     PQGFLDSDILLLGVSRTSKTPVSMYLANQGYRVSNXXXXXXXXXXXXXXXMDPQKMIGLVCSPETLGQIR
Y812_STRGC      PQGFLDSDIVLLGVSRTSKTPLSIYLANKGYKVSNLPLIPEVPLPQVLEKVDSRRLIGLVCEPEKLAKIR
Y1664_STAA8     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDINPKKCIALKISEEKLNRIR
Y1620_STAAC     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDINPKKCIALKISEEKLNRIR
Y1565_STAAT     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDINPKKCIALKISEEKLNRIR
Y1523_STAA3     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDINPKKCIALKISEEKLNRIR
Y1466_STAAE     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDINPKKCIALKISEEKLNRIR
Y1738_LACCB     PKGFLEADIVLLGVSRTSKTPLSLFLANRNLKVANLPLVPNAHIPEEIWSVDPKKIVGLTTDASVLMEFR
Y1655_STAA2     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1640_STAAR     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1621_STAA9     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1563_STAAM     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1550_STAA1     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1522_LACC3     PKGFLEADIVLLGVSRTSKTPLSLFLANRNLKVANLPLVPNAHIPEEIWSVDPKKIVGLTTDASVLMEFR
Y1515_STAAW     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1501_STAAS     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1435_STAAB     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1392_STAAN     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y1250_STAES     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNIPIVPEVTPPDGLFNVDPSKCIALKISEEKLNRIR
Y1129_STAEQ     PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNIPIVPEVTPPDGLFNVDPSKCIALKISEEKLNRIR
Y181_STAS1      FTDIGEADALIVGVSRTSKTPLSMYLANKGYKIANIPLVLEVDIPDEVFKHKHLKVFGLTASPDYILNIR
Y1110_PEDPA     PAGFLKADIVLLGVSRTSKTPLSLYLANKGYKVANLPLVPQTQIPDEIWQVDSNKIFGLTTTKEVLNNIR
PDRP2_ARATH     PENLSKADIVLVGVSRTGKTPLSTYIAQKGYKVANVPFVMGVEPPRTLFQVEPRKVFGLKIQLVVLQAIR
Y1243_HALOH     DRGVKEADVVLIGVSRTSKTPMCIYLSYRGYKAANIPLVPEVPTPLIYENPDNK-VIGLTIDPLLLNEIR
Y2419_ENTFA     PRGFLEADVLLLGVSRTSKTPLSLFLANKNLKVANLPLIPEAHLPKQLFEMDPKKIVGLTNDPNVLNGIR
Y3950_CLOB6     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
YSI3_STAAU      PKGLPKADIVLLGISRTSKTPLSQYLAHKSYKVMNVPIVPEVTPPDGLYDIDPKKCIALKISEEKLNRIR
Y699_LACS1      PSGFLKADIVLLGVSRTSKTPLSLYLANQGYKVANLPLVPKTQIPKEIYQVDKKRIFGLTNDPEVLNNIR
Y2715_BACLD     PRGILKADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXXLFTVDPAKCIGLKISPDKLNHIR
Y863_CLOBK      HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y4116_CLOBJ     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y3856_CLOBL     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y3704_CLOB1     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y3611_CLOBH     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y3095_CLOBM     HSGIKHADIVLIGLSRTSKTPLSIYLANKGIKALNIPLMXXXXXXXXLFEIDRKKIIGLTIDPMHLIEIR
Y1513_SYNWW     PRGVMQSDIVLVGVSRTSKTPLSMYLAHKRIKVANXXXXXXXXXXXXIFQVEKGKVIGLVINPEQLNQIR
Y4901_CLOB8     YRGLKNADVVLIGLSRTSKTPLCMYLANKGVKAINIPLMPEVGVPDEIYEIDRKKVFGLTINPLRLIEIR
Y1359_THEP3     AMGILLADVVVIGVSRTSKTPLCMYLAHKYIKAANLPLVPEIEPPQELFEINPKKIFGLTIDPEVLVKIR
Y1350_THEPX     AMGILLADVVVIGVSRTSKTPLCMYLAHKYIKAANLPLVPEIEPPQELFEINPKKIFGLTIDPEVLVKIR
Y5851_SORC5     PRNFKRADIVLVGVSRTSKTPLSTLLAQRGLKVANXXXXXXXXXXXELMEAPQDRVVGLTIGIDQLCEIR
Y442_STAHJ      FTDIGEADALIVGVSRTSKTPLSMYLANKGYKIANIPLVPEIEIPDNVYKQKGLKVFGLTASPQYIANIR
Y1866_LISMO     PRGLLDADIVLVGVSRTSKTPLSSFLANQNWKVANVPLVPEIPIPAELFQIPAERIIGLTTTPEKLAQIR
PDRP1_MAIZE     PQNFYRADIVLAGVSRTGKTPLSIYLAQKGYKVANVPIVMGVALPKSLFEINQDKVFGLTINPAILQGIR
Y3504_CLOBB     YGGLKNADVVLIGLSRTSKTPLSMYLANKGIKAINIPLMPEIGVPDEIYTIDKKKIFGLKIDAFQLIEIR
Y3704_LYSSC     PRGLLQADIVLVGVSRTSKTPLSQYLAHKKYKVANXXXXXXXXXXXXXXQLDPKKCFGLIISPEKLNSIR
PDRP1_ORYSJ     PQNLNRAHIVLVGVSRTGKTPLSIYLAQKGYKVANVPIVMGVNLPKSLFEIDQDKIFGLTINPVVLQAIR
PDRP1_ORYSI     PQNLNRAHIVLVGVSRTGKTPLSIYLAQKGYKVANVPIVMGVNLPKSLFEIDQDKIFGLTINPVVLQAIR
Y3210_CHLSY     PHELHQADIVLVGISRVGKTPLSMYLAVLGWKVANVPLVREVPLPAELFQVDPRRVIGLIVEAEQITAXX
Y2965_CHLAA     PHELHQADIVLVGISRVGKTPLSMYLAVLGWKVANVPLVREVPLPAELFQVDPRRVIGLIVEAEQITAXX
Y980_THETN      PMGILLADVVVIGVSRTSKTPLCMYLAHKYIKAANLPLVPEIDPPRELFEINPKKIFGLTIDPEVLVKIR
Y3298_CLOBA     YGGLKNADVVLIGLSRTSKTPLSMYLANKGVKAINIPLMPEIGVPDEIYTIDKKKIFGLKIDAFQLIEIR
Y2484_GEOKA     PRGILRADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXQLFRVGPGKCFGLKISPDKLLSIR
YQFL_BACSU      PRGILKADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXXLFNVDPKKCIGLKISPDKLNHIR
Y1946_OCEIH     PRGIARADIILIGVSRTSKTPLSQYLAHKRIKVANXXXXXXXXXXXXLMMVDPKKCIGLKITAEKLNSIR
Y2421_GEOTN     PRGILRADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXQLFQVGPSKCFGLKISPDKLLSIR
Y606_MOOTA      IRGLSHADLVLIGVSRTSKTPVCMYLAHKRLRAANLAXXXXXXXXXXXXXXXXXKIIGLTIDAGLLYQIR
Y1369_DESPS     PESLDEAEIILVGLSRAGKTPLSMYMGVMGWKVANIPYVPGVPMPQTLDEVDRRRVIALNINIEQLLSHR
Y1373_BACHD     PRGIVRADLVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXXXFKLSPKKVIGLKISPEQLNGIR
Y2417_GEOSW     PRGILRADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXQLFKVPPEKCFGLKISPEKLLSIR
Y2354_BACA2     PRGILKADIILLGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXXLFSVDPKKCIGLKISPDKLNHIR
Y1885_LISW6     PRGLIDADIVLVGVSRTSKTPLSSFLANQNWKVANVPLVPEIPIPDELFQIPNERIIGLTTTPEKLAQIR
Y122_CLOTE      YNGIKHADVILIGLSRTSKTPLCMYLANKGIKALNVXXXXXXXXXXXLFEVDRTKLVGLTIDPIRLIEIR
Y1895_LISMF     PRGLLDADIVLVGVSRTSKTPLSSFLANQNWKVANVPLVPEIPIPAELFQIPAERIIGLTTTPEKLAQIR
Y1687_BACSK     PRGIILADIVLIGVSRTSKTPLSQYLAHKRLKVANXXXXXXXXXXXXXFKISSKKCIGLKISPEKLNSIR
Y823_BACC2      ARGILKADIVLIGVSRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPDKLNHIR
Y4413_BACC4     ARGILKADIVLIGVSRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPDKLNHIR
Y4293_BACCR     ARGILKADIVLIGVSRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPDKLNHIR
Y1980_LISIN     PRGLLDADIVLVGVSRTSKTPLSSYLANQNWKVANVPLVPEIPIPDELFQIPAERIIGLTTTPEKLAQIR
Y4147_BACWK     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKIIPDKLNHIR
Y4558_BACAC     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4540_BACAA     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4520_BACAN     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4429_BACC7     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4407_BACC3     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4376_BACC1     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4318_BACC0     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4044_BACCZ     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y4034_BACHK     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y3887_BACAH     ARGILKADIVLIGISRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVAKEKCFGLKITPEKLNHIR
Y2049_PROAC     PDRLTEADICLVGVSRSGKTPLSIYLGYLGYKTVNVPLVPGIAPPTELAAVDRWRIVGLTIDAQXXXXXX
Y1185_STACT     PKGLPKADIVLIGISRTSKTPLSQFLAHKRYKVMXXXXXXXXXXXXALFEIDPKKCIALKISEEKLNKIR
Y347_SYNWW      LDSVHEADLIVLGLPRTSKTPLSMHLANLGIKVANYPILMDTEIPQEIVDLKGRIMVGLTIDIDTLMELR
Y3022_BACCN     ARGILKADIVLIGVSRTSKTPLSQYLANKRLKVANXXXXXXXXXXXXXYQVSKEKCFGLKINPEKLNHIR
Y1750_BORA1     VNQLDQADVILVGVSRCGKTPTSLYLAMQAIKAANFPLT---PDDFERSSLPKTILFGLSIQPERLSEVR
Y1715_STRA3     PRGILQADLVIIGISRTSKTPLSMFLADKNIKVINIXXXXXXXXXXXXRMIDSRRIIGLTNSVDHLNQVR
Y1683_STRA1     PRGILQADLVIIGISRTSKTPLSMFLADKNIKVINIXXXXXXXXXXXXRMIDSRRIIGLTNSVDHLNQVR
Y1671_STRA5     PRGILQADLVIIGISRTSKTPLSMFLADKNIKVINIXXXXXXXXXXXXRMIDSRRIIGLTNSVDHLNQVR
Y1381_ACIAC     HRDLSGADVILVGVSRSGKTPTSLYLAMQGLKVANYPLIERKQLPPALEPHRKK-IFGLTILPERLSQIR
Y2621_BORBR     VNQLDQADVILVGVSRCGKTPTSLYLAMQAVKAANFPLT---PDDFERGALPKTILFGLSIQPERLAEVR
Y1543_BORPA     VNQLDQADVILVGVSRCGKTPTSLYLAMQAVKAANFPLT---PDDFERGALPKTILFGLSIQPERLAEVR
Y1520_METPP     SKNLDIADVILVGVSRSGKTPTSLYLAQHGIKAANYPLIGALPVPH------KKKCFGLTIAPERLREIR
Y1435_BORPE     VNQLDQADVILLGVSRCGKTPTSLYLAMQAVKAANFPLT---PDDFERGALPKTILFGLSIQPERLAEVR
Y2880_ACISJ     HRDLSGADVILIGVSRSGKTPTSLYLAMQGLKVANYPL-----IPEDFERRQLPKIFGLTIDPQRLSQIR
Y2367_DIAST     HRDLSGADVILIGVSRSGKTPTSLYLAMQGLKVANYPL-----IPEDFERRQLPKIFGLTIDPQRLSQIR
Y5065_DELAS     HQDLTGADVILVGVSRSGKTPTSLYLAMQGLKVANYPL---IPEDFERKQLPPALVPSLTIDPQRLSSIR
Y2834_LEPCP     SRNLAEADVILVGVSRSGKTPTSLYLAQHGIKAANYPLIERDSIPSSLAPYKRK-CFGLTIDADRLSQIR
Y3310_AZOSE     TDGLADADVILVGVSRSGKTPTSLYLAVQGVKAANYPL-----IPEDFERNKLPGELHRHRSPERLSQIR
Y2400_POLNA     HRDLAGSDVILVGVSRSGKTPTTLYLAMQGLKASNYPL-----IPEDFERRQLPKIFGLTIAPERLSQIR
Y827_NEIMA      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y567_NEIM0      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y562_NEIMF      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y619_NEIMB      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y2204_METFK     DFGLSEAQVILVGVSRCGKTPTSLYLAMQGIKAANYPL-----IPEDLE--RGSLPEALKKYPEKLLSIN
Y2529_DESPS     IMDYEEADLIIVGVSRSGKTPISVFLATQGIKTANYPLVTFCQLPEDI-IKNKHKVVGLSISPDVLHTFR
Y2049_VEREI     HHDLAGADVILVGVSRSGKTPTSLYLAMQGLKTANYPLIERRQLPPALEPHRKK-IFGLTIQAERLAEIR
Y1351_HERAR     NKNLAEADVILVGVSRSGKTPTSLFLAMQGIKAANYPLIAREKLPGGLLEYKSK-IFGLSIAPDRLAEIR
Y4168_PSEAB     THYYDKADLILVGVSRCGKTPTCLYMAQYGIRAANYPLMERLQLPNALKQYKHKL-FGLTIDPDRLTAIR
Y3560_PSEA8     THYYDKADLILVGVSRCGKTPTCLYMAQYGIRAANYPLMERLQLPNALKQYKHKL-FGLTIDPDRLTAIR
Y2039_RALEH     HKNLEEADVILVGVSRSGKTPTSLYLAMQGLKAANYPLIPDDRLPSALYAF-KPKIFGLSIDPQRLTEIR
Y1769_PSEAE     THYYDKADLILVGVSRCGKTPTCLYMAQYGIRAANYPLMERLQLPNALKQYKHKL-FGLTIDPDRLTAIR
Y2168_AZOSB     SDGLAEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERNKLPKLFGLTIAPERLSQIR
Y2122_HAHCH     VRYYNEADIILVGVSRSGKTPTCIYLAQYGIKAANFPLTEDDILDQRLESLRREKIFGLTIDPERLAVIR
Y1865_RALEJ     HKNLQEADVILVGVSRSGKTPTSLYLAMQGLKAANYPL-----IPDDFERGKKPKIFGLSIDPQRLTEIR
Y1815_VARPS     NRDLEGADVILVGVSRSGKTPTSLYLAQHGLKAANYPL-----IPEDFERKQLPKIFGLTIQPERLSQIR
Y333_NEIG2      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y202_NEIG1      DKNLQEADVILMGVSRSGKTPTCLYLAQYGIRAANYPL-----IPDDLESADLPRMVGLTIQPERLQAIR
Y997_NITMU      QKNWNRADVTLVGASRTGKTPTCLYLAQYGIYAANYPLIQREELPAQIRNIRSKLFFTIH--PERLHEIR
Y2042_JANMA     HKNLSAADVILVGVSRSGKTPTSLFLAMQGIKAANYPL-----IPDDFEREKLPKIFGLSIAADRLAEIR
Y2037_BURCJ     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALSLSIDPQRLSEIR
Y1974_BURM1     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALAPHIDPQRLSEIR
Y1420_RALSO     HKNLAEADVILVGVSRSGKTPTSLYLAMQGVKSANYPL-----IPDDFERGKLPTVLGLTIDPQRLSEIR
Y6074_BURCA     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALALSIDPQRLSEIR
Y5313_BURS3     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALALSIDPQRLSEIR
Y2023_BURCC     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALALSIDPQRLSEIR
Y2003_BURCH     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALALSIDPQRLSEIR
Y2036_BURCM     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALTPHIDPQRLSEIR
Y1905_BURA4     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALTPHIDPQRLSEIR
Y4515_VIBVY     LKGLELADIILLGVSRSGKTPTSLYMAMQGLRVVNYPYIKGLKLLPEFE-IHRHKLFGLTIDPERLTEIR
Y4006_VIBVU     LKGLELADIILLGVSRSGKTPTSLYMAMQGLRVVNYPYIKGLKLLPEFE-IHRHKLFGLTIDPERLTEIR
Y1452_RALME     HKNLEDADVILVGVSRSGKTPTSLYLAMQGLKAANYPLIPDDRLPSALYAYKQK-IFGLSIDPQRLTEIR
Y3786_VIBCH     LKDLDRADIILLGVSRSGKTPTSLYMAMQGLRVVNYPFIA--EDMHAMRLLHRHKLFGLTINAERLTEIR
Y3745_VIBCM     LKDLDRADIILLGVSRSGKTPTSLYMAMQGLRVVNYPFIA--EDMHAMRLLHRHKLFGLTINAERLTEIR
Y252_VIBC3      LKDLDRADIILLGVSRSGKTPTSLYMAMQGLRVVNYPFIA--EDMHAMRLLHRHKLFGLTINAERLTEIR
YDIA_ENTAG      LRGLEDAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIA-----DDMDNLKLPPALRAHQNPERLAAIR
Y2719_BURXL     NRNLADADVILVGVSRSGKTPTSLYLAMQGVKAANYPL---IPEDFERGKLPTPLLAGLSIDPQRLSEIR
Y2439_BURPP     NRNLADADVILVGVSRSGKTPTSLYLAMQGVKAANYPL---IPEDFERGKLPTPLLAGLSIDPQRLSEIR
Y1758_DECAR     DRDLEEADVILVAVSRCGKTPTSLYLAMQGLKAANFPL-----IPEDFDRGRLPGTLEKHRSPERLHQIR
Y3043_POLSJ     NKDLAGSDVILVGVSRSGKTPTSLYLAMQGLKASNYPL-----IPEDFERRQLPKIFGLTIAPERLSQIR
Y2500_ACIB5     TRHYDKADLILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPAVLREHRSKLFGLMID
Y2163_ACIBT     TRHYDKADLILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPAVLREHRSKLFGLMID
Y1909_BURVG     NRNLSEADVILVGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPSALTQHIDPQRLSEIR
Y1578_ACIBS     TRHYDKADLILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPAVLREHRSKLFGLMID
Y1392_ACIBY     TRHYDKADLILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPAVLREHRSKLFGLMID
Y1301_ACIB3     TRHYDKADLILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPAVLREHRSKLFGLMID
Y2422_ACIAD     TRHYDKADIILIGVSRSGKTPTSIYLSLQGIRVANYPLT-----EEDLDDNRLPKVLKEHKNKLFGLMID
Y4424_VIBSL     LKGLEEADIILLGVSRSGKTPTSLYMAMQGLRVANYPFIARLRLLPEFEIYRHKL-FGLTIDAERLTEIR
Y2038_PSEU5     TRYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLMERLQLPSALKEYKDKL-FGLTIDPDRLAAIR
Y1868_PSEF5     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLMERLQLPNALRAHKHKL-FGLTIDPDRLTAIR
Y4373_VIBPA     LKGLEQADIILLGVSRSGKTPTSLYMAMQGLRVVNYPFIADVKMMRLLPEFERHKLFGLTITPERLNEIR
Y3710_CHRVO     LKDLHEADVILVGVSRSGKTPTCLYLAQYGIRAANYPLTLGSPTLPKMLLPFKDKMFGLTIDPNRLHHIR
Y617_THIDA      PEHLGQADLILVGVSRVGKTPTALYLAHYGLRAANYPLLANDGLPRALQP-HLPRLRGLTLAPERLAAIR
Y2043_BURTA     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y1334_PSYA2     TRHYHAADIILIGVSRSGKTPTSLYLALQGIRAANYPLTEEDLNDNQLPKAHKHKLFGLIIDTDRLVKIR
Y1035_PSYCK     TRHYHAADIILIGVSRSGKTPTSLYLALQGIRAANYPLTEEDLNDNQLPKAHKHKLFGLIIDTDRLVKIR
Y1741_PSEE4     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAVLKKHHSPDRLTAIR
Y5572_BURM9     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y4621_PSEFS     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMEHLTLPAALRAHSDPDRLTAIR
Y3839_BURMS     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y3811_BURM7     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y3659_PSEP1     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAVLKKHHSPDRLTAIR
Y2669_LARHH     LKDLAEADVILVGVSRSGKTPTCLYLAQYGIKAANYPLT-----PEDLDTLPKMLIFGLTIEPQRLHHIR
Y2566_BURP1     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y2476_BURP0     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y2420_BURP6     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y2383_ALTMD     LKDYDEADIILTGVSRSGKTPTSLYLAQYGIKAANYPFTEELKLPPTLRRYKHKL-FGLTIAADRLHQIR
Y2143_BURPS     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y1539_BURMA     NRNLADADVILIGVSRSGKTPTSLYLAMQGVKAANYPL-----IPEDFERGKLPTLFGLSIDPMRLSEIR
Y2190_RHOFD     NTDLEHSDIILVGVSRSGKTPTSLYLAMQGLKASNYPL-----IPDDFERQQLPPALKAHKSPERLSEIR
Y1592_PSEPG     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAVLKKHIDPDRLTAIR
Y1428_SODGM     LRNLDQAQIILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLSLPAALKA-HQPKLFGLTIDPERLAAIR
Y2081_PSEPK     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAVLKKHHSPDRLTAIR
Y1769_PSEPF     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAALRAHIDPDRLTAIR
Y2063_CHRSD     THQYDQADVILVGVSRCGKTPTSLYLALQGIRAANYPLTEDLNMPKALAPYRHKL-FALTIDPRRLAAIR
Y1825_ERWT9     LRGLEDAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLKLPAALKPFQHKL-FGLTIEPERLAAIR
Y869_NITEC      SKILADADVILVGVSRSGKTPVCVYLAQYGVLAANYPFMGVVRLPSLLQPLREKL-FGLTLSTSRLQAVR
Y6516_VIBHB     LKGLDEANIILLGVSRSGKTPTSLYMAMQGLRVVNYPFIADVKMMRLLPEIHRHKLFGLTINPERLNEIR
Y1743_PSEA6     LQEYDEADIILVGVSRSGKTPTSLYLAQYGIKAANYPFTEELKMPPALKRYKDKM-FGLTIEAQRLHQIR
Y1599_PSEPW     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAVLKKHIDPDRLTAIR
Y2716_SHEWM     LKHIDKADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFVENLKLPDALKKNKSKL-FGLTIDPVRLHEIR
Y1317_IDILO     LNQLDKADLILIGVSRTGKTPTSLYLAMQGIKVANYPLTERLQLPKELKQYRHKL-FGLTLSSQRLHEIR
Y628_DICNV      DRNLQHAEVILIGVSRSGKTPTCLYLAQYGIRAANYPLTPEDLQSPNLPNMVKPFLFGLTIDPERLSKIR
Y1428_ALCBS     TRHYDQADIILIGVSRSGKTPTCLYLALQGLFTANYPLTEDLRLPKALMEHKHKL-FGLTIDADRLSAIR
Y2545_AERS4     TKEYEEADIILIGVSRCGKTPTSLYLALQGIRAANYPFIGALVLPTALKANRHKL-FGLTITPQRLHEIR
Y2298_SHEFN     MKHMDKADIILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKSKL-FGLTIDPHRLHEIR
Y1485_LEGPA     TRGYDKADIILIGVSRCGKTPSCLYMAQYGILAANYPFLVGFRLPEVLRPY-KPKLFGLTIDAQRLQQIR
Y949_LEGPC      TRGYDKADIILIGVSRCGKTPSCLYMAQYGILAANYPFLVGFRLPEVLRPYKQKL-FGLTIDAQRLQQIR
Y2550_SHEPA     MKHMDKADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKHKL-FGLTIDPERLHEIR
Y2244_SHEPC     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y1764_SHESW     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y1528_LEGPH     TRGYDKADIILIGVSRCGKTPSCLYMAQYGILAANYPFLVGFRLPEVLRPYKQKL-FGLTIDAQRLQQIR
Y2421_STRM5     VN-YDDADVILVAVSRAGKTPTCIYLAHYGVRAANYPLLESDRLPPRLRNYRRKL-FGLTIDPDRLQQIR
Y1498_LEGPL     TRGYDKADIILIGVSRCGKTPSCLYMAQYGILAANYPFLVGFRLPDVLRPYKQKL-FGLTIDAQRLQQIR
Y2692_AERHH     TKEYDEADIILIGVSRCGKTPTSLYLALQGIRAANYPFIGVLDLPAALKANRHKL-FGLTIAPQRLHEIR
Y2602_SHEB9     MKHMDQADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKKKL-FGLTIDPVRLHEIR
Y2489_SHEB5     MKHMDQADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKKKL-FGLTIDPVRLHEIR
Y2482_SHEB8     MKHMDQADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKKKL-FGLTIDPVRLHEIR
Y1862_SHEB2     MKHMDQADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKKKL-FGLTIDPVRLHEIR
Y3013_COLP3     VTNYEEADVILVGVSRSGKTPSSLYLAQYGIKAANYPFMEELKIPSFLKPFHKKL-FGLTIDAQRLIDIR
Y2326_AZOVD     THYYDKADLILVGVSRSGKTPTCLYMAMQGIRAANYPLTEEDMERLQLPTALKPYLFGLTIDSERLAAIR
Y2089_PSEU2     THYYDKADIILVGVSRCGKTPTCLYMAMQGIRAANYPLMERLQLPAALKQHREKL-FGLTIDPDRLTAIR
Y2060_PSE14     THYYDKADIILVGVSRCGKTPTCLYMAMQGIRAANYPLT-----EDDMERLQLPAALKEHRSPDRLTAIR
YPNA_THIRO      PDNFHRADVVLIGVSRSGKTPTCLYLAHYGLRSANYPVTGDVP---QLVWDCRHKLFALTIDPQRLQLIR
Y1750_PHOPR     LNNLDQADVILLGVSRCGKTPTSLYLAMQGIRAVNYPFIA-----EDMASLKLPAAIGLTIDIERLVAIR
Y4058_PSEHT     IKNYGEADIILIGVSRSGKTPTSLYLAQYGIKAANYPITEDIPFKHKL--------FGLTIDPERLAAIR
Y2291_PSESM     THYYDKADIILVGVSRCGKTPTCLYMAMQGIRAANYPLMERLQLPPALKQHREKL-FGLTIDPDRLTAIR
Y1889_ALHEH     THHYSRADVILTAVSRSGKTPTCIYLAQYGIYAANYPLTQDDKLPRKLVEHKRKL-YGLTINVDRLQTIR
Y2645_SHEON     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y219_HALHL      HQHYGRADVILVGVSRSGKTPASLYLALQGVYAANYPLLIATRLPRALVSHRAKL-FGLTIDPDRLHQIR
Y2084_PSEMY     THYYDKADLILVGVSRCGKTPTCLYMAMQGIRAANYPLMERLQLPDSLKKHRDKL-FGLTIDPDRLTAIR
Y2212_XANOR     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLENERLPPRLRNYRSKL-FGLTIDPERLQQIR
Y2080_XANOM     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLENERLPPRLRNYRSKL-FGLTIDPERLQQIR
Y2010_SHEDO     MKHMDKADIILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKNKL-FGLTIDPNRLHEIR
Y1852_ERWCT     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLRLPDALKPFQHKLFG----LTIDX
Y1735_SHESA     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y1666_SHESR     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y1591_SHESM     MKHMDQADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPEALKRNKKKL-FGLTIDPVRLHEIR
Y2157_KLEP3     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKM-FGLTINP-------
Y2128_KLEP7     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKM-FGLTINP-------
Y2974_STRMK     VN-YDDADVILVAVSRAGKTPTCIYLAHYGVRAANYPLLESDRLPPRLRNYRRKL-FGLTIDPDRLQQIR
Y1548_SHELP     LKHIDKADIVLLGVSRCGKTPSSLYLSMQGIKAANYPFIENLKLPEVLKKNKHKL-FGLTIDPVRLHEIR
Y2358_NITEU     AKILADADVIVVGVSRTGKTPVCVYLAQYGVLAANYPFMGAIXXXXXXXXXRKKL-FGLTLNTSRLQSIR
Y2177_YERE8     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y1704_SHEHH     MKHMDKADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKGKL-FGLTIDPERLHEIR
Y1870_SHESH     LKNIDKADLVLLGVSRCGKTPSSLYLSMQGIKAANYPFVENLKLPTALKENKSKL-FGLTIDPVRLHEIR
YDIA_SALTY      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALTI      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALSV      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALPK      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALPC      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALPB      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALPA      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALNS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALHS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALG2      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALEP      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALDC      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALCH      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
YDIA_SALA4      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLTLPTSLKPLQHKLFG----LTIDP
Y594_XYLFM      AASYDEAEVVLVAVSRAGKTPTCIYLAHYGIRAANYPLILNSDQXXXXXXXXXXXXFGLTINPERLQQIR
Y622_DEIGD      DRQYGLADVILVGVSRAGKTPTSLFLAQHSVRASNYPLAESLPIPLEPHRAK---LHGLTIDPRRLHAIR
Y2203_XANC5     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLENEQLPPRLRNYRSKL-FGLTIDPERLQQIR
Y2042_XANAC     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLENEQLPPRLRNYRSKL-FGLTIDPERLQQIR
Y1727_CITK8     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLVLPTSLKPLQHKLFG----LTIDP
Y1260_XYLFA     AASYDEAEVILVAVSRAGKTPTCIYLAHYGIRAANYPLILNSDQXXXXXXXXXXXXFGLTINPERLQQIR
Y739_YERPP      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y2410_YERPE     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y2394_YERPB     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y2319_YERPS     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y1864_YERPN     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y1842_YERPY     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y1754_YERPA     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
Y1744_ENT38     MRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPPALKPLQHKL-FGLTINP-------
Y1736_YERP3     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIADDMDNLQLPAALKPFQHKLFG----LTINP
YDIA_SHIBS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRTANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_SHIB3      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRTANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
Y2073_SHEAM     LKHMDKADIILLGVSRCGKTPSSLYLSMQGIKAANYPFMDSLKLPEALKRNKHKL-FGLTIDPVRLQEIR
YDIA_ECOL5      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO7I      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
Y2165_XANCP     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLESERLPPRLRNYRSKL-FGLTIDPERLQQIR
Y2016_XANCB     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLESERLPPRLRNYRSKL-FGLTIDPERLQQIR
Y1953_XANC8     LN-YDEADVILVAVSRAGKTPTCIYLAHYGIRAANYPLLESERLPPRLRNYRSKL-FGLTIDPERLQQIR
Y2629_PHOLL     LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIQAANYPFTANLQLPATLKQFQHKL-FGLTISP-------
Y2103_ENTS8     MRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIA-----DDMDNLNLP--AALRPFQHKLFGLT
YDIA_ESCF3      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTINP-------
YDIA_SHISS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_SHIFL      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_SHIF8      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_SHIDS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOUT      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOSM      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOSE      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOLI      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOLC      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOL6      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOK1      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOHS      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECODH      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECOBW      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO8A      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO81      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO5E      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO57      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO55      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO45      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO27      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
YDIA_ECO24      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
Y549_XYLF2      AASYDEAEVILVAVSRAGKTPTCIYLAHYGIRAANYPLILNSDQXXXXXXXXXXXXFGLTINPERLQQIR
Y525_XYLFT      AASYDEAEVILVAVSRAGKTPTCIYLAHYGIRAANYPLILNSDQXXXXXXXXXXXXFGLTINPERLQQIR
YDIA_ECOLU      LRNLDQAQVILLGVSRCGKTPTSLYLAMQGIRAANYPFIANLVLPASLKPLQHKL-FGLTIDP-------
Y1728_DEIRA     DKQYGLSDVILVGVSRAGKTPTSLFLAQHGIRASNYPLAEGLPAP--LEQYRSKL-FGLTIDPRRLHAIR
Y1884_MARAV     TRHYDEADLILIGASRSGKTPTCLYLAQYGIKAANYPILDDQKMPAALRPHKEKL-FGLTIEPERLATIR
Y1850_SHEPW     MKHMDKADLILLGVSRCGKTPSSLYLSMQGIKAANYPFMDNLKLPDALKRNKDKL-FGLTIDPVRLHEI-
LEU1_BUCUE      -------------------------LINSGVKTINIPDTVGYSIPNELSFIIKNLVISVHCHDDLGMAV-


                         .         .         .         +         .         .         .:280
query           QNRLLSLGAGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE
Y426_RHOPS      QNRLLSLGAGAGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE
Y300_RHOPT      QNRLLSLGAGSGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRVPE
Y298_RHOPA      QNRLLSLGAGSGNDSYIDRQAVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRVPE
Y395_RHOP2      QNRLLSLGAGAGNDSYIDRQSVTDEVLLARKLSAKYGWSLLDVTRRSIEETAAAIMKLLADRQRQRMSE
Y380_RHOP5      QNRLLSIGAAIGNEDYIDRQTVTDEVSYARRLSAKYGWALLEVTRRSIEETAAAVMKLLADRQRQRPVE
Y294_RHOPB      QNRLLSMGATVGNEDYIDRQSVNDEVSFARRLSAKYGWALLEVTRRSIEETAAAVMKLLADRQRQR---
Y161_BRASB      QNRLLSMGAESGNETYVDKQSVTDEVAYARKLSARFNWVMLDVTRRSIEETAAAILKLYTDRQRQRLPE
Y199_BRASO      QNRLLSMGAESGNENYVDKQSVTDEVAYARKLSAKFNWVMLDVTRRSIEETAAAILKLYSDRQRQRLPE
Y112_NITHX      QNRLLSIGTRAGNDTYIDRQSVADEVTYARRLSAKHDWVQLDVTRRSIEETAAAIMKLFADRQRQRQPE
Y102_NITWN      QNRLLSIGAGPGNEAYIDRQSVTEEVIHARRLSVKHDWAQLDVTRRSIEETAAAIMKLFADRRRQR---
Y637_BRAJA      QNRLLSMGADSSSDTYTDRQSVAEEVAFARKLSAKHDWPLLDVTRRSIEETAAAIMKLYSDRQRNRPSE
Y4385_OLICO     QNXXXXXXXXXXEDSYIDSRSVAEEVAFARKLSAKYDWPLLDVTRRSIEETAAAVMKLYADRQRQ----
Y001_RHIEC      ENRVLGTTQGFDREHYTDRATISEELKYARSLCARHGWPLIDVTRRSIEETAAAIVAL-----------
Y3935_RHILW     ENRILGATHGFDREHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVAL-----------
Y001_RHIL3      ENRVLGVTQGFDREHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVAL-----------
Y002_RHIE6      ENRILGATQGFDREHYTDRAAISEELKYARSLCARHNWPLIDVTRRSIEETAAAIVAL-----------
Y4488_RHILO     QNRILGNSSSYVPTDYVDRAAINEELAYARQICTRHGWPMIDVSRRSIEETAAAIVAL-----------
Y001_AGRVS      GHRELGTVSGFDPSDYTDRASIAEELKYARSLCARHNWPVIDVTRRSIEETAAAIIALRA---------
Y001_AGRT5      ENRDLGTTGGFDGGRYTDRATIMEELKYARALCARNNWPLIDVTRRSIEETAAAILAL-----------
Y2974_MARMM     RNRLLSLNEDR-DTNYIDDFAVREEILFAKRLYAKHKWPTIDVTRRSIEETAAKIINLLMEKR------
Y3350_RHISN     QHRVLGTTQSFHGEEYTDRAAISEELKYARTLCARNNWPLIDVTRRSIEETAAAIVAL-----------
Y3209_SINMW     QHRVLGTTQSFHGEDYTDRAAIAEELKYARSLCARNNWPLIDVTRRSIEETAAAIVAL-----------
Y001_RHIME      QHRVLGTTQSFHGEDYTDRAAIAEELKYARSLCARNNWPLIDVTRRSIEETAAAIVAL-----------
Y008_BARBK      QNR--ELGKDVSIERYTDRVNIAEELTYAKRICERFGWPIIDVTRRSIEETAAAVFELLSRFREEKLRE
Y001_BARQU      QNR--DLGHGFAVESYTDRISIAEELIYAKRICERFGWPVIDVTRRSIEETAAAIFELLS---------
Y3478_MESSB     QNRLLG-ASHVDFDAYVDRAEIARELAYARQLCNRHNWPVIDVTRRSIEETAAAILAL-----------
Y001_CAUCR      RNRLLSLKENRESD-YVDADAVRQEIIAARRLFERQNWPVIDITRRSVEETAAAVINLLS---------
Y001_HYPNA      RQRLISLNQDEITE-YADEEAVRDEITQANRLFQRNGWKTIDVSRRSVEETAAGILNMLHER-------
Y001_BART1      QNR--DLGEGFAFDNYTNRINIAEELIYAKRICERFGWPVIDVTRRSIEETAAAIFELLS---------
Y2842_SPHAL     RNRLLSLNQ-APETSYVDDERVKAELAFARRMFADNGWPVIDVTRRSIEETAAAVIKLVEDR-------
Y001_BARHE      QNR--NLGDDFSLESYTDRINISEELTYAKRICERFSWPVIDVTRRSIEETAAEIFELLS---------
Y117_NOVAD      RNRLLSLNQ-APETAYVDNEQVTREVQFARRMFADNGWPVIDVSRRSIEETAAAVINLYNER-------
YD000_ERYLH     RNRLLTLNEQA-ETSYVEKDRVTEEVKFARRLFSDNNWPVIDVTRRSIEETAAAVIRLHNER-------
Y853_OCHA4      QNRPLGNVPSLDTGLYTDRVSISEELAYARNICNRNGWPIIDVSRRSIEET------------------
Y2113_BRUC2     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2068_BRUA2     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2067_BRUSU     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2060_BRUME     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2042_BRUAB     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y1987_BRUO2     QNRPLGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2129_BRUMB     QNRPIGNIPSLDTGLYTDRVSISEELAYARNLCNRHGWPIIDVSRRSIEET------------------
Y2832_SPHWW     RNRLLSLNQ-SPETAYVDHERVAAELSFARRIFSDHGWPVIDVTRRSIEETAAAIINLVNER-------
Y4549_MAGSA     RARLRLLNQEEEAD-YAQFEKVKEEVQQARRIFSRLGWPVVDVTRRSIEEASATIIQL-----------
Y2476_ACICJ     RHRLTLLXXXPDSGDYVDEEAVKAELLWARRTCSARGWPTVNVTRRSIEETAAAVLKLMAWHERRR---
Y003_GRABC      RHRLKLIGGQPNNTAYVDLESVKAELIWARRLCARKGWPVIDVTRRSIEETAATVLQLVEAWHERRRS-
Y3615_RHORT     XXXXXXXXXEDGDSPYAEEDSVAREVREARRLYARMGWTVIDVTRKSIEEVAATIMQKL----------
Y324_NEOSM      KAR-LSISQNYDNPVYADREQILEELTNARKTFIKNNWPVIDVTHRSVEEIAAAIMK------------
Y316_ANAMM      RNRLISM-KHQENCNYVSYEQVVEEISEMKKICAKNRWPTIDVTQKSVEEIAATIIQFF-NRKNNRTGD
Y486_WOLPP      KNRLTSIN-NEGNNIYADPRKVXXXXXXXXXXXXQNNWPIIDVTQRSIEEVSATIIQ------------
Y235_ANAMF      RNRLISM-KHQENCNYVSYEQVVEEINEMKKICAKNRWPTIDVTQKSVEEIAATIIQFF-NRKNNRTGD
Y205_EHRRW      RARLVSM-KNQNNYGYVDYEHVLMEIRETKKICAKNGWPIIDVTQKSVEEIAATIIQYFTKMQ------
Y005_RICRS      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y001_RICRO      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y001_RICCN      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y202_EHRRG      RARLVSM-KNQNNYGYVDYEHVLMEIRETKRICAKNGWPIIDVTQKSVEEIAATIIQYFTKMQ------
Y001_RICAE      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y450_GEOSL      TARLRNLGQ-MPKGSYADYERIEEELEFCRRLYRRNQWLVIDVTKKSVEESAAEIIQKLA---------
Y4470_WOLWR     KNRLTSIN-NEDNNIYANPXXXXXXXXXXXXXXXQNNWPIIDVTQKSIEEVSATIIQ------------
Y341_WOLPM      KNRLTSIN-NEDNNIYANPXXXXXXXXXXXXXXXQNNWPIIDVTQKSIEEVSATIIQ------------
Y3384_GEOMG     SVRLKNLGQ-MSRGSYADYEKIEDELNYCRQLYRRNQWLVIDVTKRSVEESAAEIIQKL----------
Y001_RICFE      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y633_WOLTR      KNRLTSIN-NEDNSIYADPXXXXXXXXXXXXLFKQNNWPIIDVTQKSIEEVSATIIQ------------
Y001_RICM5      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRI-----------
Y895_EHRCR      RTRLVSM-KNQNNYQYVDYEHVLMEIKETKRICVQNGWPIIDVTQKSVEEIAATIIQ------------
Y001_RICTY      EARLNLLQINE-NKSYTDFNIVQRECIEVRKICNQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y005_RICAH      EARLNLLQIN-DNKSYTDFNIVQKECLEVRKICDQKNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y343_PELUB      KNRMNAL-KEKENTNYTXXXXXXXXXXXXXXTFIKYKWPTIDVTRKSVEETAASIIKI-----------
Y005_RICPU      EARLNLLQINE-NKSYTDFNIVQKECLEVRKICDQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y001_RICPR      EARLNLLQINE-NKSYTDFNIVQRECIEVRKICNQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y3081_DESHY     TERLRTLGLGSSAD-YANYERIVEELEYARGIMRKVGCPIIDATGKAIEETASRILEILYKGER-----
Y207_EHRCJ      KTRLVSM-RNQNNCQYVDYEHVLVEIKETKRICMQNGWPIIDVTQKSVEEIAATIIQ------------
Y4252_DESHD     TERLRTLGLGSSAD-YANYERIVEELEYARGIMRKVGCPIIDATGKAIEETASRILEILYKGER-----
Y005_RICB8      ETRLNLLQINE-NRNYTDFNIVQKECLEVKKICELRNWPVIDVSTKSIEETAALIMRI-----------
Y001_RICBR      ETRLNLLQINE-NRNYTDFNIVQKECLEVKKICELRNWPVIDVSTKSIEETAALIMRI-----------
Y4292_GEOUR     SARLRNM-RQSPRGSYADYQRVEEELDYCRKLYRKHDWQVIDVTNKSVEESAAEILK------------
Y410_GEOSF      TARLRNMRQNP-RGSYADYQRVEEELDFCRRIYRKHQWQVIDVTNKSVEESAAEILR------------
Y997_GEOLS      TSRLVNMGQSMKN-SYADYEKVEDEIAFCRQYYRRHGWLIIDVTCKSVEESASEILRRL----------
Y242_GEOBB      SARLRNL-RQSPRGSYADYRQVEEELAYCRRFRAHPAWLVIDVTNKSVEESAAEILSRL----------
Y226_GEOSM      SARLRNL-RQSPRGSYADYRQVEEELSYCRRFRAHPAWLVIDVTNKSVEESAAEILSRL----------
Y961_ANAPZ      RNRLISM-KNQSNCNYISYEQVEQEISEVNRICMKNQWPLIDVTQKSIEETAATIIQ------------
Y005_RICCK      EARLNLLQINE-NKSYTDFNIIQKECLEVRKICEQRNWPVIDVSTRSIEETAALIMRIYYNRKNK----
Y2958_PELPD     TSRLINM-RQSPRGNYADYQRVEDEITSCRRLYRQHQWMVIDMTNKSVEEAASEILRKMAVREKR----
Y1093_BDEBA     KSRLEKFGQDPGG-SYASMSHIAKEIEYAEKIKVNRRWPVFNVTERALEETASEIVRIIAAR-------
Y3020_ALKMQ     QERLKALGL-KNEASYASMERILEELEYAEGIMKRIGCPVIDVSTKAVEESAGIILEIFRDR-------
Y585_SYMTH      EERIKTIGL-RSDANYSSMERILQELDYAESVFKKVGCAVIDVTNKAVEETAVRVLEII----------
Y743_LACBA      QERMLSYGLPA-DSAYSDTAKITEELAYAQKLYKKIGCLVIDVSNKSIEETATLIME------------
Y1257_ALKOO     QERLKALGL-KNEANYASMERIFEELEYADGIMKRLGCPVIDVSTKAIEESAGIILEIFKE--------
PDRP1_ARATH     EARAKSLGLGSSKTKYSELGSVKEELELAKKIFAENTWPVIEVTESAIEETAAVVLRLYDERQSNR---
Y1326_LACJO     RQRMIAYGLNP-DTTYSNMDSINAELEAADKLYKKLGCYVINVAHRSIEETAALILEHL----------
Y2242_CLOPE     KRRLDKFHRISADIEYASDSRILEEFEFADKILRKIGCRTIDVTQRAIEDTALIIMEKL----------
Y076_CLOPS      KRRLDKFHRISADIEYASDSRILEEFEFADKILRKIGCRTIDVTQRAIEDTALIIMEKL----------
Y1520_STRU0     KERLRSLGV-SGTASYANKDRIYEEAAYAEEVMRKLKCPIINVSDKAIEETATIILEMIKENQ------
Y1256_LACDA     RQRMISYGMDP-DTAYSNMDSINAELDSAMALYKKLGCFVINVAERSIEETAALIMNHLS---------
Y1123_LACGA     RQRMIAYGLNP-DTTYSNMDSINAELDAANKLYKKLGCYVINVAHRSIEETAALIMEHL----------
Y1494_LISIN     QERLISIGPGAG--TYASNQRIDEELAIFNKLASKLNCFVLDVTNKAIEETANEIL-------------
Y1476_LISMF     QERLISIGPGAG--TYASNQRIDEELAIFNKLASKLNCFVLDVTNKAIEETANEIL-------------
Y1457_LISMO     QERLISIGPGAG--TYASNQRIDEELAIFNKLASKLNCFVLDVTNKAIEETANEIL-------------
Y1174_LACDB     RQRMISYGMDP-DTAYSNMDSINAELDSAMALYKKLGCFVINVAERSIEETAALIMNHLS---------
Y442_CARHZ      KERLKTLGLSQTAD-YANMERILMELDYALGIMKKIGCAVIDVSNKAVEETAARVLEI-----------
Y1472_LISW6     QERLISIGPGAG--TYASNQRIDEELAIFDKLASKLNCFVLDVTNKAIEETANEIL-------------
Y2438_PELCD     VARLKHLGQDP-RAAYADXXXXXXXLRYAKLLFRKQRWVSVNVSGKALEETANEVL-------------
Y1306_LACH4     RQRMIAYGLNP-DTTYSNMDSINKELESAQALYKKLGCYVINVAHRSIEETAALILEHL----------
Y1143_LACSS     QERLATLGL-PQTTNYSNMTTVGDELAYANQIFEQLNATTINVADRSIEETASLIQTLI----------
Y1055_STRSV     SNRLNSLGL-TQSTSYTDLEKIYEELDYSKEVFKKYRAHVINITDKSIEETAFLI--------------
Y872_LACSS      RERMIAYGLNP-DTTYSDMDEIKAELDFAQDLYDKIGCQVINVANRSIEETAAIILE------------
Y1193_STAS1     KERLRQLGLGE-SARYATEQRIEEELNYFHELVDKIGCPIIDVSDKAIEETANDIISLI----------
Y1353_STAHJ     KQRLKQLGLG-DSARYANEIRIKEEIKYFEDIVDRIGCAVIDVSDKAIEETANDVINIIESQSK-----
Y1206_LACAC     RQRMIAYGLNP-DTTYSSMDSINKELESAQALYKKLGCYVINVAHRSIEETAALILEHL----------
Y2411_CLOD6     TQRLKALGL-SSKANYANLERILQELDYSEEIMKRIGCPVINVSNKAIEETAGIILDIMKE--------
Y1974_LACPL     RQRMVQYGLNP-DTMYSNTDKIKAELEYADKIFKKIGCLVINVANKSIEETATLITESL----------
Y2169_STAEQ     RNRAETLGL-SSESNYNSLERIKKELSYAEEVFRKLNATVINTEYKSIEESAFYIEKFLAKR-------
Y2159_STAES     RNRAETLGL-SSESNYNSLERIKKELSYAEEVFRKLNATVINTEYKSIEESAFYIEKFLAKR-------
Y1026_ENTFA     SSRLASLGLG-NETSYTNVERIEQELAYAEEIFAKYGIPVIDVTAKSVEETAFLIKEKLDER-------
Y812_STRGC      SHRLDSLGL-TQETSYTDLEKIYQELDYSKTVFKKYGAQIINMSDKSIEETAFLI--------------
Y1664_STAA8     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1620_STAAC     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1565_STAAT     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1523_STAA3     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1466_STAAE     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1738_LACCB     RQRMIAYGLNP-DTAYSARDQVNQELKFAEDLYKKIGCMVINTAHRSIEETATLILE------------
Y1655_STAA2     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1640_STAAR     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1621_STAA9     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1563_STAAM     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1550_STAA1     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1522_LACC3     RQRMIAYGLNP-DTAYSARDQVNQELKFAEDLYKKIGCMVINTAHRSIEETATLILE------------
Y1515_STAAW     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1501_STAAS     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1435_STAAB     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1392_STAAN     KERLKQLGLG-DTARYATEARIQEELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y1250_STAES     KERLKQLGLG-DKARYATEARIQEELDYFEKLVDKIGCPVIDVSDKAIEETANDIIHFI----------
Y1129_STAEQ     KERLKQLGLG-DKARYATEARIQEELDYFEKLVDKIGCPVIDVSDKAIEETANDIIHFI----------
Y181_STAS1      NERVKILGL-SGPSNYNSMDRIREELIHAEEVFEKLNATVINTEYKSIEESAFYIEKCL----------
Y1110_PEDPA     RQRMIAYGLNP-ESSYSNMDSINKELQSADELFKKIGCLVINTANKSIEETATIIMESL----------
PDRP2_ARATH     RTRVKTLGVDTAENNYSGIDLVRKELDFASRIYERNGWAVIDVTNKAIEETAAVILRLYHD--------
Y1243_HALOH     QERLKSLGIDP-ESSYASIDRINVELEYAEKTMEKIGCPVIDVTNKSIEESANEVIDYL----------
Y2419_ENTFA     KERMRAYGL-PENTSYSDIEKIRRELAFANDLYQKLGCIVIDVASLSIEETASMILNAL----------
Y3950_CLOB6     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
YSI3_STAAU      KERLKQLGLGDTARYATDQ----EELNYFEEIVSEIGCPVIDVSQKAIEETANDII-------------
Y699_LACS1      RQRMISYGLDP-DTVYSNMDNINQELEFATNLYKELGCLQINVATKSIEETATLIIESL----------
Y2715_BACLD     KERLKSLGL---NDKYANINRIKEELEFFEKIVGRIGCNVVDVSNKAVEETANIIHNMMTKR-------
Y863_CLOBK      RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y4116_CLOBJ     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y3856_CLOBL     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y3704_CLOB1     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y3611_CLOBH     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y3095_CLOBM     RHRVDNMMKIPTELKYANAERVLDELEFADKIMRKLKCKVIDVTKRAIEDTALIIMEVFSDR-------
Y1513_SYNWW     TERLKTLGL-KGQASYANLERILEEMEYAQEIMKRLGCPVIDVTNRAVEETASKILEI-----------
Y4901_CLOB8     KRRLDKFHRITSDIEYAGDARVLEELDFADKIMRKIGCKTIDVTERAIEDTALIILE------------
Y1359_THEP3     KERLKSLGLDA-NAIYATEERVKKEIKYAEEVMKRLGCTVIDVTNKAVEETANVILNVL----------
Y1350_THEPX     KERLKSLGLDA-NAIYATEERVKKEIKYAEEVMKRLGCTVIDVTNKAVEETANVILNVL----------
Y5851_SORC5     QARLRQLGM-PSETNYAMREHVRQELDFANRLFAAHEWPVVDVTKRAIEETAVIILEHLKERDER----
Y442_STAHJ      KNRAETLGL-SSESRYNNLDRIKKELVYAEEVFKKLNATVINTEYKSIEESAFYIEKFL----------
Y1866_LISMO     KVRLRSIGLDEAS-SYSSEKRILEELEYGYDTFKKLGCQVIHV--------------------------
PDRP1_MAIZE     KTRAKTLGFDGRQSNYAEMDHVRQELVHANQIFVQNWWPVIAVTGKAIEETAAVILGILHDRKQK----
Y3504_CLOBB     KKRLDKFHRISSSIEYAGDERILEELEYSDRIMKRLGCKTIDITQRAIEDTALIILELI----------
Y3704_LYSSC     KERLMSLGL---NDDYAQHNRILEEIQHFEKIVGKIGCRVIDVTNKAVEETANTIIE------------
PDRP1_ORYSJ     KARAKTLGFHGQKSNYAEMEHVRGELDHANQIFAQHPWPVIEVTGKAIEETAAVVVRIFHDRKQK----
PDRP1_ORYSI     KARAKTLGFHGQKSNYAEMEHVRGELDHANQIFAQHPWPVIEVTGKAIEETAAVVVRIFHDRKQK----
Y3210_CHLSY     XXXXXXMGVSIGG-NYTSLDAAYDEVEWARRTFRQHGWTTINVTDKSIEESADEIITLISRRFSQ----
Y2965_CHLAA     XXXXXXMGVSIGG-NYTSLDAAYDEVEWARRTFRQHGWTTINVTDKSIEESADEIITLISRRFSQ----
Y980_THETN      KERLKSLGLN-DNALYATEERVKKEIQYAEEVMQKLGCTVIDVTNKAVEETANIILNVL----------
Y3298_CLOBA     KKRLDKFHRISSSIEYAGDERILEELEYSDRIMKRLGCKTIDITQRAIEDTALIILE------------
Y2484_GEOKA     RERLKSLGL---NDQYANMDRIKEELAYFDEVVKKIGCDVIDVTNKAVEETASIIMKKL----------
YQFL_BACSU      KERLKSLGL---NDKYANINRIKEELEYFEKIVDRIGCQVVDVSNKAVEETANIIHHL-----------
Y1946_OCEIH     KERLKALGLG-DQATYANMNRIEQELEYFQSIVDKIGCQVIDVSNKAVEETANHILRL-----------
Y2421_GEOTN     RERLKSLGL---NDQYANMDRIKEELAYFDGVVKKIGCDVIDVTNKAVEETASIIMKKL----------
Y606_MOOTA      QERLKTLGL-PGPAGYATRERIEEELAYARRVMDQLGCPVIDVTNKAVEETAGKILQIYYRRER-----
Y1369_DESPS     KMRQESLGT-SDMHAYSRRQEVEVEVQTAQKYYITKGFSMIDVSNKPIETSAEEIAEMITRR-------
Y1373_BACHD     AERLKTLGKSQANYANIDR--IKEELAYAEGIMKRIGCPVIDVSNKAVEETANLISSM-----------
Y2417_GEOSW     RERLKSLGL---NDQYANMDRIKEELAYFDGIVKKIGCDVIDVTNKAVEETANIIMK------------
Y2354_BACA2     KERLKSLGL---NDKYANINRIKEELEYFEKIVDRIGCQVVDVSNKAVEETANIIHHL-----------
Y1885_LISW6     KVRLKSIGLDE-SSSYSSEKRILEELEYGYDTFKKLGCQVIHV--------------------------
Y122_CLOTE      KHRMNKFNQLSSEIQYANGERVLEELEYADKIMRRLRCKIIDVTNRAIEDTALLIMEAI----------
Y1895_LISMF     KVRLKSIGLDEAS-SYSSEKRILEELEYGYDTFKKLGCQVIHV--------------------------
Y1687_BACSK     TERLKALGKSEANYANIDR--IKEELEYAKKVMDRVNCPVIDVSNKAVEETANLISSM-----------
Y823_BACC2      KERLKSLGLSDG-ATYANINRIQEEIDHFEEVISKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4413_BACC4     KERLKSLGLSDG-ATYANINRIQEEIDHFEEVISKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4293_BACCR     KERLKSLGLSDG-ATYANINRIQEEIDHFEEVISRINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y1980_LISIN     KVRLKSIGLDEAS-SYSSEKRILEELEYGYATFKKLGCQVIHV--------------------------
Y4147_BACWK     KERLKSLGLSDG-ATYANINRIQEEIDHFEEVISKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4558_BACAC     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4540_BACAA     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4520_BACAN     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4429_BACC7     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4407_BACC3     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4376_BACC1     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4318_BACC0     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QNQKM--
Y4044_BACCZ     KERLKSLGLSDG-ATYANINRIKEEIDHFENVVSKINCQVIDVSNKAIEETANIIVNAV---QN