[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37710.1

[Show Plain Result]


## Summary of Sequence Search
    1::137
   55::219     1e-11  34%  225 aa  THYN1_HUMAN RecName: Full=Thymocyte nuclear protein 1;AltName:
   57::220     3e-11  36%  226 aa  THYN1_MOUSE RecName: Full=Thymocyte nuclear protein 1;AltName:
   57::220     6e-11  36%  226 aa  THYN1_RAT RecName: Full=Thymocyte nuclear protein 1;
   73::236     2e-10  35%  242 aa  THYN1_CHICK RecName: Full=Thymocyte nuclear protein 1;AltName:
   63::225     2e-10  37%  231 aa  THYN1_DANRE RecName: Full=Thymocyte nuclear protein 1;
   10::189     9e-09  37%  261 aa  YBV3_SCHPO RecName: Full=Uncharacterized protein C21.03c;
    1::137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNXXXXXXXXXXXXXXX
THYN1_HUMAN     -SHWLMKSEPESFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNKEPGIAGLMKIVKEA
THYN1_MOUSE     --YWLMKSEPESFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYHSNKQPGIVGLMKIVKEA
THYN1_RAT       --YWLMKSEPESFSIEDLQAQPKQTTCWDGVRNYQAWNFLRAMKLEDEAFFYHSNKQPGIVGLMKIVKEA
THYN1_CHICK     --HWLLKSEPESFSIEDLKAQPNQTTFWEGVRNYQARNFLRAMKLGQQAFFYHSNKEPGIVGIVKIVKEA
THYN1_DANRE     ---WLMKSEPESFGIEDLKALPNQTGCWDGVRNYQARNFMREMKVGQQAFFYHSNKEPGIAGLMKIVKEA
YBV3_SCHPO      --YWLMKAEGETFEMLEEITEDGKMESWSGVRNYEAR-NMIRIKIGDYAFLYCSNCKFPHIKGVMRVSIT


                         .         .         *         .         .         .         .:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMxxx
THYN1_HUMAN     YPDHTEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQLKNMVLFTRQRLSIQPLTQEEFDFVLSL---
THYN1_MOUSE     YPDHTEDDPKWSMVDVQFVRMMKRFIPLEELKTYHQLKSMTLFTRQRLSVQPLTQEEFDFILSL---
THYN1_RAT       YPDHTEDNPKWSMVDVQFVRMMKRFISLDELKTYHQLKSMTLFTRQRLSVQPLTQEEFDFILSL---
THYN1_CHICK     YPDHTQENPKWSMVDVQFVRMTKRFIPLSEIKTHGPLKNMMLFSRQRLSIQPLTQEEFDFVLSL---
THYN1_DANRE     YVDHTQDNPKWHMVDVQFERMVKRFIPLAELKLEHRLKDMALFTRARLSVQPLTAEEFEFVLSL---
YBV3_SCHPO      FPKSTPQNPRWYSVGVQSEYKLDRPVTLRELKMENQLKSMELLNRSRLSISRVKPEEWKFI------