[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37723.1

[Show Plain Result]


## Summary of Sequence Search
    1::194
   34::178     2e-25  43%  180 aa  Y1483_SYNY3 RecName: Full=Uncharacterized protein sll1483;Flags:
    3::131     5e-21  43%  133 aa  Y1735_SYNY3 RecName: Full=Uncharacterized protein sll1735;
    3::131     1e-18  38%  133 aa  Y175_SYNP2 RecName: Full=Uncharacterized protein SYNPCC7002_A0175;
   94::191     5e-18  46%  193 aa  MP70_MYCTU RecName: Full=Immunogenic protein MPT70;Flags:
   94::191     5e-18  46%  193 aa  MP70_MYCBO RecName: Full=Immunogenic protein MPB70;Flags:
  120::217     4e-16  48%  220 aa  MP83_MYCTU RecName: Full=Cell surface lipoprotein MPT83;AltName:
  120::217     4e-16  48%  220 aa  MP83_MYCBT RecName: Full=Cell surface lipoprotein MPB83;AltName:
  120::217     4e-16  48%  220 aa  MP83_MYCBO RecName: Full=Cell surface lipoprotein MPB83;AltName:
  270::373     2e-14  38%  683 aa  BGH3_MOUSE RecName: Full=Transforming growth factor-beta-induced
  270::373     3e-14  37%  683 aa  BGH3_HUMAN RecName: Full=Transforming growth factor-beta-induced
  269::369     3e-13  36%  838 aa  POSTN_MOUSE RecName: Full=Periostin;         Short=PN;AltName:
  267::367     8e-13  35%  836 aa  POSTN_HUMAN RecName: Full=Periostin;         Short=PN;AltName:
  270::373     4e-12  36%  683 aa  BGH3_RABIT RecName: Full=Transforming growth factor-beta-induced
  133::236     7e-10  31%  683 aa  BGH3_PIG RecName: Full=Transforming growth factor-beta-induced
  490::590     2e-09  34% 1431 aa  STAB2_RAT RecName: Full=Stabilin-2;AltName: Full=Fasciclin,
 1633::1733    2e-09  35% 2559 aa  STAB2_MOUSE RecName: Full=Stabilin-2;AltName: Full=Fasciclin,
 1626::1726    8e-08  32% 2551 aa  STAB2_HUMAN RecName: Full=Stabilin-2;AltName: Full=Fasciclin,
  500::638     2e-07  28% 2570 aa  STAB1_HUMAN RecName: Full=Stabilin-1;AltName: Full=Fasciclin,
 1610::1711    3e-07  35% 2571 aa  STAB1_MOUSE RecName: Full=Stabilin-1;AltName: Full=Fasciclin,
  367::470     5e-07  28%  662 aa  FAS1_SCHAM RecName: Full=Fasciclin-1;AltName: Full=Fasciclin I;    
   77::184     8e-06  32%  247 aa  FLA6_ARATH RecName: Full=Fasciclin-like arabinogalactan protein
   78::183     1e-05  32%  249 aa  FLA12_ARATH RecName: Full=Fasciclin-like arabinogalactan protein
  358::463     3e-05  30%  652 aa  FAS1_DROME RecName: Full=Fasciclin-1;AltName: Full=Fasciclin I;    
   76::181     6e-05  33%  246 aa  FLA11_ARATH RecName: Full=Fasciclin-like arabinogalactan protein
   75::181     7e-04  36%  247 aa  FLA13_ARATH RecName: Full=Fasciclin-like arabinogalactan protein
    1::194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTVMVGGAPMYPSKNIVENAVNSKDHSXX
Y1483_SYNY3     ------------------------------------------SAVVSQAATDSAMTIVEVAAGNETFSTL
Y1735_SYNY3     -------------------------------------------------------NIVEIAVSDERFSTL
Y175_SYNP2      -------------------------------------------------------SIVDIAVNNEGFSTL
MP70_MYCTU      ----------------------------------------------------------------------
MP70_MYCBO      ----------------------------------------------------------------------
MP83_MYCTU      ----------------------------------------------------------------------
MP83_MYCBT      ----------------------------------------------------------------------
MP83_MYCBO      ----------------------------------------------------------------------
BGH3_MOUSE      ----------------------------------------------------------------------
BGH3_HUMAN      ----------------------------------------------------------------------
POSTN_MOUSE     ----------------------------------------------------------------------
POSTN_HUMAN     ----------------------------------------------------------------------
BGH3_RABIT      ----------------------------------------------------------------------
BGH3_PIG        ----------------------------------------------------------------------
STAB2_RAT       ----------------------------------------------------------------------
STAB2_MOUSE     ----------------------------------------------------------------------
STAB2_HUMAN     ----------------------------------------------------------------------
STAB1_HUMAN     -----------------------------------------------GTPGDPKRTIGQILASTEAFSRF
STAB1_MOUSE     ----------------------------------------------------------------------
FAS1_SCHAM      ----------------------------------------------------------------------
FLA6_ARATH      ----------------------------------------------------------------------
FLA12_ARATH     ----------------------------------------------------------------------
FAS1_DROME      ----------------------------------------------------------------------
FLA11_ARATH     ----------------------------------------------------------------------
FLA13_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
Y1483_SYNY3     VAAVKAADLVEALSAEGPFTVFAPTNDAFAALPAGTVESLLLPENKDKLVKILTYHVVPGKITAAQVQSG
Y1735_SYNY3     VTAVTAANLVDVLQSPGPFTVFAPTDTAFAKLPPGTITTLV--QNIPQLARILTYHVVAGKFTQADLCRL
Y175_SYNP2      VAAVQAAGLVETLAGEGDFTVFAPNDDAFAKLPPGTIQTLV--QNPPQLARILTYHVAAGRLTKDDLIKL
MP70_MYCTU      ----------------GQYTVFAPTNAAFSKLPASTIDEL--KTNSSLLTSILTYHVVAGQTSPANVVGT
MP70_MYCBO      ----------------GQYTVFAPTNAAFSKLPASTIDEL--KTNSSLLTSILTYHVVAGQTSPANVVGT
MP83_MYCTU      ----------------GEYTVFAPTNAAFDKLPAATIDQL-KTDAK-LLSSILTYHVIAGQ-ASPSRIDG
MP83_MYCBT      ----------------GEYTVFAPTNAAFDKLPAATIDQL-KTDAK-LLSSILTYHVIAGQ-ASPSRIDG
MP83_MYCBO      ----------------GEYTVFAPTNAAFDKLPAATIDQL-KTDAK-LLSSILTYHVIAGQ-ASPSRIDG
BGH3_MOUSE      -------------EGDGQFTLLAPTNEAFEKIPAETLNRILDPEA---LRDLLNNHILKSAMCAEAIVAG
BGH3_HUMAN      -------------EGNGQYTLLAPTNEAFEKIPSETLNRILDPEA---LRDLLNNHILKSAMCAEAIVAG
POSTN_MOUSE     ----------------GHFTLFAPTNEAFEKLPRGVLERIM--GDKVASEALMKYHILNTLQCSEAITGG
POSTN_HUMAN     ----------------GHFTLFAPTNEAFEKLPRGVLERIM--GDKVASEALMKYHILNTLQCSESIMGG
BGH3_RABIT      -------------ESDGQFTLLAPTNEAKEKIPTETLNRILDPEA---LRDLLNNHILKSAMCAEAIVAG
BGH3_PIG        -------------EGPGSFTIFAPSNEAWASLPAEVLDSLVS-NVNIELLNALRYHMVDRRVLTDELKHG
STAB2_RAT       --------------GPGPFTVFAPLSSSFNHEP-----RIKDWDQQGLMSQVLRYHVVGQQLLLDNLKVT
STAB2_MOUSE     --------------GPGPFTVFVPSSDSFN-----SESKLKVWDKQGLMSQILRYHVVAQQLLLENLKVI
STAB2_HUMAN     --------------GPGPFTVFAPLSAAFDE------EARVKDWDKGLMPQVLRYHVVAHQLLLENLKLI
STAB1_HUMAN     ETILENCGLPSILDGPGPFTVFAPSNEAVDSLRDGRLIYLF-TAGLSKLQELVRYHIYHGQLTVEKLISK
STAB1_MOUSE     -------------KGDGPFTVFVPHADLISNM---SQDELARIRAHRQL--VFRYHVVGRKLWSQEMLDQ
FAS1_SCHAM      -------------------TLFAPSNAAWSETTANNLLT-----DRKKFREILNLHIVAEKLSIESIVEQ
FLA6_ARATH      -------------------TIFAPTDNAFNKLKPGTLNSLTYQQQ----IQLMLYHIIPKYYSLSDLLLA
FLA12_ARATH     -------------------TIFAPSDSSFTGLKAGTLNSLTDEQQ----VELIQFHVIPSYVSSSNFTIS
FAS1_DROME      -------------------TILAPSNEAWN---SSNINNVLRDRNK--MRQILNMHIIKDRLNVDKIRQK
FLA11_ARATH     -------------------TVFAPTDNAFNSLKSGTLNSL----SDQQKVQLVQFHVLPTLITMPQFTVS
FLA13_ARATH     -------------------TVLAPTDNAFQNLKPGTLNKL-SPDDQ---VKLILYHVSPKFYTLEDLASG


                         +         .         .         .         .         *         .:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPx
Y1483_SYNY3     -EVASLAGEALTFKVKDGKV-----KVNKATVISADVDASNGVIHVIDQVILP-
Y1735_SYNY3     STVDSVEGSPIAIDTEGFEVK-------NATVIIPDIEADNGIIHVIDNVIL--
Y175_SYNP2      GEVTSIEGSPIPI--NGED----DFEVKNATVLAADIEADNGIIHVIDNVIL--
MP70_MYCTU      RQ--TLQGASVTVTGQGNSL-----KVGNADVVCGGVSTANATVYMIDSVLMP-
MP70_MYCBO      RQ--TLQGASVTVTGQGNSL-----KVGNADVVCGGVSTANATVYMIDSVLMP-
MP83_MYCTU      TH-QTLQGADLTVIGARDDLMV-----NNAGLVCGGVHTANATVYMIDTVLMP-
MP83_MYCBT      TH-QTLQGADLTVIGARDDLMV-----NNAGLVCGGVHTANATVYMIDTVLMP-
MP83_MYCBO      TH-QTLQGADLTVIGARDDLMV-----NNAGLVCGGVHTANATVYMIDTVLMP-
BGH3_MOUSE      MSMETLGGTTLEVGCSGDKLTI----NGKAVISNKDILATNGVIHFIDELLIP-
BGH3_HUMAN      LSVETLEGTTLEVGCSGDMLTI----NGKAIISNKDILATNGVIHYIDELLIP-
POSTN_MOUSE     AVFETMEGNTIEIGCEGDSISI----NGIKMVNKKDIVTKNGVIHLIDEVLIP-
POSTN_HUMAN     AVFETLEGNTIEIGCDGDSITV----NGIKMVNKKDIVTNNGVIHLIDQVLIP-
BGH3_RABIT      LSMETLEATTLEVGCSGDMLTI----NGKAIISNKDVLATNGVIHFIDELLIP-
BGH3_PIG        MALTSMQNSNIQIHHYPNGIVTVNC----ARLLKADHHATNGVVHLIDKVI---
STAB2_RAT       TSATTLQGEPVSISVSQDTVFI----NNEAKVLSSDIISTNGVIHVIDKLLSP-
STAB2_MOUSE     TSATTLQGEPISISVSQDTVLI----NKKAKVLSSDIISTNGVIHVIDTLLSP-
STAB2_HUMAN     SNATSLQGEPIVISVSQSTVYI----NNKAKIISSDIISTNGIVHIIDKLLSP-
STAB1_HUMAN     GRILTMANQVLAVNISEEGRILLGPEG--VPLQRVDVMAANGVIHMLD------
STAB1_MOUSE     GYITTLSGHTLRVSEREGSIYLNDF----ARVVSSDLEVVNGVLHFIDHVLLP-
FAS1_SCHAM      KQVPTMADRNVVHGPAGNKTVTVEGGGVNATIVQPNIAATNGMVHIINKIL---
FLA6_ARATH      SQATGQDGGVFGLNFTGQQSNQVNVSTGVVETRINNAQQFPLAVYVVDSVLLP-
FLA12_ARATH     NPLRTQAGDSLNVTTSGNTVNIT---SGVTNTTVSGNVYSDGAVYQVDKVLLP-
FAS1_DROME      NQVPTVNNNTFNVRGEGDTVITVEGGGVNATVIQADVAQTNGYVHIIDHVL---
FLA11_ARATH     NPLRTQAGFPLNITSSGNQVNITTGV-VSATVANSVYSDKQLAVYQVDQVLLP-
FLA13_ARATH     RDVGGVYGLNFT--GQGNQVNV--STGVVETRLSTSLRQERPLVYVVDMVLLP-