[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37731.1

[Show Plain Result]


## Summary of Sequence Search
    1::344
    1::340     e-105  57%  340 aa  DHAS_AQUAE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::338     7e-98  54%  338 aa  DHAS_RICFE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::338     9e-98  55%  338 aa  DHAS_RICCN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::338     5e-95  53%  338 aa  DHAS_RICTY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::338     1e-89  50%  338 aa  DHAS_RICPR RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::333     8e-89  51%  337 aa  DHAS_VIBCH RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    7::335     3e-88  50%  347 aa  DHAS_LEGPN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::334     4e-88  51%  338 aa  DHAS_SHEVI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::338     9e-87  49%  338 aa  DHAS_RICBR RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::334     3e-86  50%  338 aa  DHAS_SHESP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    6::341     9e-82  48%  343 aa  DHAS_CAMJE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::316     1e-80  49%  316 aa  DHAS_VIBMI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    2::332     1e-76  51%  338 aa  DHAS_STRAK RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   14::342     1e-74  45%  343 aa  DHAS_PROMA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    1::347     6e-73  46%  358 aa  DHAS_STRMU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   18::346     1e-72  45%  346 aa  DHAS_BACSU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    1::341     2e-70  47%  345 aa  DHAS_MYCTU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    1::341     2e-70  47%  345 aa  DHAS_MYCBO RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::339     7e-68  45%  346 aa  DHAS_HELPJ RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::339     4e-67  44%  346 aa  DHAS_HELPY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::342     7e-66  46%  346 aa  DHAS_MYCSM RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::343     3e-65  48%  344 aa  DHAS_CORGL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::343     8e-65  47%  344 aa  DHAS_CORML RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   17::343     6e-64  47%  344 aa  DHAS_CORFL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    6::277     9e-63  45%  280 aa  DHAS_SYNY3 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    7::336     3e-41  33%  336 aa  USG_PSEAE RecName: Full=USG-1 protein homolog;
   23::334     4e-40  32%  336 aa  USG_AZOVI RecName: Full=USG-1 protein homolog;
    4::336     7e-37  29%  337 aa  USG_ECOLI RecName: Full=USG-1 protein;
    1::343     2e-32  40%  343 aa  DHAS_ARCFU RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    7::352     5e-29  35%  354 aa  DHAS_METJA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::347     2e-24  36%  347 aa  DHAS_METTH RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::257     3e-22  38%  349 aa  DHAS_LEPIN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::257     4e-22  38%  349 aa  DHAS_LEPIC RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    3::365     8e-22  42%  365 aa  DHAS_YEAST RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    3::370     4e-21  28%  370 aa  DHAS_PSEAE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   58::370     1e-20  31%  371 aa  DHAS_HAEIN RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   67::370     1e-20  31%  371 aa  DHAS_BUCAI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::356     2e-20  29%  367 aa  DHAS_SHIFL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::356     2e-20  29%  367 aa  DHAS_ECOLI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::356     2e-20  29%  367 aa  DHAS_ECOL6 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::356     2e-20  29%  367 aa  DHAS_ECO57 RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::357     1e-19  28%  368 aa  DHAS_SALTY RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    4::357     1e-19  28%  368 aa  DHAS_SALTI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   58::285     2e-19  35%  286 aa  DHAS_ACTPL RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    2::357     6e-19  31%  371 aa  DHAS_NEIMB RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    2::357     2e-18  30%  371 aa  DHAS_NEIMA RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    1::362     1e-17  27%  376 aa  DHAS_BORPE RecName: Full=Aspartate-semialdehyde dehydrogenase;     
   97::358     2e-17  32%  369 aa  DHAS_BUCBP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    1::370     8e-17  27%  371 aa  DHAS_BUCAP RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    5::357     7e-15  34%  357 aa  DHAS_SCHPO RecName: Full=Probable aspartate-semialdehyde
    2::178     1e-12  34%  332 aa  ARGC_ARCFU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   84::310     3e-12  25%  317 aa  USG_HAEIN RecName: Full=USG-1 protein homolog;
    3::368     6e-12  28%  368 aa  DHAS_AZOVI RecName: Full=Aspartate-semialdehyde dehydrogenase;     
    3::334     5e-11  29%  336 aa  ARGC_MORAB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::325     1e-10  28%  339 aa  ARGC_KOSOT RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::323     1e-10  27%  344 aa  ARGC_GEOTN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::323     1e-10  29%  344 aa  ARGC_GEOKA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     3e-10  29%  345 aa  ARGC_BACHD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::324     2e-09  28%  345 aa  ARGC_BACSU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     3e-09  31%  347 aa  ARGC_NEIMB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     3e-09  31%  347 aa  ARGC_NEIMA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     3e-09  31%  347 aa  ARGC_NEIM0 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::180     3e-09  31%  342 aa  ARGC_METST RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     3e-09  26%  343 aa  ARGC_LISMC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::185     5e-09  33%  343 aa  ARGC_METKA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     5e-09  27%  343 aa  ARGC_LISIN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     6e-09  26%  343 aa  ARGC_LISMF RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-09  30%  346 aa  ARGC_ALKMQ RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     8e-09  30%  347 aa  ARGC_NEIMF RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::194     8e-09  32%  336 aa  ARGC_MORPR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::177     1e-08  31%  334 aa  ARGC_METTH RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::327     1e-08  27%  341 aa  ARGC_STAES RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::191     1e-08  30%  342 aa  ARGC_SILPO RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::327     2e-08  26%  341 aa  ARGC_STAEQ RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::328     2e-08  28%  349 aa  ARGC_MAGSM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     2e-08  30%  345 aa  ARGC_BACCN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     3e-08  31%  347 aa  ARGC_NEIG2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::191     3e-08  31%  347 aa  ARGC_NEIG1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::335     3e-08  28%  351 aa  ARGC_HELMI RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     4e-08  31%  345 aa  ARGC_BACC4 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::185     5e-08  29%  342 aa  ARGC_SILST RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::200     5e-08  30%  346 aa  ARGC_PELPD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::324     5e-08  27%  345 aa  ARGC_BACST RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   13::332     9e-08  28%  341 aa  ARGC_CHLTE RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::338     1e-07  27%  341 aa  ARGC_DEHE1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::323     2e-07  27%  339 aa  ARGC_THESQ RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::173     2e-07  30%  330 aa  ARGC_PYRHO RecName:
    3::323     2e-07  27%  339 aa  ARGC_THEP1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::323     2e-07  29%  339 aa  ARGC_THEMA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     2e-07  27%  343 aa  ARGC_LISW6 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::186     3e-07  29%  342 aa  ARGC_NITEU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::309     3e-07  24%  310 aa  ARGC_AGRRK RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::184     4e-07  28%  344 aa  ARGC_CLOB8 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::191     4e-07  32%  354 aa  ARGC_CALMQ RecName:
    6::150     6e-07  29%  327 aa  ARGC_XYLFT RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::150     6e-07  29%  333 aa  ARGC_XYLFA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::150     6e-07  29%  327 aa  ARGC_XYLF2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::331     6e-07  31%  347 aa  ARGC_PELTS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   16::180     6e-07  32%  341 aa  ARGC_METTP RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::161     6e-07  35%  346 aa  ARGC_GEOSM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::167     6e-07  35%  346 aa  ARGC_GEOSL RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::186     6e-07  31%  346 aa  ARGC_DESAP RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::330     6e-07  25%  346 aa  ARGC_CLOTH RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  531::829     6e-07  26%  847 aa  ARG56_DICDI RecName: Full=Bifunctional protein argC,
    3::194     7e-07  28%  355 aa  ARGC_PSYWF RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::187     9e-07  30%  342 aa  ARGC_METVS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::161     9e-07  34%  346 aa  ARGC_GEOBB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::339     1e-06  25%  343 aa  ARGC_STAAR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     1e-06  25%  343 aa  ARGC_STAAN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     1e-06  25%  343 aa  ARGC_STAAM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     1e-06  25%  343 aa  ARGC_STAA1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     1e-06  26%  343 aa  ARGC_LISMH RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::161     1e-06  31%  346 aa  ARGC_HALWD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     2e-06  32%  334 aa  ARGC_SALTY RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     2e-06  32%  334 aa  ARGC_SALTI RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     2e-06  32%  334 aa  ARGC_SALPA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::209     2e-06  29%  330 aa  ARGC_PYRFU RecName:
    3::195     2e-06  29%  346 aa  ARGC_GEOSF RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     3e-06  23%  311 aa  ARGC_OCHA4 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::185     3e-06  32%  343 aa  ARGC_METMP RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   25::195     3e-06  29%  345 aa  ARGC_JANMA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   16::186     3e-06  29%  345 aa  ARGC_HERAR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::195     3e-06  30%  346 aa  ARGC_GEOUR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  535::729     3e-06  27%  857 aa  ARG56_CANAL RecName: Full=Protein ARG5,6, mitochondrial;Contains:
    3::183     4e-06  32%  341 aa  ARGC_METJA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::327     4e-06  28%  343 aa  ARGC_EXIS2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     4e-06  35%  334 aa  ARGC_ECOL6 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   66::324     4e-06  29%  345 aa  ARGC_BACLD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::165     5e-06  33%  352 aa  ARGC_SULSO RecName:
    1::191     5e-06  28%  342 aa  ARGC_RHOCA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::156     5e-06  30%  330 aa  ARGC_PYRKO RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     5e-06  27%  343 aa  ARGC_LISMO RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUSU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUSI RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUMB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUC2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUAB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUA2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     5e-06  23%  310 aa  ARGC_BRUA1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::329     5e-06  28%  345 aa  ARGC_BACWK RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::149     5e-06  33%  345 aa  ARGC_BACCQ RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::149     5e-06  33%  345 aa  ARGC_BACC7 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::149     5e-06  33%  345 aa  ARGC_BACC1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::325     6e-06  28%  340 aa  ARGC_STRSV RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::182     6e-06  30%  340 aa  ARGC_STRMU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-06  25%  343 aa  ARGC_STAAW RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-06  25%  343 aa  ARGC_STAAS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-06  25%  343 aa  ARGC_STAAC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-06  25%  343 aa  ARGC_STAA8 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::334     6e-06  25%  343 aa  ARGC_STAA3 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::185     6e-06  28%  345 aa  ARGC_PELCD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::165     6e-06  31%  343 aa  ARGC_NITOC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::174     6e-06  28%  328 aa  ARGC_METB6 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::192     6e-06  33%  356 aa  ARGC_IGNH4 RecName:
    3::330     6e-06  27%  346 aa  ARGC_DESPS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     6e-06  33%  345 aa  ARGC_BACC3 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     6e-06  33%  345 aa  ARGC_BACAN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     6e-06  33%  345 aa  ARGC_BACAC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::185     6e-06  33%  345 aa  ARGC_BACAA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     8e-06  34%  334 aa  ARGC_SHIFL RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::209     8e-06  27%  330 aa  ARGC_PYRAB RecName:
    3::320     8e-06  26%  336 aa  ARGC_DICTD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::185     8e-06  28%  344 aa  ARGC_ACIF5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::185     8e-06  28%  344 aa  ARGC_ACIF2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     1e-05  34%  334 aa  ARGC_ECOLI RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     1e-05  23%  310 aa  ARGC_BRUO2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::185     1e-05  25%  345 aa  ARGC_THET2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::175     1e-05  33%  349 aa  ARGC_SULTO RecName:
    6::192     1e-05  34%  334 aa  ARGC_ECO57 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::310     1e-05  23%  310 aa  ARGC_BRUME RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   15::186     1e-05  27%  345 aa  ARGC_BACA2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  572::715     1e-05  29%  885 aa  ARG56_SCHPO RecName: Full=Protein arg11, mitochondrial;Contains:
    4::185     2e-05  30%  343 aa  ARGC_METM7 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::155     2e-05  25%  310 aa  ARGC_RHILW RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::185     2e-05  31%  346 aa  ARGC_GEOMG RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  554::704     2e-05  27%  871 aa  ARG56_NEUCR RecName: Full=Protein arg-6, mitochondrial;Contains:
    4::190     3e-05  30%  326 aa  ARGC_SHEON RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     3e-05  28%  326 aa  ARGC_SHELP RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::155     3e-05  25%  310 aa  ARGC_RHIE6 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::165     3e-05  31%  351 aa  ARGC_PYRAE RecName:
    5::194     3e-05  29%  355 aa  ARGC_PSYCK RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::324     3e-05  29%  334 aa  ARGC_PELPB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::183     3e-05  29%  343 aa  ARGC_METM5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   53::166     4e-05  29%  315 aa  ARGC_BURCM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::309     4e-05  24%  310 aa  ARGC_AGRT5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::183     5e-05  30%  343 aa  ARGC_METM6 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   16::182     5e-05  30%  344 aa  ARGC_META3 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   53::158     5e-05  28%  315 aa  ARGC_BURS3 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::309     5e-05  22%  310 aa  ARGC_AGRVS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     7e-05  30%  334 aa  ARGC_YERPE RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     7e-05  32%  326 aa  ARGC_SHEB5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    7::190     7e-05  31%  346 aa  ARGC_RHOBA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   42::307     7e-05  24%  308 aa  ARGC_RHISN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::155     7e-05  25%  308 aa  ARGC_RHIET RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::155     7e-05  25%  310 aa  ARGC_RHIEC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    5::194     7e-05  27%  355 aa  ARGC_PSYA2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::163     9e-05  30%  352 aa  ARGC_PYRIL RecName:
   16::186     9e-05  28%  342 aa  ARGC_NITEC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::187     9e-05  30%  345 aa  ARGC_CLONN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     1e-04  28%  326 aa  ARGC_SHEWM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     1e-04  32%  326 aa  ARGC_SHEB8 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     1e-04  32%  326 aa  ARGC_SHEB2 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   22::155     1e-04  28%  310 aa  ARGC_RHIL3 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::160     1e-04  27%  345 aa  ARGC_HALMA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::185     2e-04  28%  344 aa  ARGC_SYNFM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::188     2e-04  27%  334 aa  ARGC_SULDN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     2e-04  29%  326 aa  ARGC_SHESR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     2e-04  29%  326 aa  ARGC_SHESM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     2e-04  29%  326 aa  ARGC_SHESA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::163     2e-04  31%  351 aa  ARGC_PYRCJ RecName:
    3::161     2e-04  30%  348 aa  ARGC_CELJU RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::322     2e-04  27%  344 aa  ARGC_BACAM RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     2e-04  29%  334 aa  ARGC_YERPS RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     2e-04  32%  326 aa  ARGC_SHEB9 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::154     3e-04  25%  337 aa  ARGC_RALSO RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   74::255     3e-04  27%  415 aa  ARGC_ORYSJ RecName: Full=Probable N-acetyl-gamma-glutamyl-phosphate
   49::309     3e-04  22%  310 aa  ARGC_SINMW RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::193     3e-04  28%  337 aa  ARGC_ALTMD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    5::148     3e-04  23%  322 aa  ARGC2_ANASP RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   25::180     4e-04  32%  334 aa  ARGC_UNCMA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::160     4e-04  31%  344 aa  ARGC_CLOBB RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::161     6e-04  31%  346 aa  ARGC_NATPD RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  142::333     6e-04  26%  346 aa  ARGC_EHRCJ RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::184     6e-04  24%  344 aa  ARGC_CLOK5 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::184     6e-04  24%  344 aa  ARGC_CLOK1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    5::148     6e-04  23%  322 aa  ARGC_ANAVT RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   36::129     6e-04  29%  313 aa  ARGC2_PSEPK RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::183     7e-04  25%  343 aa  ARGC_STAS1 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    4::190     7e-04  28%  326 aa  ARGC_SHEFN RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   72::190     7e-04  33%  326 aa  ARGC_SHEDO RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    3::186     7e-04  28%  347 aa  ARGC_HALOH RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   52::333     7e-04  25%  346 aa  ARGC_EHRCR RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   60::386     7e-04  22%  401 aa  ARGC_ARATH RecName: Full=Probable N-acetyl-gamma-glutamyl-phosphate
   41::158     7e-04  26%  306 aa  ARGC2_DEIRA RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   49::155     0.001  24%  310 aa  ARGC_RHIME RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    6::192     0.001  27%  334 aa  ARGC_PHOLL RecName: Full=N-acetyl-gamma-glutamyl-phosphate
  142::330     0.001  25%  346 aa  ARGC_OCEIH RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::185     0.001  28%  342 aa  ARGC_JANSC RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    2::214     0.001  25%  344 aa  ARGC_BACSK RecName: Full=N-acetyl-gamma-glutamyl-phosphate
   73::194     0.001  33%  335 aa  ARGC_AERS4 RecName: Full=N-acetyl-gamma-glutamyl-phosphate
    1::344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
DHAS_AQUAE      MGYRVAIVGATGEVGRTFLKVLEERNFPVDELVLYASERSEGKVLTFKGKEYTVKALKENSFKGIDIALF
DHAS_RICFE      --YNIAVIGATGNVGRETLNILAERNFPVNKIYAIASDNSIGREISYGEKILKISSLTNLNFDDIDIAFF
DHAS_RICCN      --YNIAVIGATGNVGRETLNILAERNFPINKVYAIASDSSLGREVSFGEKILQINSLKSLHFDDIDIAFF
DHAS_RICTY      --YNIAVIGATGNVGRETLNILAERHFPINKIYAIASNNSLGREVRFGAKILHINSLTIFNFYDIDIAFF
DHAS_RICPR      --YNIAVIGATGNVGRETLNILAERHFPINKIYAIASDNSLGREVRFGEKILHINSIKIFNFHDIEIAFF
DHAS_VIBCH      --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
DHAS_LEGPN      ----VAIVGATGAVGETFLTVLEERNFPIKSLYPLASSRSVGKTVTFRDQELDVLDLAEFDFSKVDLALF
DHAS_SHEVI      --FNVVVLGASGAVGQTMIEILEERNFPVAKLFPLASSRSAGGTVSFNGKQVEILDVDDFDWSQAQIGFF
DHAS_RICBR      --YNIAVIGATGNVGRETLNILAERNFPINKIYAVASNNSIGKKVSFGEQVLQISSLDDLDFEEIDIAFF
DHAS_SHESP      --FNVVVLGASGAVGQTIIEILQERNFPIAKLFPLASSRSAGGTVSFNGKQVEILDVDDFDWSQAQIGFF
DHAS_CAMJE      ---KIAIVGATGAVGEELLNVLDELDFPVESILPLASAKSVGSEVEFKGKAYKVKELTENVFKEIDIAFF
DHAS_VIBMI      --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
DHAS_STRAK      ---RVGIVGATGQVGTVMRRILTERNFPVTELRLFASARSAGTELD--GVTVEDAATA--DYTGLDIVLF
DHAS_PROMA      ----LAVLGSSGAVGAEILKILEERSFPIRELRLLASERSAGQVQFFKGEDLVVKKVSPEGFEDVDLVLA
DHAS_STRMU      MGYTVAIVGATGAVGTRMIQQLEQSTLPVDKVRLLSSSRSAGKVLQYKDQDVTVELTTKDSFEGVDIALF
DHAS_BACSU      ---------------QQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPESFEGVNIALF
DHAS_MYCTU      MGLSIGIVGATGQVGQVMRTLLDERDFPXXXXXXXXXXXXQGRKLAFRGQEIEVEDAETADPSGLDIALF
DHAS_MYCBO      MGLSIGIVGATGQVGQVMRTLLDERDFPXXXXXXXXXXXXQGRKLAFRGQEIEVEDAETADPSGLDIALF
DHAS_HELPJ      --YNVAIVGASGAVGQELIKGLENSFFPIKKFVPLASARSAGKKIRAFNKDYEILETTHFEKEEIDIAFF
DHAS_HELPY      --YNVAIVGASGAVGQELIKGLENSFFPIKKFVPLASTRSAGKKIKAFNKDYEILETTHFEREKIDIAFF
DHAS_MYCSM      ----IGVVGATGQGRQVMRNLLEQRNFPATSVRFFASPRSEGKKLTFRGQEIEVENAETADPSGLDIALF
DHAS_CORGL      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQASLKDIDVALF
DHAS_CORML      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQASLKDIDVALF
DHAS_CORFL      -----------------MRTLLEERNFPADTVRFFASPRSAGRKIEFRGTEIEVEDITQASLKGIDVALF
DHAS_SYNY3      -------------------------------------------------------------FKGCDLVLA
USG_PSEAE       ----VAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRMGFAESSLRVGDVDSFDFSSVGLXXX
USG_AZOVI       --------------------ILEERDFPVGQLHLLASPASAGKSVSFKGRNLRVKSIEAFDFAQVRLVFF
USG_ECOLI       -GWNIAVLGATGAVGEALLETLAERQFPVGEIYALARNESAGEQLRFGGKTITVQDAAEFDWTQAQLAFF
DHAS_ARCFU      MRYSVGVLGATGMVGQKFIQMLAEH--PWFKLTSLASERRVGKK--YGEEVDWIVSREVPDIADADIVFS
DHAS_METJA      MKIKVGVLGATGSVGQRFVQLLADH--PMFELTALASERSAGIPENIKDMVVIPTDPKHEEFEDVDIVFS
DHAS_METTH      ----VGVLGATGMVGQRFIQMLD--KHPEFELTTLASSRSAGKP--YGEVALDCEMPESVRVGDVDILFS
DHAS_LEPIN      ---KVAVLGATGSVGQRFIQLLDHHPF--FEVTHLASENSAGK--TYGEKNLVITTPDPAKTKDVVLAFS
DHAS_LEPIC      ---KVAVLGATGSVGQRFIQLLDHHPF--FEITHLASENSAGK--TYGEKNLVITTPDPAKTKDVVLAFS
DHAS_YEAST      -GKKIAVLGATGSVGQRFILLLANH--PHFELKVLASSRSAGKKVNWKQTDLECKS-EFFKECDIVFSGL
DHAS_PSEAE      ---RVGLIGWRGMVGSVLMQMLEERDFDLIEPVFFTTSNVGGQGPEVGKDIAPLKDAYSIDLKTLDVILT
DHAS_HAEIN      -------------------------------------------------------AFDIEELKKLDIIVT
DHAS_BUCAI      ---------------------------------------------------------------EMDIIIT
DHAS_SHIFL      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
DHAS_ECOLI      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
DHAS_ECOL6      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
DHAS_ECO57      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
DHAS_SALTY      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQFGQAAPTFGDTSTXXXXXXXXXXXXXXIIVT
DHAS_SALTI      ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQFGQAAPTFGDTSTXXXXXXXXXXXXXXIIVT
DHAS_ACTPL      -------------------------------------------------------AFDIEELKKLDIIVT
DHAS_NEIMB      ---KVGFVGWRGMVGSVLMQRMKEENDFAHEAFFFTTSNVGGAAPDFGQKTL-LDANNVAELAKMDIIVT
DHAS_NEIMA      ---KVGFVGWRGMVGSVLMQRMKEENDFAHEAFFFTTSNVGGAAPDFGQKTL-LDANDVAELAKMDIIVT
DHAS_BORPE      MTQAVGLVGWRGMVGSVLMQRMDENDFALIEPVFFSTSNXXXXXXXXXXXXXSLQNAYDIDLKKLPIIVT
DHAS_BUCBP      ----------------------------------------------------------------------
DHAS_BUCAP      MTKSVGIIGWRGMVGSVLLKRMQEENDFSKIIPYFFSTSQSGQDGPIINNILSKNLKDAYNINEMDIIIT
DHAS_SCHPO      ---KVGILGATGTVGQRFITLLSDH--PEFKIAVLASARSAGKPYAVATKQMSVKACDPKEFSECDIVFS
ARGC_ARCFU      ---KVGIIGASGYTGSELLRILANH--PEAEVIAASSRRYEGQKIWKVHRFLKCSP-ELSNFGDCDLVFT
USG_HAEIN       ----------------------------------------------------------------------
DHAS_AZOVI      ---RVGLIGWRGMVGSVLMQMLEERDFDLIEPVFFTTS-SVGGQGAIGKETVPLKAYSIEELKSLDAIIT
ARGC_MORAB      ---KTILVGATGYTGAELAHYIT--KHPELELAGLVSEHSLDAGKPFSDQTIQPLALSNIKHDDVDIVVL
ARGC_KOSOT      ---RVGIIGATGYTGLELVRILTNH--PDVKITFLSSRSFAGKKLNVYPFSLKNETLEEIDSKNCDVVFT
ARGC_GEOTN      ---KVAIIGATGYSGAELFRLLQAHPHVDRCDVYLSSQDGVHLSESFPHVGAVDGAVLHEALAKYDAVFF
ARGC_GEOKA      ----VAIIGATGYSGAELFRLLHGHPHVSRCDVFSSSQDGVHVSESFPHHKLEIEALSRYD-----AVFF
ARGC_BACHD      ---KVGIVGATGYGGLELIRLLSQHPNVEEIICYSSSQEGLPLDDMYGNVRWTLKAIDPEAIADVDTVFL
ARGC_BACSU      ---KIGIVGATGYGGTELVRILSHHPHAEECILYSSSGEGNVYSEGYPHLTLADQQLKPIDMNEIDIMFL
ARGC_NEIMB      ---KVGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_NEIMA      ---KVGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_NEIM0      ---KVGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_METST      ----VAIIGASGYTGGELVRLLT--RHPRVNISTVTSRKNNGEDLSLQDLDLKFTNPDTKDI-DADVVFS
ARGC_LISMC      ---KVSIIGATGYGGLELIRLLHQHASVDIATLHSFSAQSETLATFYPHKDLEASPLEKINSAEIDTVFI
ARGC_METKA      ----VGIVGASGYTGGELLRLL-ARHPEVEEVRYATSRRLEGKPVWKVHPNLR-RDYPDLEFSDCDVVFT
ARGC_LISIN      ---KVSIIGATGYGGLELIRLLHQHSSVDIATLHSFSAQSETLANFYPHKGLEASPLEKINPAEIDTVFI
ARGC_LISMF      ---KVSIIGATGYGGLELIRLLHQHASVDIATLHSFSAQSETLATFYPHKDLEASPLEKINSAEIDTVFI
ARGC_ALKMQ      ---KAGILGSTGYAGAELVRLLTGH--PEVEIQFLDSRSYHGKEVYPSLKNIKCASIDENDFEGIDILFC
ARGC_NEIMF      ---KVGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_MORPR      ---KTILVGATGYTGAELAHYIT--KHPELELAGLVSEHSLDAGKPFSDQTIEPLAVSNIKCDDVDIVVL
ARGC_METTH      ----VGIIGASGYTGGELLRLLENHR--EVEVVSATSRQYSGVPVSRVHPHLQDTDLKFEDVGDADLVFT
ARGC_STAES      ----ISIVGITGYTGLELLRLA--LNHPHVTVSSIHATKEVGVQISDIFPHLKGKEIQVFDSEFIDLVFF
ARGC_SILPO      MTHKIAILGASGYTGAELVRLIAEH--PNMEIVALSGERKAGQSMAHLDLPVLCK-IDEIDFAGVDLCFC
ARGC_STAEQ      ----ISIVGITGYTGLELLRLA--LNHPHVTVSSIHATKEVGVQISDIFPHLKGKEIQVFDSEFIDLVFF
ARGC_MAGSM      ---RVAILGATGYTGGELIRLL--HRHPGAELSFVSSERFAGQSIAKVYTHLQCQPMDAKKACEADFIFC
ARGC_BACCN      ---KVAIIGATGYGGIELIRLLQQH--PYFSIVSIHSFSQVGEHITSSYPHLRVYTLQEIDVESIDLVFL
ARGC_NEIG2      ---KAGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_NEIG1      ---KAGIVGATGYTGVELLRLL--AAHPDVEVAAVTSRSEAGTAVARGVYGLAFQTPDEAGLEQCDIVFF
ARGC_HELMI      ---RAAIVGATGYTGAELVRLLARHR--EVELVGLTSRQYADQPYASGQVDLACQSQDIDHITDMDVVFL
ARGC_BACC4      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGTNVYPHLRNVLFHTLQEIDVKTIEIVFL
ARGC_SILST      MTHNVAILGASGYTGAELIRLISQH--PSITIKALAAERKAGMEMADVFPHLRCK-IDEIDFAQIDLCFC
ARGC_PELPD      ----VAIVGASGYTGLELLRIL--YAHPQVAVTCVTSERSAGKRIDEVFPTLRDRVLENLESQKADLIFT
ARGC_BACST      ----VAIIGATGYSGAELFRLLYGHPHVSQCDVFSSSQDGIHLSESFPHHKLEIEALAKYD-----AVFF
ARGC_CHLTE      ----VSVIGASGYSGAELVKLL--MKHPGIVIEELYAHTQAGKRFTELYPSIPCKTFQTYGQTNSDVYLL
ARGC_DEHE1      --YKAGIINVTGYAGLELARIL--ASHPSVELCSVTGRSLAGKKLSDAFPYLHSLDLPITESGEVDIAFM
ARGC_THESQ      ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEVFPSTLENSILSEFDPEKVDVLFT
ARGC_PYRHO      ---KVAIVGGSGYIGGELIRLL--AMHPEVEIVAVTSREYAGKKVHKVHPNLRLRFTSDYNF-DADVIFL
ARGC_THEP1      ---RVGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEVFPSTLENSILSEFDPEKVDVLFT
ARGC_THEMA      ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEIFPSTLENSILSEFDPEKVDVLFT
ARGC_LISW6      ---KVSIIGATGYSGLELIRLIQQHSSVDIATLHSFSNQTNLLSNLYPHKNLEASPLEKINPKDIETVFL
ARGC_NITEU      ------IVGGTGYTGVELLRILVQH--PKVKLKVITSRQEAGTGVDRGQIALKFSDPAKVDFSKCDVVFF
ARGC_AGRRK      ----------------------------------MADRRDVEL-LSIPEAERRNAAMREDMLNSADIAIL
ARGC_CLOB8      ---KIGIIGATGYVGAELLRLL--LSHPKVEVAALSSVSFEGQEISFLSKTNLICESAHDVVEKCDVIFT
ARGC_CALMQ      ---RACIIGASGVIGGELLRLLLGHN--NVEVVCATSRRFAGEFIYRVHPNLRGFINLKFTQPSIDAVLK
ARGC_XYLFT      --FTLGIVGARGYTGAALITLLTAH--PAIELIFVSSREYHGQPVAAHNPTLRFETLDPAAVADVVILAL
ARGC_XYLFA      --FTLGIVGARGYTGAALITLLTAH--PAIELIFVSSREYHGQPVAAHNPTLRFETLDPAAVADVVILAL
ARGC_XYLF2      --FTLGIVGARGYTGAALITLLTAH--PAIELIFVSSREYHGQPVAAHNPTLRFETLDPAAVADVVILAL
ARGC_PELTS      MAVKVSIIGATGYTGAELVRILS--RHPQAELVALTTQSYAGKKFLYGYNQLTCEEMEIMESSDIVFVAL
ARGC_METTP      ----------------ELLRLLSVH--PSANVVCVTSRKLAGKPVTSGLLDLRFEAPSPAEIAQCDVVFT
ARGC_GEOSM      ---KVAIVGASGYTGVELLRIL--HSHPEVAVTCVTSEQSAGRPVSSVFPSLRGRVLENLEAEKVDIVFT
ARGC_GEOSL      ---KVAVVGASGYTGVELLRIL--HCHPEVAVTCITSEQSAGKPVSDLFPSLRAQVLENLEAEKADIIFT
ARGC_DESAP      ---KVGIVGSTGYTGAELVRLL--TRHPHVELVGLTSRSYVGEHYNYTD--LQCEELDLPRLVDADVLFT
ARGC_CLOTH      ----VGIIGATGYVGTEIVRLL--QNHPDINITSVVSHNFAGQKISDIYPNLKCDELDIDKIADAEVFVT
ARG56_DICDI     --FRVGLIGARGFTGGNLVRLIDGH--PNLELAIASSSTNFGKPITTEFPQLKSNLFDNVKPENIDIFTR
ARGC_PSYWF      ---QIAIVGGTGYTGVELIRLLSSH--PKVNIKWLTSRSEAGKPVASTFPSL--RGISELTYSDLDVVFF
ARGC_METVS      ----VSIIGGTGYTGSELLGILANHKDV--EVKNVTSRKDSGKKLTKIHPQVKLKNYNELEFKDTDIVFC
ARGC_GEOBB      ---KVAIVGASGYTGVELIRIL--HSHPEVAVTCVTSEQSAGRPVSSVFPSLRGRVLENLEAEKVDIVFT
ARGC_STAAR      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAAN      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAAM      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAA1      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_LISMH      ---KVSIIGATGYGGLELIRLLHQHASVDIATLHSFSAQSETLATFYPHKDLEASPLEKINPTEIDTVFI
ARGC_HALWD      --YTASVVGGSGFTGGELLRLLTQH--PYFEVVQATSRSKTHKTIGNVHPNLRSVDLRFTDPSEVDILFA
ARGC_SALTY      ------IVGASGYAGAELVSYVN--RHPHMTITALTSAQSNDAGKLISDLHPQLKGIDVRDFSDVDVVFL
ARGC_SALTI      ------IVGASGYAGAELVSYVN--RHPHMTITALTSAQSNDAGKLISDLHPQLKGIDVRDFSDVDVVFL
ARGC_SALPA      ------IVGASGYAGAELVSYVN--RHPHMTITALTSAQSNDAGKLISDLHPQLKGIDVRDFSDVDVVFL
ARGC_PYRFU      ---KAAVVGASGYIGGELVRLL--AMHPEVEITAITSRQYAGKKVHKVHPNLRLRFTNDYNFDADVIFLA
ARGC_GEOSF      ---KVAIVGASGYTGIELLRLL--HGHPEVSVTCVTSEQSAGKNVAEIFPTLRSRVLENLEAERADFIFT
ARGC_OCHA4      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_METMP      ----VSIIGGTGYTGSELLRLLSNH--DEVEVVNVTSRKEAGKNLNYNDLKFQNIAPEDID-SDIVFCAT
ARGC_JANMA      ---------------------------PEVKLTAITSRKEDGLPVARGRVDLAFSAPEKAKLTECDVVFF
ARGC_HERAR      ----------------ELLRILATH--PEVELTAITSRKEDGLPVSRGRVDLAFSSPDKAKLTECDVVFF
ARGC_GEOUR      ---KVAIVGASGYTGVELLRLL--HCHPEVAITCVTSEQSAGKAISEVFPTLRSRNLEPVRIADADFIFT
ARG56_CANAL     ---KVALIGARGYTGQNLIKLIDNH--PYLDISYVSSRELEGQKLGYNKDNIVYSNLQIEDINEVDVWVM
ARGC_METJA      ---EVAIIGATGYTGAELLRLLANHE--KVNVTYITSRKEAGKHVFKVHPHL--KGIEKYDIDKVDAYLV
ARGC_EXIS2      ---KCTIVGATGYAAIELIRLIE--LHPHLEIVSLISDSQTNQEMNMNNKVLTAFSLEQIEAVETDLLFL
ARGC_ECOL6      ------IVGASGYAGAELVTYVN--RHPHMNITALAQSNDAGKLISDLHPQLKIVDLPLQPMSDVDVVFL
ARGC_BACLD      --------------------------------------------------------------NEIDFLFM
ARGC_SULSO      ---RVAVVGGSGYTGGELLRILVTH--PKTEISVITSREYAGKPVSLIHPNLRLISLNFTNFSKADAIFL
ARGC_RHOCA      MTQKIAILGASGYTGAELARII--ATHPEMEITALSGDRKAGMRMGEVFPHLRLVKIEEIDFSGIDLAFC
ARGC_PYRKO      ---KAAVVGASGYIGGELVRLL--AMHPEVEITAITSRRFAGQKVHKVHPNLRGLDLRFTNTKDADVIFL
ARGC_LISMO      ---KVSIIGATGYGGLELIRLLHQHSSVDIATLHSFSAQAETLATFYPHKDLAVSPLEKINPTEIDTVFI
ARGC_BRUSU      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUSI      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUMB      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUC2      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUAB      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUA2      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BRUA1      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BACWK      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGEFITYPHHTLQXXXXXXXXXXXXXVFLA
ARGC_BACCQ      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGTNVYPHFQNVLVHTLQEIDAEEIEIVFL
ARGC_BACC7      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGTNVYPHFQNVLVHTLQEIDAEEIEIVFL
ARGC_BACC1      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGTNVYPHFQNVLVHTLQEIDAEEIEIVFL
ARGC_STRSV      ---RISIVGITGYSGMELLRIL--LQHPQAEVVSLHASQDMEAPASELYPHLKCDKIEAFDSQEIDLVFF
ARGC_STRMU      ---KVSIVGITGYSGLELVRILNGHQ--KVELVSVHATKEIGTKLSDIYSYLKCDLIQSFDSQKIDLVFF
ARGC_STAAW      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAAS      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAAC      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAA8      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_STAA3      ---KVGIVGGSGYGAIELIRLLQTH--PHVTIAHIYSHSKVDEPLKLTFPHLQ-HIMQHFDNNDCDVIFF
ARGC_PELCD      ---KVAIVGASGYTGVELIRLL--LNHPQVEITCVTSRQNAGASIDSVFPSLAGRIDLTFDPVDVDTIIR
ARGC_NITOC      ---RAAIVGGTGYTGVELLRLL--ANHPNVEIVAITSRTEAGRPVSKLFPNLRTEPEPAQLAAECDVVFF
ARGC_METB6      ---KVAIVGASGYAGGELVRLLYHHS--SAEVTCVTSRSLAGIPLSFSDLRFENPA---PDAIDADVAFL
ARGC_IGNH4      MTYEVAIVGASGYTGGELLRVL--AVHPDVNVKVVTSREYANKPVYYAPASLKFKRLDDPDVGDVDLVFL
ARGC_DESPS      ---KIAIIGASGYTGVELSRLLCNH--PQVEITAVTSRQYAGVALSEGRTSLICENLTIEELCRADLFFA
ARGC_BACC3      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGECITYPHHTLQXXXXXXXXXXXXXVFLA
ARGC_BACAN      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGECITYPHHTLQXXXXXXXXXXXXXVFLA
ARGC_BACAC      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGECITYPHHTLQXXXXXXXXXXXXXVFLA
ARGC_BACAA      ---KVAIIGATGYGGIELIRLLEQH--PYFSIASLHSFSQVGECITYPHHTLQXXXXXXXXXXXXXVFLA
ARGC_SHIFL      ------IVGASGYAGAELVTYVN--RHPHMNITALAQSNDAGKLISDLHPQLKIVELPLQPMSDVDVVFL
ARGC_PYRAB      ---KAAIVGGSGYIGGELIRLLSMH--PEVEITTITSRKFAGKKVHKVHPNLRLRFTDKYEF-DADVIFL
ARGC_DICTD      ---KVGIVGASGYVGLELTRIL--LRHPQVDKLYLFSDH---FEDSWVFKSEKIFITDRSTYSDLDVVFF
ARGC_ACIF5      ---RAGIVGGTGYTGVELLRLL--LPHPEVELVAITSRAEAGQRVDRGHCNLSYTAPDPAILGTLDVVFF
ARGC_ACIF2      ---RAGIVGGTGYTGVELLRLL--LPHPEVELVAITSRAEAGQRVDRGHCNLSYTAPDPAILGTLDVVFF
ARGC_ECOLI      ------IVGASGYAGAELVTYVN--RHPHMNITALAQSNDAGKLISDLHPQLKIVDLPLQPMSDVDVVFL
ARGC_BRUO2      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_THET2      ----MGILGASGYGGAELLRLL--KAHPEVELVGFSSRKYEGRPLEAAWPQLRLFAAQEEVLERAEVVFL
ARGC_SULTO      ---RVAVIGGSGYTGGELLRIL--AVHPKIEVTYVTSREYAGKPITLVHPNL--RGFYNMNFSQADAVFL
ARGC_ECO57      ------IVGASGYAGAELVTCVN--RHPHMNITALAQSNDAGKLISDLHPQLKIVDLPLQPMSDVDVVFL
ARGC_BRUME      ---KIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDLRADY--------------LRAADIAIL
ARGC_BACA2      ----------------ELVRILNHHPYAEDCILYSSSDEGKEYAASYPHRNIASQSLQPLHINEIDVMFI
ARG56_SCHPO     ---KVVLLGARGYTGKNLIGLINTH--PYLELSHVSSRELEGTKLGYTKKEIQYVNLSTDDVKKVDAWVM
ARGC_METM7      ----VSIIGGTGYTGSELLRLLSTHE--KVEVLNVTSRKEAGKKLNYNDLEFQNIAPEDID-TDIVFCAT
ARGC_RHILW      ----------------------------------MAGRRDVEL-LSIPEAERRNAAMREDMLNSADIAIL
ARGC_GEOMG      ----VAVVGASGYTGVELLRLL--YCHPEVAVTCITSEQSAGRPVAAVFPTLRSRVLENLEAQKADLIFT
ARG56_NEUCR     ---RVALIGARGYTGQELIRLIDSH--PNMELHHVSSRELAGKKLGYNKQEVIYENLSPEDVRDIDCWVM
ARGC_SHEON      ----IAIIGASGYTGAQLTALVHAEENSLDKGRALADLYPVHIELTLSPLTEEAKA---NIVAEADAVVL
ARGC_SHELP      ----IAIIGASGYTGAQVTSLIDQLKIQGDKGKTLASLYPVYSHIDLSLAPLTEQAKQAI-VNEADAVVL
ARGC_RHIE6      ----------------------------------MAGRRDVEL-LSIPEAERRNAAMREDMLNSADIAIL
ARGC_PYRAE      ---KVCIIGASGFVGGELLRILLQHS--GVEVVCATSRRFKGEYVYRVHPNLRFTQLKFVEPSKADVVFL
ARGC_PSYCK      -----AIVGGTGYTGIELIRLLSAH--PKVSIDLLTSRSEAGTRADEIFPSLR--GISDIVFSDLDVVFF
ARGC_PELPB      --YSVSIIGASGYSGAELTRLL--LRHPGVELQELYAFSQAGKAVSESDKVYKPYGGECE--SDVYFLAL
ARGC_METM5      ----VSIIGGTGYTGSELLRLLSNH--DKVEVLNVTSRKEAGKKLNYNDLEFQNIAPEDID-TDIVFCAT
ARGC_BURCM      -----------------------------------------------------------------DIAIL
ARGC_AGRT5      ----------------------------------LAGRRDIEL-LSIPETERRNAAMREDLLNNADISIL
ARGC_METM6      ----VSIIGGTGYTGSELLRLLSNH--DNVEVLNVTSRKEAGKKLNYNDLEFQNIAPEDID-TDIVFCAT
ARGC_META3      ----------------ELLRIL--LNHPQVEIKHITSRKMDGVNITKVHPNLKIKNIDNLVFENIDFVFC
ARGC_BURS3      -----------------------------------------------------------------DIAIL
ARGC_AGRVS      ----------------------------------MADRRDVEL-LSIPQEQRRNAALREDLLNSADIAIL
ARGC_YERPE      ------IVGASGYAGAELTAYLN--RHPHMNITGLASAQSADAGKLLSDLHPQLKGILDLPLQPIDVVFL
ARGC_SHEB5      ----IAIIGASGYTGAQLTALLDKGKPLAD---LYPSYSHIALTLSPLSEDAKAKIV-----AEADAVVL
ARGC_RHOBA      ---RVALVGSTGYTALEVARLL--LTHPGADLVVATSRQDEGKPLSEIHPMLAGRCDVTLQPLDADVIAK
ARGC_RHISN      -------------------------------------------------------ALREDLLNGADIAIL
ARGC_RHIET      ----------------------------------MAGRRDVEL-LSIPEAERRNAAMREDMLNSADIAML
ARGC_RHIEC      ----------------------------------MAGRRDVEL-LSIPEAERRNAAMREDMLNSADIAML
ARGC_PSYA2      -----AIVGGTGYTGIELIRLLSAH--PEVSIDLLTSRSEAGTRADEIFPSLR--GISDIVFSDLDVVFF
ARGC_PYRIL      ---KVCIVGASGFTGGELLRILLQHR--GVEIVCATSRRFKGEYVYRVHPNLRGFTQLKFVEPSIDVALL
ARGC_NITEC      ----------------ELLRILAQH--PKAKLKVITSRQEAGTGVDRGQITLKFSDPLKVDFGKCDVVFF
ARGC_CLONN      ---KVGIIGSTGYIGQQLVWLL--KIHPNVEIVFLSSYNYAGYSFNKGFVETTCINIKEVKLKDVDIVFM
ARGC_SHEWM      ----IAIIGASGYTGAQITSLIDADKNLVIQGLYV-SENSVGKPLSELYPTYSHISLPLSPLSDADGVVL
ARGC_SHEB8      ----IAIIGASGYTGAQLTALLDKGKPLAD---LYPSYSHIALTLSPLSDDAKAKIV-----AEADAVVL
ARGC_SHEB2      ----IAIIGASGYTGAQLTALLDKGKPLAD---LYPSYSHIALTLSPLSDDAKAKIV-----AEADAVVL
ARGC_RHIL3      ----------------------------------MAGRRDVEL-LSIPEAERRNAAMREDMLNGADIAIL
ARGC_HALMA      MTYTASVVGGSGFTGGELLRLLDGH--PEFELAQATSRSKENKTIGHSHPNLRHSDLRFEDLESVDVLFA
ARGC_SYNFM      ---RVAIAGASGYTGFELVRLLD--RHPHAELKMITSRVHRGQRLDKVYPALR----KHCDLAEADLVFT
ARGC_SULDN      ----VGVIGASGYTGLELIKIL--LKHPKFNLSYVANTEG-GATLSELHPSLKCNVVK-VDIDELELVFL
ARGC_SHESR      ----IAIIGASGYTGAQLTALVHAEENSLDKGRALADLYPVHIDLALSPLTEEAKAKI---VAEADAVVL
ARGC_SHESM      ----IAIIGASGYTGAQLTALVHAEENSLDKGRALADLYPVHIDLALSPLTEEAKAKI---VAEADAVVL
ARGC_SHESA      ----IAIIGASGYTGAQLTALVHAEENSLDKGRALADLYPVHIDLALSPLTEEAKAKI---VAEADAVVL
ARGC_PYRCJ      ---RVCIVGASGFTGGELLRILLQHS--GVEVVCATSRKFKGEYVYRVHPNL--RGFTQLKFVEADVVFL
ARGC_CELJU      ---KAGIVGGTGYTGVELLRLL--AKHPQVEVSVITSRAEAGVKVADLFPNLRGHVDLAFTEPDVDVVFF
ARGC_BACAM      ---KIGFVGATGYGGTELVRILSHH--PHAEECILYQTSGEGNVYSEGYPHLTGLALKPIDMNEIDIMFL
ARGC_YERPS      ------IVGASGYAGAELTAYLN--RHPHMNITGLASAQSADAGKLLSELHPQLKGILDLPLKGIDVVFL
ARGC_SHEB9      ----IAIIGASGYTGAQLTALLDKGKPLAD---LYPSYSHIALTLSPLSDDAKSKIV-----AEADAVVL
ARGC_RALSO      MAFKVFVDGQEGTTGLRLLDYLSQRD--DIELLRIAEDRR-------KDPAERAKFL-----NAADVAFL
ARGC_ORYSJ      ---RIAVLGASGYTGAEIVRLL--ANHPQFRIKVMTADRKAGEQFGSVFPHLNLVAVKDADFSNVDAVFC
ARGC_SINMW      --------------------------------------------------------------NSADIAIL
ARGC_ALTMD      --YSVSIIGASGYTGAQLVQLVSENSNDANKSIAELHGNLAHVNATLSDTALSEMA------NGVDFIFL
ARGC2_ANASP     ---KIFIDGEAGTTGLQIYSRLNERD-DIELVSIAASKRK--------DADERAKLL-----NSVDVAIL
ARGC_UNCMA      ---------------------------PLAEVTVVTSRKQAGQPVDTVHPNLK--SLTDLKFEDCDVVFT
ARGC_CLOBB      ---KVGIIGATGYVGVELLRLL--LNHSQIEIGAISSVSFDGQELNLGRTNLICTNMEVIEKSDVIFTAL
ARGC_NATPD      -GYTASVVGASGFTGGEVLRLLSGH--PEMAVTQATSR-------SYENKTMDLRFSSPEELESVDVLFA
ARGC_EHRCJ      ----------------------------------------------------------------------
ARGC_CLOK5      ---QVGVIGGTGYVGAELIRLLSNHN--KIKISGISSTSYEGKSINYDLKELVCEKDDEV-IKRSDLIFL
ARGC_CLOK1      ---QVGVIGGTGYVGAELIRLLSNHN--KIKISGISSTSYEGKSINYDLKELVCEKDDEV-IKRSDLIFL
ARGC_ANAVT      ---KIFIDGEAGTTGLQIYSRLNERD-DIELVSIAASKRK--------DADERAKLL-----NSVDVAIL
ARGC2_PSEPK     -------------------------------------------EAERKDPQRRCEAINSADIALLCLPDD
ARGC_STAS1      ---EVGIVGGSGYGAIELIRLLIQHPNVNIKYIFSHSKQDQPIQLTYHYETLNSEGIE------CDVIFF
ARGC_SHEFN      ----IAIIGASGYTGAQITSLINDCNFSVQGLYVSENSLDKGRKLADLYPTYSHMAYTLSPLSDADAVVL
ARGC_SHEDO      --------------------------------------------------------------AESDAVVL
ARGC_HALOH      ---RVSIIGATGYTGIELVRLL--ANHPEVELSSLVSRNASNKPLSIGRIDLK---FSEYDCQAIDIVFT
ARGC_EHRCR      --------------------------------------------ISQDDISVNISSFDDIDLSKVDVVFL
ARGC_ARATH      ---RIGLLGASGYTGAEIVRLLANH--PHFQVTLMTADRKAGQSMESVFPHLRAQKLKDADFSTVDAVFC
ARGC2_DEIRA     ------------------------------------------------DSAARAELLNAADVSILCLHDD
ARGC_RHIME      --------------------------------------------------------------NSADIAIL
ARGC_PHOLL      ------VVGASGYTGAELAAYL--HRHPHMNLIRLVSAQSVDADKCFSDLHPQYKGIVDLPLQPIDVVFL
ARGC_OCEIH      ----------------------------------------------------------------------
ARGC_JANSC      MTKKIAILGASGYTGAELCRLI--AGHPDMTIVALTGDRKAGQPMASVYPFLRGAGLEDVDFSGVDLAFC
ARGC_BACSK      ---EVGIIGATGYSGLELIRLLKNHPQVTNIMLYSSSQSGETINRLYPHQNEQWKPLKEIDLNEIDVMFL
ARGC_AERS4      --------------------------------------------------------------TQADLVLL


                         .         .         *         .         .         .         .:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
DHAS_AQUAE      SAGGSTSKEWAPKFAKDGVVVIDNSSAWRMDPDVPLVVPEVNPEDVKDFKKKGIIANPNCSTIQMVVALK
DHAS_RICFE      CAGSEVSKEFVPKATASSCVVIDKSSLFRVDNQVPLIVPEVNLSTLTEFNTKNIIANPNCIVIPLAVALK
DHAS_RICCN      CAGSEVSKEFIPKATASNCVVIDKSSLFRVDNQVPLIVPEVNLSTLKEFNTKNIIANPNCIVIPLAVALK
DHAS_RICTY      CAGSNVSKEFIPKATADNCIVIDKTSLFRTDNQVPLIVPEANLSTLKEFNTKNIIANPNCIVIPLVVALK
DHAS_RICPR      CAGSNVSKEFIPKATSCNCIVIDKTSLFRADNQVPLIVPEVNLSTLKEFNTKNIIANPNCXXXXXXXXXX
DHAS_VIBCH      SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
DHAS_LEGPN      SAGGAVSKEYAPKAVAAGCVVVDNTSCFRYEDDIPLVVPGSESSSNRDYTKRGIIANPNCSTIQMVVALK
DHAS_SHEVI      SAGGDVSEKWAPIAAENGCVVIDNTSQFRYDNDVPLVIPEVNPEAIADFRNRNIIANPNCSTIQMLVALK
DHAS_RICBR      SAGSEVSKKFIPIAIVKNCMVIDKSSFFRLSEDIPLIVPEANLSTLKDFAIKNIISNPNCIAIPLAVVLK
DHAS_SHESP      SAGGDVSEKWAPIAAESGCVVIDNTSHFRYDNDVPLVIPEVNPEAIADFRNRNIIANPNCSTIQMLVALK
DHAS_CAMJE      SAGGSVSEKYAKFAVESGAVVIDNTSHFRMEKDVPLVVPECNPEDIKDWKKTGIIANPNCSTIQMVQVLK
DHAS_VIBMI      SAGGELSAHWAPIRAEAGVVVIDNTSHFRYDYDIPLVIPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
DHAS_STRAK      SAGGATSKALAEKVASQGAVVIDNSSAWRKHPEVPLVVSEVNPHAIKD-RPKGIIANPNCTTMAAMPVLR
DHAS_PROMA      SAGGSISRKWRKVINSAGAVIVDNSNAYRMEPDVPLVVPEVNPSQV--FTHKGLIANPNCTTILLALVLA
DHAS_STRMU      SAGGSVSAKFAPYAVKAGAVVVDNTSHFRQNPDVPLVVPEVNAYAMD--AHNGIIACPNCSTIQMMVALE
DHAS_BACSU      SAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADL--HEHNGIIANPNCSTIQMVAALE
DHAS_MYCTU      SAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRRPKGIIANPNCTTMAAMPVLK
DHAS_MYCBO      SAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRRPKGIIANPNCTTMAAMPVLK
DHAS_HELPJ      SAGGSVSEEFAIS-ASKTALVIDNTSFFRLNKDVPLVVPEINAQEIFN-APLNIIANPNCSTIQMTQILN
DHAS_HELPY      SAGGSVSEEFATS-ASKTALVVDNTSFFRLNKDVPLVVPEINAKEIFN-APLNIIANPNCSTIQMTQILN
DHAS_MYCSM      SAGATMSRVQAPRFAEAGVIVVDNSSAFRKDPDVPLVVSEVNFDRDVRGKKKGIIANPNCTTMAAMPVLK
DHAS_CORGL      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSLV-KGIIANPNCTTMAAMPVLK
DHAS_CORML      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSLV-KGIIANPNCTTMAAMPVLK
DHAS_CORFL      SAGGTASKQYAPLFAAAGATVVDNSSAWRKDDEVPLIVSEVNPSDKDSLV-KGIIANPNCTTMAAMPVLK
DHAS_SYNY3      SAGGSTSKRWAEEITKAGAVMVDNSSAFRMVPEVPLVVPEINPEAAQNH--QGIIANPNCTTILMGVAIY
USG_PSEAE       XXXXXXXXXXXXXXXXXGCSVIDLSGA--LEPSVPPVMVSVNAERLASQAAPFLLSSPCAVAAELCEVLA
USG_AZOVI       AAGQAVTRQYASQARAAGCMLVDLSGALPLQ-QAPRVVAEVNPQVLEKLEAPCQVTSPASQXXXXXXXXX
USG_ECOLI       VAGKEATAAWVEEATNSGCLVIDSSGLFAXXXXXXXXXXXXXXFVLTDYRNRNVIAVPDSLTSQLLAALK
DHAS_ARCFU      ALPSDIAREVEPKFAEAGFVVASNASAYRMAEDVPLVIPEVNPLGLIEVQKKNIVTNPNCTTIVLVLSLK
DHAS_METJA      ALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLVIPEVNADHLELIEIQRIITNPNCSTICAVITLK
DHAS_METTH      ALPADVARKVEPKF-AEKYIVASNASAMRMEPDVPLVIPEVNPEFLDLIEVQQIVTNPNCSTIALTLTLK
DHAS_LEPIN      GLDSNVAGEVEKNYANAGIHIISNSKNHRMDPTVPILSAEVNSSLTSQKTKGKIITNSNCTIMGVTISLK
DHAS_LEPIC      GLDSNVAGEVEKNYANAGIHIISNSKNHRMDPTVPILSAEVNSSLTSQKTKGKIITNSNCTIMGVTISLK
DHAS_YEAST      DAAGAIEKEFMEA----GIAIVSNAKNYRREQDVPLIVPVVNTAKAQGKPRPGIICISNCSTAGLVAPLK
DHAS_PSEAE      CQGGDYTSEVFPKLREAGGYWIDAASSLRMEDDAVIVLDPVNRKVALDAGTRNYIGG-NCTVSLMLMALG
DHAS_HAEIN      CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
DHAS_BUCAI      CQGGSYTKEIYPTLRKNGGYWIDAASNLRMKNDSVIILDPVNYNVIEDSINKGIFVGGNCTISLMLMSLG
DHAS_SHIFL      CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
DHAS_ECOLI      CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
DHAS_ECOL6      CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
DHAS_ECO57      CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
DHAS_SALTY      CQGGDYTNEIYPKLRESGGYWIDAASTLRMKDDAIIILDPVNQDVITDGLNNGVFVGGNCTVSLMLMSLG
DHAS_SALTI      CQGGDYTNEIYPKLRESGGYWIDAASTLRMKDDAIIILDPVNQDVITDGLNNGVFVGGNCTVSLMLMSLG
DHAS_ACTPL      CQGGDYTNEVYPKLKATGGYWIDAASALRMEKDAIIVLDPVNQHVISEGLKNGIFVGGNCTVSLMLMAIG
DHAS_NEIMB      CQGGDYTKSVFQALRDSGGYWIDAASSLRMKDDAIIVLDPVNRDVLDNGLKKNYIGG-NCTVSLMLMALG
DHAS_NEIMA      CQGGDYTKSVFQPLRDSGGYWVDAASSLRMKDDAIIVLDPVNRNVIDNGLKKNYIGG-NCTVSLMLMALG
DHAS_BORPE      AQGGDYTSEVYPKLRGAGGIWIDAASTLRMADDAIIVLDPVNRPVIDAALKRGVFVGGNCTVSCMLMGLA
DHAS_BUCBP      ---------------------IDAASVLRMNQDTVIILDPVNSSIDSGF---KTFVGGNCTVXXXXXXXX
DHAS_BUCAP      CQGSSYTEKIYPKLRNNNGYWIDAASTLRMEKDATIILDPVNLNVINNALDKGIFVGGNCTVSLMLMALG
DHAS_SCHPO      GLDADFAGEIEKSFRDANLVIVSNAKNYRREXDVIKYQRQENK-----LDRGCIITNSNCSTAAVVVPLK
ARGC_ARCFU      AVPHGEAMKYVPQLLDSGIKVVDISADYRLDKETYERVHEGYVEAVYGLTKANLVANPGCYPTGTILAAS
USG_HAEIN       ------------QAAEQGCIVIDMLGVCSALSDVPVVVPTVNESQLLELRQRNIVSLPDPQVSQLALTLA
DHAS_AZOVI      CQGGDYTSEVFPKLRDAGGYWIDAASSLRMADDAVIVLDPVNRRVIAGV--KNYIGG-NCT----VSXXX
ARGC_MORAB      ATAHEVSHDIAAEFLAQGTVVFDLSGAFRVDKELKSAVYGLAEWASADIAEANLIAVPGCYPTASLSALK
ARGC_KOSOT      ALPAGVSYEIARKL--KDVRIIDLGADFRFDKKLPDYDPTERVYGLTELYREKIVGNPGCYPTSVLLATA
ARGC_GEOTN      ATPPGVSGEWAPALVDRGVKVIDLSGDFRLKDGAVYERWYGREAAPAAYLKRELLSNPGCYPTATLLGLA
ARGC_GEOKA      ATPPGVSGEWAPALVDRGVKVIDLSGDFRLKDGAEAAPAEYLQKAVYGLTEWNLLSNPGCYPTATLLGLA
ARGC_BACHD      ATPPGVSGELTPDLVKLGLKVIDLSGDLRIEPDVYEAWYKRQAAAVYGLTEAQIIANPGCYPTAVLLGLA
ARGC_BACSU      AAPPGVSSELTPKLADAGITVIDLSGDLRIKEPAETAAPKVIQEAVYGLAELNLIANPGCFPTAVLLGLA
ARGC_NEIMB      ATPNGIAMKDAPRLIEQGVRVIDLSADFRI-RDIPTAAPDLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_NEIMA      ATPNGIAMKDAPRLIEQGVRVIDLSADFRI-RDIPTAAPDLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_NEIM0      ATPNGIAMKDAPRLIEQGVRVIDLSADFRI-RDIPTAAPDLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_METST      ALPHGVSMKLVPEYLDNGARVIDLSGDFRFSPDLKAVLPEINRDKIKDAT---LIANPGCFPTGAILSSL
ARGC_LISMC      ATPSGIAKDIALPYVDAGLNVIDLSGDFRLKPIEYIAKAEYGLAEFRDKKEARFIANPGCYATATLLGIA
ARGC_METKA      AVPHTAAMELVPDLLEGGAVVIDLSADFRFDDGVEHAAPELNDEAVYGLPRTDLIANPGCYPTGAILAAA
ARGC_LISIN      ATPSGIAKDVAPYIDA-GLNVIDLSGDFRLKPEDYLAKAEYGLAEFRDNELATFIANPGCYATATLLGLA
ARGC_LISMF      ATPSGIAKDIALPYVDAGLNVIDLSGDFRLKPIEYIAKAEYGLAEFRDKKEARFIANPGCYATATLLGIA
ARGC_ALKMQ      ALPHGLSQEAVKRMMAKGKRVIDLSADFRIDPKVYEAWYDVRHQALGELGKAQLVANPGCYPTSIALALY
ARGC_NEIMF      ATPNGIAMKDAPRLIEQGVRVIDLSATWEHWYGMPHAAPGLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_MORPR      ATAHEVSHDIAAEFLAQDTVVFDLSGAFRVDKELQSAVYGLAEWASADIAEANLIAVPGCYPTASLSALK
ARGC_METTH      ATPHGASMKIVPQLIERGIRVVDLSGDYRFDDESPLELPEIHREEIAS---ADLVANPGCFPTGAILACL
ARGC_STAES      ATPSGVAKDLSKNFVKNNFPVIDLSGDHRLSPDVYLCTVDIQKRFTYGLSRNRFIANPGCYATATELALY
ARGC_SILPO      ALPHKTSQEVIRALPAT-LKIVDLSADFRLDPEAEHVALEQQAEAVYGLTEARLVAGTGCNAATGQYVLR
ARGC_STAEQ      ATPSGVAKDLSKNFVKNNFPVIDLSGDHRLSPDVYLCTVDIQKRFTYGLSRNRFIANPGCYATATELALY
ARGC_MAGSM      ALPHVTSMEVVPELLQRGAKVVDLSADFRLKSGTQHLAPELLPQAAYGLPEANLVANPGCYPTSVQLPLF
ARGC_BACCN      ATPAGVSVKLTPLLLKAGLKVIDLSGDFRMNPSIPAASEEFLQQAVYGLSQAKLVANPGCFATATLLAIA
ARGC_NEIG2      ATPNGIAMKDAPRLIEQGVRVIDLSADFRI-RDIPTAAPGLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_NEIG1      ATPNGIAMKDAPRLLEQGVRVIDLSADFRI-RDIPTAAPGLVSQAVYGLSELNLVANPGCYPTCVSLPLV
ARGC_HELMI      ALPHGLSVPWVAECVRKGKKVVDLGADFRLRRHVTHEAPELLAEAVYGIQKARIIANPGCYPTASLLSIA
ARGC_BACC4      ATPAGVSAELTPKLVAEGLKVIDLSGDFRMDPSSPAAKEEILRKAVYGLSKANLIANPGCFXXXXXXXXX
ARGC_SILST      ALPHKTSQEVIAKLPGD-LKIVDLSADFRLDPEAPHAALEQQQEAVYGLTEARLVAGTGCNAATGQFALR
ARGC_PELPD      ALPHKAAMAVMPTFMELGKTVIDLSADYRLDAEVPHLNPELLKSAVYGLPEKKLVANPGCYPTSITLGLA
ARGC_BACST      ATPPGVSGEWAPALVDRGVKVIDLSGDFRLKDGAVYAQWYGREAAPSGLTEWNLLSNPGCYPTATLLGLA
ARGC_CHLTE      ALPHGEALQLVPGIVAAGKKVIDLSGDFRLEDVLQYGMPELFRDEIAGSTA---ISNPGCYATSIILGLA
ARGC_DEHE1      ALPHKEGASLVPDLLSKGMRVIDISADFRL-KDPPLYCPELLAEAVYGIASARLVANPGCYPTSAILGLA
ARGC_THESQ      ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
ARGC_PYRHO      AVPHGVSMKLINEF-LGSAKIIDLSADFRVRKELPELIPEIHRKE---IKKAELVANPGCNATAVILALY
ARGC_THEP1      ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
ARGC_THEMA      ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
ARGC_LISW6      ATPSGISKDIAPYIDA-GLNVIDLSGDFRLEKSAPLMRAEYGLAEFRENKESTFIANPGCYATATLLGLA
ARGC_NITEU      ATPNGIAMQQAKALLDSGIKVIDDVAEWEKWYGMTHAAPELVAEAVYGLPEVNLIANPGCYPTAVQLGFI
ARGC_AGRRK      CLPDDASKEAVKMVSANNNVVIDTSTAFRVHPDWAYGFAEMDKDQGGKITSARFVANPGCYPTGAVALIR
ARGC_CLOB8      ALPHGLSEDIAKKALDNKKVCIDMGADFRLSSEKKFTQPEIHTESVYGLPELNLIANPGCYPTTIELGLM
ARGC_CALMQ      SESDVVSVKWVPKLVESGLLAIDLSADFRLNPDQPHPYPDLLKAAAYGLPETKVIAVPGCMATASIVSLA
ARGC_XYLFT      PNGNAAPYVHAIDATAPPTLIIDLSADTRFDPDWYYGLPELTRHT---YTGQKRISNPGCYATAMQLAIA
ARGC_XYLFA      PNGNAAPYVHAIDATAPPTLIIDLSADTRFDPDWYYGLPELTRHT---YTGQKRISNPGCYATAMQLAIA
ARGC_XYLF2      PNGNAAPYVHAIDATAPPTLIIDLSADTRFDPDWYYGLPELTRHT---YTGQKRISNPGCYATAMQLAIA
ARGC_PELTS      PHGHAMPA--AREAARRGRKLIDLGADFRLKDRVEHTARELLAGAVYGLPEVNLVANPGCYPTSAILALA
ARGC_METTP      AVPHGTAMDWVPELLDNGAKVIDLSADYRLPVDVPELHPEVAGASLVG--------NPGCYPTGATLAIA
ARGC_GEOSM      ALPHKAAMEVVPTFMKMGKDVIDLSADYRIDADTPHLNPELLPEAVYGIAEASLIANPGCYPTSVILGLA
ARGC_GEOSL      ALPHKAAMEVVPTFLKLGKRVIDLSADYRFNPKAVYGLPEVRRAAVKG---AKLVANPGCYPTSVILGLQ
ARGC_DESAP      ALPHGHSMDVAREVLSRGKKLVDLGADFRLLPRAVYGLPEINREALRG---ADLVANPGCYPTASILGLA
ARGC_CLOTH      ALPHGISKEVIPKLVEKGKRIVDHSGDFRYKSNATHGMPHLLKLSAYGLPEKNIIGNPGCYPTCSILALA
ARG56_DICDI     DHGALPDKISSPYISSESPVLVDLSSDHRFNEKWTYGQPETNRAA---IKESKLIANPGCYATGMFLTLK
ARGC_PSYWF      ATPHGVAMQQAEALVAAGVKVIDLAADFRLQPDLAYGLPEINREA---IKSASVIGNPGCYPTTAILGLK
ARGC_METVS      ATPHGASLKIVPILHEMGINVIDLSGDYRFE-DLEMYLPEIYREK---IKKANVIANPGCYPTGAILSMA
ARGC_GEOBB      ALPHKAAMEVVPTFMKMGKDVIDLSADYRIDADTPHLNPELLPEAVYGIAEASLIANPGCYPTSVILGLA
ARGC_STAAR      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSLDNNGTKLISNPGCFPTATLLALH
ARGC_STAAN      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAAM      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAA1      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_LISMH      ATPSGIAKDIALPYVDAGLNVIDLSGDFRLKPTEYIAKAEYGLAEFREKKETTFIANPGCYXXXXXXXXX
ARGC_HALWD      ATPHGVSMQQIESFTAAADTVVDLSADFRLNEDAEYALPEINRSNLVG---ASLIASGGCNATATILGLK
ARGC_SALTY      ATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDGFTHQYPELLEQAVYGLAEANLIAVPGCYPTAAQLSLK
ARGC_SALTI      ATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDGFTHQYPELLEQAVYGLAEANLIAVPGCYPTAAQLSLK
ARGC_SALPA      ATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDGFTHQYPELLEQAVYGLAEANLIAVPGCYPTAAQLSLK
ARGC_PYRFU      VPHGTSMKIIEEFLGS--AKIIDMSADFRIKKELPHEKPELIDRFTYGLPKAELVANPGCNATATILGLY
ARGC_GEOSF      ALPHKAAMEVVPTFLKLGKRVVDLSADYRLHDAEPHMNPELLKEAIYGIAEADLVANPGCYPTSIILGLA
ARGC_OCHA4      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_METMP      PHGASMA--IVPTLHEKGINVIDLSGDYRFE-DIDMYLPELHREK---IKKSKTIANPGCYPTGAILSMA
ARGC_JANMA      ATPHGVAMAQAPELLAAGVKVIDLAADFRLQDKIPHSCPELLKEAAYGLVELNIVGNPGCYPTTMQLGLA
ARGC_HERAR      ATPHGVAMAQAPELLAAGVKVIDLAADFRLQDKMPHSCPELLKEAAYGLVELNIVGNPGCYPTTMQLGLA
ARGC_GEOUR      ALPHKAAMEVVPTFLKLGKRVVDLSADYRLEPHMPTLLPELRREKIAG---ADLVANPGCYPTSVILGLA
ARG56_CANAL     ALPNGVCKPFVDTIDLPNSKIVDLSADYRFDTEWTYGLPELNDRKTIAQAKK--ISNPGCYATAAQVAIA
ARGC_METJA      ATPHGASMDIVPDFIERGMKVIDLSGDYRFEPDVKIALPELHREE---IKEAQLVANPGCFPTGAILAVA
ARGC_EXIS2      ATPSGISTKYLKQLDDWKGTVIDLSGDLRLEKSLESVDTVLQKKATYGLTESRLIANPGCYATAVXXXXX
ARGC_ECOL6      ATAHEVSHDLAPQFLEAGCVVFDLSGAFRVN-DVAFYYPELLEQAAYGLAEANLIAVPGCYPTAAQLALK
ARGC_BACLD      AAPPGISSRLTPQFDAYDIPIIDLSGDLRINPSVREAAPEVLQKAVYGLSELNYIANPGCFPTAVLLGLA
ARGC_SULSO      ALPHGVSLNYAPKLLDLGLTVVDLSADFRLNPELYKIYPDLLDKAVYGLPEKNLIASPGCNATATILALA
ARGC_RHOCA      ALPHATSQAVIAEL-PRDLKVVDLSADFRLRDAAPHAAMDLQAEAVYGLTEARLCAGTGCNAAAGQYAIR
ARGC_PYRKO      AVPHGTSMEIDDYLGS--AKIIDMSADFRLREDLPELIEELPELHRKEIRKAELVANPGCNATATILALY
ARGC_LISMO      ATPSGIAKDIALPYVDAGLNVIDLSGDFRLK-DRQLYEKWYGKSAAAEFREKKFIANPGCYXXXXXXXXX
ARGC_BRUSU      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUSI      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELTKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUMB      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUC2      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUAB      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUA2      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BRUA1      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BACWK      TPAG-VSAELTPKLLAVGLKVIDLSGDFRMDPSSPAAQEELLRKAVYGLSEANLIANPGCFXXXXXXXXX
ARGC_BACCQ      ATPAGVSAELTPKLLAVGLKVIDLSGDFRMDPFIAAAKEEILSKAVYGLSEANLIANPGC----------
ARGC_BACC7      ATPAGVSAELTPKLLAVGLKVIDLSGDFRMDPFIAAAKEEILSKAVYGLSEANLIANPGC----------
ARGC_BACC1      ATPAGVSAELTPKLLAVGLKVIDLSGDFRMDPFIAAAKEEILSKAVYGLSEANLIANPGC----------
ARGC_STRSV      ATSSGVAKDLSKDFVEAGFPVIDLSKKWYQKEPAEDYVQKAFIYGLSEFTDERFIANPGCYATATELALI
ARGC_STRMU      ATPSGVAKELAKDFIAADFPVIDISGDHRLPAAIYEKWYKKAAAEQASLDKKKFIANPGCYATATELALL
ARGC_STAAW      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAAS      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAAC      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAA8      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_STAA3      ATPAPVSKTCIPPLVEKGIHVIDLSGAFRIQDDLNHAIYSISEWQSFDNNGTKLISNPGCFPTATLLALH
ARGC_PELCD      KSDHKAAMAVVPAFLHAGKKVVDLSADYRLDVDVKHTSPELLDEAVYGLPEARLVANPGCYPTSIALGLA
ARGC_NITOC      ATPHGVAMDMVPALLAQNTRVIDLSADFRLDPTIPHAAPHLLAEAVYGLPEINLIACPGCYPTAVQLGFL
ARGC_METB6      AVPHTAAMTIAGKLLSRGIKVVDLSADYRLPKDAPYGIPELHRKEC---INAKFVANPGCFPTGATLAAA
ARGC_IGNH4      ALPHKVSLHYVPKALEVGYKVVDLSADYRLKPDLVYGLPELYGDKIRG---AQLVANPGCATSSILAVLP
ARGC_DESPS      AVPHKTAMNIVPQLLAAGKKVIDLSADFRLNSAAVYSAKEFLSQAVYGLAKTQLLANPGCYPTSIILGMA
ARGC_BACC3      TPAG-VSAELTPKLLAVGLKVIDLSGDFRMKD--PFIYEQWYKRAAAEIQKANLIANPGCFATAALLAIL
ARGC_BACAN      TPAG-VSAELTPKLLAVGLKVIDLSGDFRMKD--PFIYEQWYKRAAAEIQKANLIANPGCFATAALLAIL
ARGC_BACAC      TPAG-VSAELTPKLLAVGLKVIDLSGDFRMKD--PFIYEQWYKRAAAEIQKANLIANPGCFATAALLAIL
ARGC_BACAA      TPAG-VSAELTPKLLAVGLKVIDLSGDFRMKD--PFIYEQWYKRAAAEIQKANLIANPGCFATAALLAIL
ARGC_SHIFL      ATAHEVSHDLAPQFLEAGCVVFDLSGAFRVN-DATFYYPELLEQAAYGLAEANLIAVPGCYPTAAQLALK
ARGC_PYRAB      AVPHGTSMRIIGEF-LGSAKIIDLSADFRVSKDLPELIPELHRKE---IKRAELVANPGCNATAVILALY
ARGC_DICTD      ALGGFLSKGEIPEIDMSADFRFKNPGEYERVYGIKHNMPEILEKVVYGLPEAQYIANPGCYPTASLLGLF
ARGC_ACIF5      ATPHGVAMDSAPKLLAEGVRIIDLGADFRL-PDAEVFAPEVLGEACYGISEARLIANPGCYPTAVIXXXX
ARGC_ACIF2      ATPHGVAMDSAPKLLAEGVRIIDLGADFRL-PDAEVFAPEVLGEACYGISEARLIANPGCYPTAVIXXXX
ARGC_ECOLI      ATAHEVSHDLAPQFLEAGCVVFDLSGAFRVN-DATFYYPELLEQAAYGLAEANLIAVPGCYPTAAQLALK
ARGC_BRUO2      CLPDDASKEAVSLLGHNSTRIIDTSTAHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_THET2      ALPNGLSMEIAPEALKAGKRVVDLSGDFRLPPEVPHKSPDLYREAVYGLPEARLVANPGCYVXXXXXXXX
ARGC_SULTO      GLPHKVSLEYVPKILEMGIQVIDLSADFRLDPTLYKIYPDLLKKAVYGLPEKNLIASPGCNATATILAGA
ARGC_ECO57      ATAHEVSHDLAPQFLDAGCVVFDLSGAFRVN-DATFYYPELLEQAAYGLAEANLIAVPGCYPTAAQLALK
ARGC_BRUME      CLPDDASKEAVSLLGHNSTRIIDTSTTHRVHPDWAYGFAELAKGQRERIAEARLVANPGCYPTGAIALVR
ARGC_BACA2      AAPPGVSGEWSPKLAEAGIPVIDLSEKWYKRKAAPKGTIQSAVYGLAELQKEEIIANPGCFPTAVLLGLA
ARG56_SCHPO     ALPNGVCKPYVDALSANGSVIVDLSADYRFEPSWQYGLPELNDREALRNSKR--ISNPGCYATGSQVGLT
ARGC_METM7      PHGASMA--IVPILHEKGINIIDLSGDYRFE-DIEMYLPELHREK---IKKSKTIANPGCYPTGAILSMA
ARGC_RHILW      CLPDDASKEAVQMVSANNNVVIDTSTAFRVNPGWAYGFAEMDGAQADRIKAARFVANPGCYPTGAIGLIR
ARGC_GEOMG      ALPHKAAMEVVPTFLELGKRVVDLSADYRFDPAVPHMNPENLKEAVYGLPEIRLVGNPGCYPTSVILGLM
ARG56_NEUCR     ALPNGVCKPFVEAVSGHKSVIIDLSADYRFDNKWTYGLPEL--VQRSNIIQATQIANPGCYATAAQLGIS
ARGC_SHEON      ATEHSVSLHLAAWFYSQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_SHELP      ATDHGVSLHLAAWFYQAGLAVFDLSGAYRFADSEQYIYPEVLAEAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_RHIE6      CLPDDASKEAVQMVSANNNVVIDTSTAFRVNPGWAYGFAEMDGAQADKIKAARFVANPGCYPTGAIGLIR
ARGC_PYRAE      ALPHGESVKWVPKLYESGVAVFDLSADFRLDPNAPHPYPDLLQKAVYGLVGAKLVAVPGCMATASILMLA
ARGC_PSYCK      ATPHGVAMKQAEALTQAGVKVIDLAADFRLQPDLLKTLPEVNRAKIA---EALVVGNPGCYPTTAILGLK
ARGC_PELPB      PHGEAL--QLVPPLVKAGKTVIDLSGDFRLKSTVEVMTYGMSELFREEIIKAKAISNPGCFATSIILGVA
ARGC_METM5      PHGASMA--IVPTLHEKGINIIDLSGDYRFE-DIEMYLPELHREK---IKKSKTIANPGCYPTGAILSMA
ARGC_BURCM      CLPDAAAREAVGFIRNPAVRVIDASSAHRTEPDWVYGFPEMVDGHAQTIAHARRVTNPGCYPTGAVGLLR
ARGC_AGRT5      CLPDDASKEAVSMVAGNNNVIIDTSTAYRVHQDWAYGFAEMDRDQGEKVRSARFVANPGCYPTGAIGLIR
ARGC_METM6      PHGASMA--IVPILHEKGINVIDLSGDYRFE-DIEMYLPELHREK---IKKSKTIANPGCYPTGAILSMA
ARGC_META3      ATPHGASMKIVPELYETGSKIIDLSGDYRFEDELPAVLPELHRNE---IKKAQLVANPGCFPTGSILALA
ARGC_BURS3      CLPDAAAREAVGFIRNPAVRVIDASSAHRTQPDWVYGFPEMANGHAQTIAHARRVTNPGCYPTGAIALLR
ARGC_AGRVS      CLPDDASKEAVSMLAGNNNVIIDTSTAFRVAQDWTYGFAEMDKAQGDKIRSARCVANPGCYPTGAIALIR
ARGC_YERPE      ATAHEVSHDLAPQFLAAGCVVFDLSGAFRVHPDLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQLALK
ARGC_SHEB5      ATEHSVSLHLAAWFYSQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_RHOBA      SADVAMSAESVKQLAEAGMRVIDFSADFRLSSDVVYGMPEFFADE---IRSADIVANPGCYPTSAIMPLA
ARGC_RHISN      CLPDDASREAVAMVAGNNRVIIDTSTAHRVAPDWAYGFAEMDKAQPAKIRDARHVSNPGCYPTGAIGVIR
ARGC_RHIET      CLPDDASKEAVQMVSANNNVVIDTSTAFRVNPGWAYGFAEMDKEQAEKIASARFVSNPGCYPTGAIGLIR
ARGC_RHIEC      CLPDDASKEAVQMVSANNNVVIDTSTAFRVNPGWAYGFAEMDKEQAEKIASARFVSNPGCYPTGAIGLIR
ARGC_PSYA2      ATPHGVAMQQAEALTEAGVKVIDLAADFRLQSLTDFACPELLKTAVYGLPEINVVGNPGCYPTTAILGLK
ARGC_PYRIL      ALPHGESVKWVPKLYESGVAVFDLSADFRLDPNAPHPYPDLLQKAVYGLVGAKLVAVPGCMATASILMLA
ARGC_NITEC      ATPNGIAMQQVSALLGSGIKVIDLSADFRIKDGMSHTAPELVAEAVYGLPEVNLIANPGCYPTAVQLGFI
ARGC_CLONN      ALPHGKSFEMVKYSLNLGIKVIDLSGDFRLKDSIEHPLKEVLKYSVYGIKKASLICNPGCYATASILALA
ARGC_SHEWM      ATDHAVSLHLAAWFFEQGLTVFDLSGAYRFEHDYPQVLSHAVYGLAADIADSKMIAVPGCYPTASLTALK
ARGC_SHEB8      ATEHSVSLHLAAWFYSQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_SHEB2      ATEHSVSLHLAAWFYSQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_RHIL3      CLPDDASKEAVQMVSANNNVVIDTSTAFRVNPGWAYGFAEMDKQQADKIAAARFVANPGCYPTGAIGLIR
ARGC_HALMA      ATPHGVSMEQIDAFQEAAGTVVDLSADFRLESEAEYALPELNRDNLEG---ADLIASGGCNATATILGLL
ARGC_SYNFM      ALPHRAAMDMIPDLLKGGAKVVDLSADYRLDAAVPHKTPELLKEAVYGLPEARLVGNPGCYPTSVILAAA
ARGC_SULDN      AVPHQAAMAYVKPLIEKGLKVVDLSADYRLSKDIEFYCPHTDVENAQKIKKAKLVANPGCFPTSAILGLL
ARGC_SHESR      ATEHSVSLHLAAWFYNQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_SHESM      ATEHSVSLHLAAWFYNQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_SHESA      ATEHSVSLHLAAWFYNQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_PYRCJ      ALPHGESVKWVPQLYESGVAVFDLSADFRLDPNAPHPYPDLLAKAVYGLVGARLVAVPGCMATASILMLA
ARGC_CELJU      ATPHGVAQNMMPVLMKTGTRIVDLSADFRI-RDVPLWAPDLVSQAVYGLPEVNLVACPGCYPTATQLGFL
ARGC_BACAM      AAPPGVSSELTPKLADAWVTVIDLSEKWYKRTAAPKAVIQEAVYGLAAIQQAKLIANPGCFPTXXXXXXX
ARGC_YERPS      ATAHEVSHDLAPQFLAAGCVVFDLSGAFRVHPDLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQLALK
ARGC_SHEB9      ATEHSVSLHLAAWFYSQGLAVFDLSGAYRFS-DVAQYYPEVLAKAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_RALSO      CLPDVASREAVSLVDNPNTCIIDASTAFRTSDDWAYGLPELAPGQRERLRNSKRIAVPGCHASAFVLLMR
ARGC_ORYSJ      CLPHGTTQEIIKGL-PQELKIVDLSADFRL-RDINEYAPELQQEAVYGLTEARLVANPGCYPTSIQLPLV
ARGC_SINMW      CLPDDASREAVAMVAGNNRVIIDTSTAHRVAPDWAYGFAEMDKAQPRKIRDARHVANPGCYPTGAIALIR
ARGC_ALTMD      ATPHEASHDWMPILSSGKAKVLDLSGAFRIKDTAPHTQTQSLAQAVYGLAEADVIAVPGCYPTASLSALK
ARGC2_ANASP     CLPDDAAREAVSLVNSSQVKILDASTAYRTAQGWVYGFPEMNPGQREKIANAQFVSNPGCYPTGFLACVR
ARGC_UNCMA      AVPHGAAMAVVPELLKYGLRVIDLSADYRLDPGLPELHPEVKDAT--------LIANPGCYPTGANLACA
ARGC_CLOBB      PHG--LSEDIAKKIIENNKICIDMGADFRLSNEEEFSQPELHKQSTYGLPELNLIANPGCYPTSIELALA
ARGC_NATPD      CTPHGVSMEHIDAFQDAADTVVDLSADFRLDIEAEYALPELNRENLPG---ADIVASGGCNATAAIMGLK
ARGC_EHRCJ      --------------------------------------------------KSSFIACPGCTSVXXXXXXX
ARGC_CLOK5      ALPSGVSEPIVEKAVAKDKICIDNESSYKKWYGKNFITPKLHESSVYGIKKSRVIGNPGCYATSVQIGVL
ARGC_CLOK1      ALPSGVSEPIVEKAVAKDKICIDNESSYKKWYGKNFITPKLHESSVYGIKKSRVIGNPGCYATSVQIGVL
ARGC_ANAVT      CLPDDAAREAVSLVHSSQVKILDASTAYRTAQGWVYGFPELNPGQREKIANAQFVSNPGCYPTGFLACVR
ARGC2_PSEPK     AAREAVAAIHNPQVR-----VIDASSAHRTTPGWVYGLPELDEQQAERIAQSTRVSNPGCYPTGAIALLH
ARGC_STAS1      ATPSNVSKHIVPQLLSKRIKIIDLSGDFRLTNRATYETYYGETAASQEYLNEQLIANPGCFPTATLLALH
ARGC_SHEFN      ATEHSVSLELAAWFYQQGLAVFDLSGAYRF-ADVAQYPPDVLAQAVYGLAEWNMIAVPGCYPTASLTALK
ARGC_SHEDO      ATEHSVSLELAAWFYQQGLAVFDLSGAYRF-ADVAQYPPDVLAEAAAEIAKTRMIAVPGCYPTASLTALK
ARGC_HALOH      ALPHGISQEIVGELYNCGVKIIDLSGDFRYKDSAIYHYPHLLEKAVYGLVEINLVANPGCYPTASLLGLW
ARGC_EHRCR      CLPHGTSSEVVRKIH-DVVRIIDLSADFRIDAEVSHCCPDLVRDFVYGLTRSRFIACPGCTSVXXXXXXX
ARGC_ARATH      CLPHGTTQEIIKELPT-ALKIVDLSADFRLRNIAPHKAVELQKEVVYGLTKARLVANPGCYPTTIQLPLV
ARGC2_DEIRA     AAREAVSLTTNP-----ASRLLDASTAHRIHPDWVFGFPELSAEQPEKIRQARYVANPGCYSTGAIALLA
ARGC_RHIME      CLPDDASREAVAMVAGNNRVIIDTSTAHRVAPDWAYGFAEMDKAQPQRIRDARHVANPGCYPTGAIALIR
ARGC_PHOLL      ATAHEVSHDIAPLFLAAGCTVFDLSGAYRVQKHTEWLAQAVYGLAAENIKQAQLVAVPGCYPTVSQLCLK
ARGC_OCEIH      ----------------------------------------------------NIISNPGCFPTAALLGLI
ARGC_JANSC      ALPHATSQSVIKALPAD-LKVVDLSADFRLRDPADYAAPALQKQAIYGLTEARLVAGTGCNAATGQFALR
ARGC_BACSK      ATPPGVSAEWSGPLLEAGLSVIDLSGDLRLDRGVPSAKEGLIEQAIYGLSEWNLIANPGCFPTXXXXXXX
ARGC_AERS4      ATAHEVSAELAPKFLAKGLPVFDLSGAFR-------VKDQQFYSSFYGFTHENLIAVPGCYPTASLCALK


                         +         .         .         .         .         *         .:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
DHAS_AQUAE      PIYDKAGIKRVVVSTYQAVSGAGAKAIEDLKNQTKAWCEGKEMPKQKFPHQIAFNALPHIDVFFEDGYTK
DHAS_RICFE      PLDNEIKIKRVVISTYQSVSGAGKAGMDELYDQTKSKYVFGENDPKKFPKQITFNLFPHIGDLNKDGYTS
DHAS_RICCN      PLDNEIKIKRVVISTYQSVSGAGKAGMDELYDQTKSKYVFGENDPKKFPKQIAFNIFPHIGDLNKDGYTS
DHAS_RICTY      PLDNEIKIKRVVISTYQSVSGAGKAGMDELYDQTKSKYVFRENNPQKFPKQIAFNLFPHIGDFNKDGYTT
DHAS_RICPR      XXDNEIKIKRVVISTYQSVSGAGKAGMDELYNQTKSKYVFRENNPKKFPKQIAFNLFPYIGDLNKDGYTS
DHAS_VIBCH      PIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTK
DHAS_LEGPN      PIYDAVGISRINVATYQSVSGTGKKAISELVAQVGDLLNGRPANVQVYPQQIAFNALPHIDQFEDNGYTR
DHAS_SHEVI      PIYDAFGISRINVATYQSVSGSGKEAITELAGQCSKLLHGLPAESKVYPKQIAFNVLPQIDKFMENGYTK
DHAS_RICBR      PLDNEISIKRVVISTYQSVSGAGKAGMDELYDQTKSKYIFEEKSPNIFPKQIAFNLFPHIGDLNKDGYTS
DHAS_SHESP      PIYDAFGISRINVATYQSVSGSGKEAIAELAGQCSKLLQGLPIEPKVYSKQIAFNVLPQIDTFMENGYTK
DHAS_CAMJE      PLNDAFNLKRVDVSTYQAASGAGKEGMQELVEQSFFAFKLDEFEPQTFPYTLALNLIPQIDVFMDNDYTK
DHAS_VIBMI      PIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTK
DHAS_STRAK      PLHDEAGLEALVVATYQAVSGSGLAGVAELHGQTQKVVADAEKLTHDYKRPIAFNVLPLAGSIVDDGLTD
DHAS_PROMA      PLSAQLPIKRVVVSTYQSASGAGARAMNELKQLSQDVLNGNIPKSEILPYSLAFNLFLHNSPLQSNNYCE
DHAS_STRMU      PIRQKWGLSRVIVSTYQAVSGAGQSAINETVREIKEVVNDSGGDKKHYP--IAFNALAQIDVFTDNDYTY
DHAS_BACSU      PIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEEIEPEIMPVKIAFNAIPQIDKFQDNGYTF
DHAS_MYCTU      VLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGGAEQLALEFPAPIAFNVVPLAGSLVDDGETD
DHAS_MYCBO      VLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGGAEQLALEFPAPIAFNVVPLAGSLVDDGETD
DHAS_HELPJ      PLHLHFKIKSVIVSTYQAVSGAGNKGIESLKNELKAIDLNQVLQAGAFAYPIAFNAIAHIDTFKENGYTK
DHAS_HELPY      PLHLHFKIKSVIVSTYQAVSGAGNKGIESLKNELKTIDLNQVLQAGAFAYPIAFNAIAHIDTFKENGYTK
DHAS_MYCSM      PLHEEAGLQRLIVSSYQAVSGSGIAGVEELAGQARPVIDGVELVHNKYVAPIAFNIVPLAGNYVDDGETD
DHAS_CORGL      PLHDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDNVEFVHDPYVSPIAYNVLPFAGNLVDDGETD
DHAS_CORML      PLHDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDNVEFVHDPYVSPIAYNVLPFAGNLVDDGETD
DHAS_CORFL      PLHDAAGLVKLHVSSYQAVSGSGLAGVETLAKQVAAVGDNVEFVHDPYVSPIAYNVLPFAGNLVDDGETD
DHAS_SYNY3      PLHQLQPIKRIVVATYQSASGAGAMAMEEVKHQSRDILEGKIPQAEILPYPLAFNLFPHNSPITANHYCE
USG_PSEAE       PLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGHSA
USG_AZOVI       XXXXXXXWRHLGVTACLPVSSLGREGVAELARQTTELLNGRPPKPRFFDRQIAFNLLGRVGDSDTAGHTG
USG_ECOLI       PLIDQGGLSRISVTSLISASAQGKKAVDALAGQSAKLLNGIPIDEEDFGRQLAFNMLPLLP--DSEGSXX
DHAS_ARCFU      PLMD-LGLRTVRVASMQALSGAGYPGVPSL--------------------AITDNVIPFIK-GEEDKVEE
DHAS_METJA      PIMDKFGLEAVFIATMQAVSGAGYNGVPSM--------------------AILDNLIPFI--------KN
DHAS_METTH      PIYDAYTIKRVYVSTMQAVSGAGYNGVPSM--------------------AILDNLVPFXXXXXXXXXXX
DHAS_LEPIN      PLLDRFGIESVMLFSMQAISGAGYPGVPTM--------------------DILGNVIPHIG-GEEEKAEI
DHAS_LEPIC      PLLDRFGIESVMLFSMQAISGAGYPGVPTM--------------------DILGNVIPHIG-GEEEKAEI
DHAS_YEAST      PLIEKGPIDALTTTTLQAISGAGFSGID-----------------------ILDNIIPYIG--------G
DHAS_PSEAE      GLFDAGLVEWMSAMTYQAASGAGAQNMRELLKQMGAAHASDDLANEHFGAPLGGSLIPWIDKELPNGQSR
DHAS_HAEIN      GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
DHAS_BUCAI      GLFQTELVEWIAVSTYQAASGAGARHMIELLNQMGILYKSVETVNKNFSVPLAASLIPWIDTEMSNGQSR
DHAS_SHIFL      GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_ECOLI      GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_ECOL6      GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_ECO57      GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_SALTY      GLFAHNLVDWVSVATYQAASGGGARHMRELLTQMGQLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_SALTI      GLFAHNLVDWVSVATYQAASGGGARHMRELLTQMGQLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
DHAS_ACTPL      GLFEKDLVEWVSVATYQAASGAGAKNMRELLSQMGELEASAELANPNFGAPLAGSLIPWIDKLLESGQTK
DHAS_NEIMB      GLFQNDLVEWATSMTYQAASGAGAKNMRELISGMGAVHASDFLRSEDYPKALAGSLIPWIDVDLGNGQSK
DHAS_NEIMA      GLFQNDLVEWATSMTYQAASGAGAKNMRELISGMGAIHASDFLRSEDYPKALAGSLIPWIDVDLGNGQSK
DHAS_BORPE      GLFNNDLVEWMSSMTYQAASGGGAQHMRELLTQVLARQQDPSLPQEHFGVPLGGNLIPWIDKDLGDGMSR
DHAS_BUCBP      XXFSEKLIEWITVSTYQAASGSGAKYIEELLMQMGSMYTEASSCSDKFPKKLAGSLIPWIDKKMRNGQSR
DHAS_BUCAP      GLFVNNLIDWVFVSTYQAASGAGSRYVIELLKQMGSLYVTQESRSKNFPLELATSLIPWIDVEMKNGQSR
DHAS_SCHPO      ALQDFGPIAQTNVVSMQAISGAGYPGVSSL--------------------DILDNIVPFIG--------G
ARGC_ARCFU      PLAKLELIERVVFDCKSGITGAGE----------------------------------------------
USG_HAEIN       PILQETNLNQVFVTSLLPASYTDAETVTKLAGQTARLLNGIPLDEEE--TRLAFDV-----------YPY
DHAS_AZOVI      XXXXXXXXXXXXXDERHDLSGAGAQNMRELIRQMGTIQRSAEFPVDHFGVPLAGSLIPYIDKELPNGQSR
ARGC_MORAB      PLAQHGLIAKPIINAVSGVSGAGKASLASAFCEVS--HAPYGVFNHRHQPEISTHLGHEVIFTPHLGSFK
ARGC_KOSOT      PLLKNGSLDEIIVDSKSGVSGAGKESIDYSFSELSGSLK-------------AYNVSKH----------R
ARGC_GEOTN      PLVKERLIEEIIVDAKSGVSGAGKAGLGTHFSEVNE--------NVKIYKVNAHQHIPEIE---------
ARGC_GEOKA      PLVKEGLIQEIIVDAKSGVSGAGKAGLGTHFSEVNE--------NVKIYKVNVHQHIPEIE------QTL
ARGC_BACHD      PLVQQKWIKRIIIDAKSGTSGAGR-------NPSQITHFSEMNENFKIYQVNQHKHTPEIEQQLRN----
ARGC_BACSU      PLAQKKLLDEVIVDAKTGVSGAGRKA---------SMGTHFSELNDNF----------KIYKVNEHQHTP
ARGC_NEIMB      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_NEIMA      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_NEIM0      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_METST      PIVENKLVDRIILDSKSGVSGAG-----------------------------------------------
ARGC_LISMC      PLVKSQLITSIIVDAKSGISGAGKVPS----ASTHFTETNE---NMTLYKMNSHQHIPEIMQQLT-----
ARGC_METKA      PLVEEGLVDVVIFDSKSGTSGAG-----------------------------------------------
ARGC_LISIN      PLVKKQLITSIIVDAKSGISGAGKV-------PSKSTHFTETNENMTLYKMNSHQHIPEIMQQLT-----
ARGC_LISMF      PLVISQLITSIIVDAKSGISGAGKVPS----ASTHFTETNE---NMTLYKMNSHQHIPEIMQQLT-----
ARGC_ALKMQ      PLLKENVISSIIIDAKSGVSGAGRNLNDTLFSQCNE--------NIKAYSIGTHRHIPEI----------
ARGC_NEIMF      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_MORPR      PLAKHGLISKPIINAVSGVSGAGRK---------------------------------------------
ARGC_METTH      PLVYEKIADTFIIDSKTGVSGAG-----------------------------------------------
ARGC_STAES      PLISNIRVDSIIVDAKSGLTGAGKKLNQSSHXXXXXXXXXXXKLNK-------HQHIPEI----------
ARGC_SILPO      PLIAAGVIDEIILDLKCAVSGAGRSLKENL----------------------------------------
ARGC_STAEQ      PIISNIRVDSIIVDAKSGLTGAGKKLNQSSHXXXXXXXXXXXKLNK-------HQHIPEI----------
ARGC_MAGSM      PLLQEGMIALVIADSKSGVSGAGRSAQGTLFAELSEGF--------KAYKVEAHRHIPEMEQNLALAAGK
ARGC_BACCN      PLMRNKIINSIIIDAKSGVSGAGK----------------------------------------------
ARGC_NEIG2      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_NEIG1      PLLRQCRLMPLIADCKSGVSGAGRKG--------------------------------------------
ARGC_HELMI      PLCGQGLIDRLIIDAKSGVSGAGR-------NANLAIIYGEVNENVK-----AYNVAKH--------RHN
ARGC_BACC4      XXXRSGMIEEIIIDAKSGVSGAGK----------------------------------------------
ARGC_SILST      PLIAAGVIDEIILDMKCAVSGAGR----------------------------------------------
ARGC_PELPD      PLLKNGMIKSIIADSASGVTGAGRGAVDSLYCEVNEGY--------------------------------
ARGC_BACST      PLVKEGLIKEIIVDAKSGVSGAGKAGLGTHFSEVNE--------NVKIYKVNAHQHIPEIEQAL------
ARGC_CHLTE      PLFAGLDVESVNVTAVSGISGAGRSAKLELFSEMSG--------NMRAYKVGKHQHTPEI----------
ARGC_DEHE1      PAFKMDLIPNAIVDAKSGLSGSGR------------TPTAKNIFCEASEDVCAYSI----------GTHR
ARGC_THESQ      PALKHNLVDTILVDAKSGVSGAGKEKVDYLFSE----------VNESLPYNVAHRHVPEMEQ--------
ARGC_PYRHO      PFKDLTKEVLVDLKVSSSAGG-------------------------------------------------
ARGC_THEP1      PALKRNLVDTILVDAKSGVSGAGKEKVDYLFSE----------VNESLPYNVAHRHVPEMEQ--------
ARGC_THEMA      PALKHNLVDTILVDAKSGVSGAGKEKVDYLFSE----------VNESLPYNVAHRHVPEMEQ--------
ARGC_LISW6      PLVKKQLITSIIVDAKSGISGAGKVPS----TSTHFTETNE---NMTLYKMNSHQHIPEIMQQLT-----
ARGC_NITEU      PLIEAGAVDHLIADTKSGVSGAGRK---------------------------------------------
ARGC_AGRRK      PLRAAGILPDGYPVTVNAVSGYTGGGKQMIAQMENADHPDAPLTHKHVPEMTTHGLLDRAPIF-SPSVGK
ARGC_CLOB8      PLLKNSKLDNIICDSKSGTTGAGR----------------------------------------------
ARGC_CALMQ      PLVKGHLINNIVVDAKIASSGAGAEG--------------------------------------------
ARGC_XYLFT      PLRD------------------------------------------------------------------
ARGC_XYLFA      PLRD------------------------------------------------------------------
ARGC_XYLF2      PLRD------------------------------------------------------------------
ARGC_PELTS      PLLKNXXXXXXXXXXXXGVSGAGR-GL--------ALGSHFSEVNENFK---AYNVTPEIE---------
ARGC_METTP      PLAKAGMVDRVVFDSKSGISGAGAE---------------------------------------------
ARGC_GEOSM      PL--------------------------------------------------------------------
ARGC_GEOSL      PLLKHKLI--------------------------------------------------------------
ARGC_DESAP      PLLAKGLIDEIVIDAKSGVSGAGR----------------------------------------------
ARGC_CLOTH      PLVKNRLVKNIIIDAASGVSGAGKTDLPYQFCECDENFKAYSVSNHRHTSEIE----QELSLLAEEEITV
ARG56_DICDI     PFVNDL-VTPPSCFGISGYSGAG-----------------SKPSEKNDPTRLSDNILP------------
ARGC_PSYWF      PVIEAQNLARIIIDAKSGVSGAGRQ---------------------------------------------
ARGC_METVS      PLVSNDIVERIIFDSKSGVSGAGVEATE------------------------------------------
ARGC_GEOBB      PL--------------------------------------------------------------------
ARGC_STAAR      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAAN      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAAM      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAA1      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_LISMH      XXXKNKLITSIIVDAKSGISGAGKVPS----ASTHFTETNE---NMTLYKMNSHQHIPEIMQQLT-----
ARGC_HALWD      PLFD------------------------------------------------------------------
ARGC_SALTY      PLIDGGLLDLTVINATSGVSGAGRK---------------------------------------------
ARGC_SALTI      PLIDGGLLDLTVINATSGVSGAGRK---------------------------------------------
ARGC_SALPA      PLIDGGLLDLTVINATSGVSGAGRK---------------------------------------------
ARGC_PYRFU      PFKD---LTQEAIVDLKVSSSAG--GRRENIASIHPERSNVVRVYKPYHHRHEAEVLQETRV--------
ARGC_GEOSF      PLLKKKLVATIIADAKSGVSGAGRSAVDNLYCE-------------------------------------
ARGC_OCHA4      PLRDAGLLPAVSVNAVSGYTGGGKQMI-------------AQMEDKSHPEHLAANNFLYGLPLKHKHVPE
ARGC_METMP      PLVANDLVDRIIFDSKSGVSGAGVE---------------------------------------------
ARGC_JANMA      PLLQAGVISHLIADCKSGVSGAGRKAVATLFSE-------------------------------------
ARGC_HERAR      PLADVIDASHLIADCKSGVSGAGRK---------------------------------------------
ARGC_GEOUR      PLLKKKLIATIIADSKSGVSGAGRSAVDNLYCE-------------------------------------
ARG56_CANAL     PLKEYISGTPSIFGV-SGYSGAGTKPSPKLLSNNLIPYSLTDHVHEK-----------------------
ARGC_METJA      PLKENIIEERIIFDSKTGVSGAG-----------------------------------------------
ARGC_EXIS2      XXXEERVISQIIIHASSGLSGAGK----TLTEQTHHVRSSE---NVRLYKMNQHQHIPEIESIAED----
ARGC_ECOL6      PLIDADLLDLPVINATSGVSGAGRK---------------------------------------------
ARGC_BACLD      PLVKSGSINEVIIDAKTGVSGAGKPSMGTHFSEVND--------NFKIYKVNEHQHTPEIE------QTV
ARGC_SULSO      PI--------------------------------------------------------------------
ARGC_RHOCA      PLIEAGVIDEIVIDLKAGVSGAGRSLKENL----------------------------------------
ARGC_PYRKO      PFRE------------------------------------------------------------------
ARGC_LISMO      XXXXNKLITSIIVDAKSGISGAGKVPS----ASTHFTETNE---NMTLYKMNSHQHIPEIMQQLT-----
ARGC_BRUSU      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUSI      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUMB      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUC2      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUAB      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUA2      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BRUA1      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BACWK      XXXRSGIIASIIIDAKSGVSGAGK-------TPTTMTHFPELYDNLHIYKVNQHQHVPEIEQML------
ARGC_BACCQ      ----------------------------------------------------------------------
ARGC_BACC7      ----------------------------------------------------------------------
ARGC_BACC1      ----------------------------------------------------------------------
ARGC_STRSV      PLLKARAIELIIVDAKSGLTGAGKNPA----ASSHFVHVHDNYVTYKLNQH---QHIPEI-VQQLQRFDK
ARGC_STRMU      PLEKLIDVNSIIVDAKSGLTGAGK----------------------------------------------
ARGC_STAAW      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAAS      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAAC      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAA8      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_STAA3      PLISEVDLSSIIIDAKTGVSGAGRSLSQRVFSEMNENLSAYAIGNHKHK--------PEIEQYL------
ARGC_PELCD      PLLENNLIASLIIDSKSGTSGAGR----------------------------------------------
ARGC_NITOC      PLLEH-----------------------------------------------------------------
ARGC_METB6      PIASRAH--TIIFDSKTGVSGAG-----------------------------------------------
ARGC_IGNH4      PAAERIDLDRIVVDVKVGSSEAG-----------------------------------------------
ARGC_DESPS      PLAGIIKPQSIIADSKSGTTGAGRGAVGSLFCEVNDGF-------KAYGVGRKHRHTPEIE---------
ARGC_BACC3      PLXXXXXXXXXXXXAKSGVSGAGK----------------------------------------------
ARGC_BACAN      PLXXXXXXXXXXXXAKSGVSGAGK----------------------------------------------
ARGC_BACAC      PLXXXXXXXXXXXXAKSGVSGAGK----------------------------------------------
ARGC_BACAA      PLXXXXXXXXXXXXAKSGVSGAGK----------------------------------------------
ARGC_SHIFL      PLIDADLLDLPVINATSGVSGAGRK---------------------------------------------
ARGC_PYRAB      PFRD---VTSEAIVDLKVSSSAG--GRRENVASIHPERSHVVRVYKPFHHRHEAEVLQETGV--------
ARGC_DICTD      PLKNNLTYGNAIIDAKSGISGAGRKPTDKIYGNIAENYQAYSILNHRHQPEIE-NVIKEI------GY--
ARGC_ACIF5      XXXXXXXXQELIADCKSGVSGAGR----------------------------------------------
ARGC_ACIF2      XXXXXXXXQELIADCKSGVSGAGR----------------------------------------------
ARGC_ECOLI      PLIDADLLDLPVINATSGVSGAGRK---------------------------------------------
ARGC_BRUO2      PLCDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_THET2      XXXXEGVLKGAFVVGLSGVSGAGREAEGTAFAE-------------------------------------
ARGC_SULTO      PL-----VASSLLETYKLIS--------------------------------------------------
ARGC_ECO57      PLIDADLLDLPVINATSGVSGAGRK---------------------------------------------
ARGC_BRUME      PLRDAGLLPAVSVNAVSGYTGGGKQLIAQMEDRNHPDYLAAN--NFLYGLPLKHKHVPELQLHGR-----
ARGC_BACA2      PLAKNGLLSFLIVDAKTGVSGAGRK---------------------------------------------
ARG56_SCHPO     PI--------------------------------------------------------------------
ARGC_METM7      PLVANDLVERIIFDSKSGVSGAGVE---------------------------------------------
ARGC_RHILW      PLRAAGLLPPVTVNAVSGYTGGGKQ---------------------------------------------
ARGC_GEOMG      PLLKKRLISTIIADSKSGVSGAGR----------------------------------------------
ARG56_NEUCR     PLVPH-----------------------------------------------------------------
ARGC_SHEON      PLKNLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHELP      PLKDLMTDSLPVINAVSGVTGAGRK---------------------------------------------
ARGC_RHIE6      PLRAAGILPPVTVNAVSGYTGGGKQ---------------------------------------------
ARGC_PYRAE      PLAKH-----------------------------------------------------------------
ARGC_PSYCK      PIIEAQNESRIVIDAKSGVSGAGRQ---------------------------------------------
ARGC_PELPB      PLNDSSINVRGINCTSTSISGAGRSSKTELFSEMSE--------NIRAYKVGLHQHIPEI----------
ARGC_METM5      PLVANDLVERIIFDSKSGVSGAG-----------------------------------------------
ARGC_BURCM      PLQQAGLLPRVCIHAVSGYSGGGRAAVDAFESNGAA----------------------------------
ARGC_AGRT5      PLRASGILPPVSVNAVSGYTGGGKQMIAQMEDQSRAISANNFL----YGLTLKHKHVPEMTIHGQ-----
ARGC_METM6      PLVANDLVERIIFDSKSGVSGAG-----------------------------------------------
ARGC_META3      PLVKEGIINRIIVDSKTGVSGAG-----------------------------------------------
ARGC_BURS3      PLQQAGLLPRVSIHAVSGYSGGGRAAVD------------------------------------------
ARGC_AGRVS      PLRAAGILPPVSVNAVSGYSGGGKQLIAQMEDESHPEHLT--VNNYVYGLNLKHKHVPEMKA--------
ARGC_YERPE      PLVDGQLLNDAVINAVSGVSGAGRK---------------------------------------------
ARGC_SHEB5      PLASLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_RHOBA      PLVKAGLIETIIVDSKSGVSGAGR----------------------------------------------
ARGC_RHISN      PLRQAGILPPVTVNAVSGYTGGGKQMIAQIEDENHADHISAPLKHKHVPEMKMHGMLERAPIF-SPSVGK
ARGC_RHIET      PLRAAGILPPVTVNAVSGYSGGGKQ---------------------------------------------
ARGC_RHIEC      PLRAAGILPPVTVNAVSGYSGGGKQ---------------------------------------------
ARGC_PSYA2      PIIEAQNESRIVIDAKSGVSGAGRQ---------------------------------------------
ARGC_PYRIL      PL--------------------------------------------------------------------
ARGC_NITEC      PLIEAGAVNHLIADTKSGVSGAGRK---------------------------------------------
ARGC_CLONN      PLLDLVEKGSIIVDAKSGVSGAGR----------------------------------------------
ARGC_SHEWM      PIHSLMTSSLPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHEB8      PLASLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHEB2      PLASLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_RHIL3      PLRDGYPITVNAVSGY---TGGGKQ---------------------------------------------
ARGC_HALMA      PLFE------------------------------------------------------------------
ARGC_SYNFM      PLGKLADPRTLIADSKSGVSGAGR----------------------------------------------
ARGC_SULDN      PFMDRVAHTPIIVDSKTGVSGAGKKLSD------------------------------------------
ARGC_SHESR      PLKNLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHESM      PLKNLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHESA      PLKNLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_PYRCJ      PL--------------------------------------------------------------------
ARGC_CELJU      PL--------------------------------------------------------------------
ARGC_BACAM      XXXXXXXXDEVIVDAKTGVSGAGRKA---------SMGTHFSELNDNF----------KIYKVNEHQHTP
ARGC_YERPS      PLVDGQLLNDAVINAVSGVSGAGRK---------------------------------------------
ARGC_SHEB9      PLVSLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_RALSO      PLVEAGIVPAITAFSLTGYSGGGKK---------------------------------------------
ARGC_ORYSJ      PLAKLIKVSNIIIDAKSGVSGAGR----------------------------------------------
ARGC_SINMW      PLRQAGILPPVTVNAVSGYTGGGKQMIAQIEDDKSPDHIRAP--HFLYGLTLKHKHVPEM----------
ARGC_ALTMD      PLAHNGLLVRPVINAVSGVSGAGRK---------------------------------------------
ARGC2_ANASP     PLIAQGILPSSFPITINAVSG-------------------------------------------------
ARGC_UNCMA      PLIAQGLVNRAVVDSKSGISGSGQD---------------------------------------------
ARGC_CLOBB      PL--------------------------------------------------------------------
ARGC_NATPD      PLFD------------------------------------------------------------------
ARGC_EHRCJ      XXXXXVKSNNIIVDAKSGVSGAGRSKQDNLFCEVYDAIKSYKVSNHRH--------IPEIEQELCFAACR
ARGC_CLOK5      PLISKGLIEEIIADCKSGLTGAGK----------------------------------------------
ARGC_CLOK1      PLISKGLIEEIIADCKSGLTGAGK----------------------------------------------
ARGC_ANAVT      PLIAQGILPSSFPITINAVSG-------------------------------------------------
ARGC2_PSEPK     PL--------------------------------------------------------------------
ARGC_STAS1      PLKDIVKQDNIIIDAKTGVSGAGR----------------------------------------------
ARGC_SHEFN      PLKPFLTEMYPVINAVSGVTGAGRK---------------------------------------------
ARGC_SHEDO      PLKSLLTSAYPVINAVSGVTGAGRK---------------------------------------------
ARGC_HALOH      PVENLINLNTIIIDAKSGVSGAGK----------------------------------------------
ARGC_EHRCR      XXXXXXKSQGIIVDAKSGVSGAGRSKQDKLFCEVYDVIKSYKISDHRH--------IPEIEQELCFAACR
ARGC_ARATH      PLANLIKHENIIIDAKSGVSGAGRGAKENLYSEIAEGISSYGVTRHRH--------VPEIEQGLSD----
ARGC2_DEIRA     PLTGRGLLPAVHIQGYSGYTGGGRALVD------------------------------------------
ARGC_RHIME      PLRQAGILPPVTVNAVSGYTGGGKQ---------------------------------------------
ARGC_PHOLL      PLLENSLLDWPVINATSGVSGAGRK---------------------------------------------
ARGC_OCEIH      PMLENNIIESIMIDGKTGISGAGKNSSAKTHFST----TNENVTPYKIGTH---QHIPEIEKYL------
ARGC_JANSC      PLIENGVVXXXXXXXXXGVSGAGR----------------------------------------------
ARGC_BACSK      XXXXXXXXERIVIDAKSGTSGAGKSPTSMTFSETNENFKIYQVASHKHTPEI------------------
ARGC_AERS4      PLQQAGLIAQPIINAVSGVSGAGRK---------------------------------------------


                         .         .         .         +         .         .         .:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
DHAS_AQUAE      EENKMLYETRKIMDENIKVSATCVRIPVFYGHSESISMETEKEISPEEAREVLKNAPGVIVIDNPQNNEY
DHAS_RICFE      EEAKIAFELNKIMGNHFKASVTSVRVPVFIGHSISVNIEFNDKMDANIAEEILQDADGIVTISNNNDLAY
DHAS_RICCN      EEAKIASELNKIIGNHFKASVTSVRVPVFIGHSISVNIEFNDKIDAKEVEEILQDADGIVTISNNNYLAY
DHAS_RICTY      EETKIAFELSKIMGTHFKTSVTSVRVPVFIGHAISVNIEFSNKIYAKDVEEILQDADGIVTISNNNDLAY
DHAS_RICPR      EETKIAFELNKIMGNHFKTSVTSVRVPVFIGHAISVNIEFSDKIYAKDVEEILQDADGIVTISNNNGLAY
DHAS_VIBCH      EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
DHAS_LEGPN      EEMKMVWETRKIMDDSIMVNPTAVRVPVIYGHSEAVHLELKKPLTADDARALLAKAPGVTVVDNLSKASY
DHAS_SHEVI      EEMKMVWETQKIFDDNIVVNPTAVRVPVFYGHSEAIHLETIQPAEAEDVKAVLREAPGIELFESNEE--Y
DHAS_RICBR      EESKIALELQKIIGDHLKXXXXXXXXXXXXGHSISVNIEFSSKVDAKEVEEILEDADGVVMISQTKDLAY
DHAS_SHESP      EEMKMVWETQKIFDDNIVVNPTAVRVPVFFGHSEAIHLETIQPAEAEDVKAVLRDAPGIELFESNEE--Y
DHAS_CAMJE      EELKMVNETQKILHKNLEVSATCVRVPVLRSHSEAITMHFEKEIDVKKAKEILKKAPSVIVIDDPKNKKY
DHAS_VIBMI      EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLDQTDG---IELFRGADF
DHAS_STRAK      EEQKLRNESRKILEPGLKVSGTCVRVPVFSGHSLQINARFARPISADGATELLKDAPGVELSD------I
DHAS_PROMA      EEMKMINETRKILNQSLAITATCVRVPVLRAHSESINIEFAEPFPVEEARKILSNASGIKLLEDIQMNRF
DHAS_STRMU      EEMKMTNETKKIMEPELPVSATCVRVPILFSHSEAVYIETKDVAPIEEVKAAIAAFPGAVLEDDIKHQIY
DHAS_BACSU      EEMKMINETKKIMHPDLQVAATCVRLPIQTGHSESVYIEIDDDATVEDIKNLLKEAPGVTLQDDPSQQLY
DHAS_MYCTU      EDQKLRFESRKILGPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVD------V
DHAS_MYCBO      EDQKLRFESRKILGPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVD------V
DHAS_HELPJ      EELKMVHETHKIMGVDFPISATCVRVPVLRSHSESLSIAFEKEFDLKEVYEVLKNAPSVVVCDDPSHNLY
DHAS_HELPY      EELKMLHETHKIMGVDFPISATCVRVPVLRSHSESLSIAFEKEFDLKEVYEVLKNAPSVAVCDDPSHNLY
DHAS_MYCSM      EDQKLRNESRKILGPELLVSGTCVRVPVFSGHSLSINAEFSQPISVERTKELLSAAAGVKLVD------V
DHAS_CORGL      EEQKLRNESRKILGPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVDQAQEILGAASGVKLVD------V
DHAS_CORML      EEQKLRNESRKILGPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAASGVKLVD------V
DHAS_CORFL      EEQKLRNESRKILGPDLKVSGTCVRVPVFTGHTLTIHAEFDKAITVEQAQEILGAASGVELVD------V
DHAS_SYNY3      EEMKMVQETRKIFAAEIRITATCVRVPVLRAHSEAVNLEFATPFPVELAKTAIAKAPGVKLVEDWQKNYF
USG_PSEAE       IERRIFAEVQALLGERIPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKG---IEWVGEGDY
USG_AZOVI       LERRLVEESRQVLDPELKISVTCLMAPVFFGDSLSLAVQASQAIDPSAVRAALERAPGLELIEPDDCPTV
USG_ECOLI       XXXXXXXXXXKILDEGLMISASVVQAPVFYGHAQMVNFXXXXXXXXXXXXXXFVQGEDIVLSEENEFPTQ
DHAS_ARCFU      EPLKLLFNGRKIEFADIKVSASCHRVPVIDGHTEAVWVEFDREVSVEEAKAALPTSPEKVIIVREEPD--
DHAS_METJA      EEEKMQTESLKLLGTLFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKKPIVIREEIDRPQPR
DHAS_METTH      XLHLLGELDEGVVKPAFGVSASCHRVPVVDGHTEAXXXXXXXXXXXXXXREAMDKFRGVVVRDEENRPQP
DHAS_LEPIN      EPLKCLVENGKILHADFSISAHCNRVPVFDGHTVCVSVKFKKKPSREE----------------------
DHAS_LEPIC      EPLKCLVENGKILHADFSISAHCNRVPVFDGHTVCVSVKFKKKPSREE----------------------
DHAS_YEAST      EEDKMEWETKKILAPLIKVSAQCNRVAVSDGHTECISLRFKNAPSVEQVKTCLKE----YVCDAYKLGCH
DHAS_PSEAE      EEWKAQAETNKILKNPIPVDGICVRVGAMRCHSQALTIKLNKDVPLTDIEGLIQHNPWVKLVPNHREVSV
DHAS_HAEIN      EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
DHAS_BUCAI      EEWKGQAETNKILKDTILIDGTCVRIGSLRCHSQSFVIKLKKDVSLEDIEEIIRNHNKWVDVIPNSIQDK
DHAS_SHIFL      EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
DHAS_ECOLI      EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
DHAS_ECOL6      EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
DHAS_ECO57      EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
DHAS_SALTY      EEWKGQAETNKILNTAIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAHNPWAKVVDRDITMRE
DHAS_SALTI      EEWKGQAETNKILNTAIPVDGLCVRVGALRCHSQAFTIKLKKEVSIPTVEELLAHNPWAKVVDRDITMRE
DHAS_ACTPL      EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLK-----------------------------
DHAS_NEIMB      EEWKGGVETNKILDNPTVIDGLCVRVGAMRCHSQAITLKLKKDLPVSEIETILAGANDWVKVIPNEKEAS
DHAS_NEIMA      EEWKGGVETNKILDNPTVIDGLCVRIGSMRCHSQALTLKLKKDLPVSEIEAILAGANDWVKVIPNEKEAS
DHAS_BORPE      EEWKAEAETNKILTPATPIDGLCVRIGAMRCHSQALTIKLKRDVPLDEIEDLIAAGTQWAKVTKEDTVKA
DHAS_BUCBP      EEWKIQAETNKILNKDILIDGLCVRIGALRCHSQSFVIKLKKDISIPEIEQILLNHNSWTKVRKHDTMTE
DHAS_BUCAP      EEWKGQAETXXXXXXXXXXDGTCVRISSIRCHSQSFLIKLNKDISLENIKKIINQWVDVIPNNMQKTLCN
DHAS_SCHPO      EEEKIEWETRKILGSVNSVSAQCNRVPVIDGHLMCISVKFKTSPTPDQVREVLAQKLGCYVFDDSTPDRP
ARGC_ARCFU      ----------------------------------------------------------------------
USG_HAEIN       QTPNLSNQLQRIFPQLDRATFHAIQVPVFYGLAQKVT------ALSDYDFDYQPQNSELIALEETLITPV
DHAS_AZOVI      EEWKGQAETNKILKNPIPVDGICVRVGAMRCHSQALTIKLNKDVIADIEGLISQHNPWVKLVPNHREASM
ARGC_MORAB      RGILATIN--------VKLVAGVTPEQVTAAYQEAYQ---DQPM----VRLLPRRTPSIKAVEK--TAYY
ARGC_KOSOT      HVPEMEQEMSKLCGKRLKLVFTPHLVPMVRGILSTIYVKTD--LSLDEVYELYREYYGKKFIHVLQPGVY
ARGC_GEOTN      ---QMLGTWNGAMKP---ITFSTHLIPMTRGIMSTIYAKVKQPFSLNDLIDLYKTSEDASFVRIRQPGQF
ARGC_GEOKA      QTWNEAME---------PITFSTHLIPMTRGIMATIYAKAKQPISPNDLVDLYKTSEGSPFIRVRKVGQF
ARGC_BACHD      --WDESVG---------NVTFSTHLVPMVRGIMATIYAEANQAISEKELREVYETSP---FVHVYSEGRY
ARGC_BACSU      EIEQALNEWQPGLGP---ITFSAHLVPMTRGIMATMYTRLTCDLTADDLHDLYSEYQDSYFVRVRPKGQY
ARGC_NEIMB      ----------------------------------------------------------------------
ARGC_NEIMA      ----------------------------------------------------------------------
ARGC_NEIM0      ----------------------------------------------------------------------
ARGC_METST      ----------------------------------------------------------------------
ARGC_LISMC      -KWDETI-------PAIQFSTSLI--PITRGIFTTIYVKPKNPITQKELHTLYKSTYENAPFVRIQPENY
ARGC_METKA      ----------------------------------------------------------------------
ARGC_LISIN      -KWDKSI-------PAIQFSTSLI--PITRGIFTTIYVKPKNPITQQELHQLYESTEHASFVRIQAENTY
ARGC_LISMF      -KWDETI-------PAIQFSTSLI--PITRGIFTTIYVKPKNPITQKELHTLYKSTYENAPFVRIQPENY
ARGC_ALKMQ      -------------EQELSLAAGKEMIIQFTPHLVPMNRGILSTIYTTNIKNVKENDIEAIYAHYYEEKRF
ARGC_NEIMF      ----------------------------------------------------------------------
ARGC_MORPR      ----------------------------------------------------------------------
ARGC_METTH      ----------------------------------------------------------------------
ARGC_STAES      ------VQTLQFFNKSLQIQFSTSLIPVNRGIVATIYTRLENGVKINQIKDVYKNKPFIRIKD-----GL
ARGC_SILPO      ----------------------------------------------------------------------
ARGC_STAEQ      ------VQTLQFFNKSLQIQFSTSLIPVNRGIVATIYTRLENGVKINQIKDVYKNKPFIRIKD-----GL
ARGC_MAGSM      E---------------IKIRFTPHLLPQSRGILSTCYLRPTSGVNAQRVRDTLRDEPFVTVLPH---GDM
ARGC_BACCN      ----------------------------------------------------------------------
ARGC_NEIG2      ----------------------------------------------------------------------
ARGC_NEIG1      ----------------------------------------------------------------------
ARGC_HELMI      PEIEQEVAERAGLDPAMAITFTPHLMPMTRGILTTVYADLKEGVTSEEVRNLYRQYAGEPFIHVMDEGVW
ARGC_BACC4      ----------------------------------------------------------------------
ARGC_SILST      ----------------------------------------------------------------------
ARGC_PELPD      ----------------------------------------------------------------------
ARGC_BACST      QTWN---------EAVAPITFSTHLIPMTRGIMATIYAKAKQSISPNDLVDLYKTSEGSPFVRIRQLGQF
ARGC_CHLTE      ----MQTLGTSVTDPSFRFVFTPMIAPYVRGIYSVLNVRLASPVAMEPVRELYA-------------GFY
ARGC_DEHE1      HQPEIVQELSLVGGGVIPRVTFCPHVPMSRGILSSAYARLKQPVTDEEVKEIYRR------FYKDEPFVK
ARGC_THESQ      -------ELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSLEEEAYLEFYRNEPFVHVLPM---GIY
ARGC_PYRHO      ----------------------------------------------------------------------
ARGC_THEP1      -------ELEKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSLEEEAYLEFYRNEPFVHVLPM---GIY
ARGC_THEMA      -------ELGKISGKKVNVVFTPHLVPMTRGILSTIYVKTDKSL--EEIHEAY------LEFYKNEPFVH
ARGC_LISW6      -KWDESI-------PAIQFSTSLI--PITRGIFTTIYVRPKKPIAWEELHKLYESTENAPFVRIQKENVY
ARGC_NITEU      ----------------------------------------------------------------------
ARGC_AGRRK      FAQGMIVQVPLHLDNLAEGATMESIHAALVGHFAGQDV--VQVVSLAESRALPR----------------
ARGC_CLOB8      ----------------------------------------------------------------------
ARGC_CALMQ      ----------------------------------------------------------------------
ARGC_XYLFT      ----------------------------------------------------------------------
ARGC_XYLFA      ----------------------------------------------------------------------
ARGC_XYLF2      ----------------------------------------------------------------------
ARGC_PELTS      ------QELGRIAGEDVAVTFTPHLLPVTRGILSTVYAKLAAPAGEEEIRDYYRGEPFVRVL----PAGM
ARGC_METTP      ----------------------------------------------------------------------
ARGC_GEOSM      ----------------------------------------------------------------------
ARGC_GEOSL      ----------------------------------------------------------------------
ARGC_DESAP      ----------------------------------------------------------------------
ARGC_CLOTH      SFTPHLVPMKRGMLATIYANLNCEK-----STSELIEL----------YKEYYKNEYFVRILDE---GKL
ARG56_DICDI     --YKLVQHTHE-LEVSHQLGSPIYFMPFFQGITLTISMELKYPMTKEQVVERYQKFYQNEPLIKIDKDGI
ARGC_PSYWF      ----------------------------------------------------------------------
ARGC_METVS      ----------------------------------------------------------------------
ARGC_GEOBB      ----------------------------------------------------------------------
ARGC_STAAR      ---------SIIAGQDVSVIFTPHLVPMARGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAAN      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKFSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAAM      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKFSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAA1      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKFSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_LISMH      -KWDESI-------PAIQFSTSLI--PITRGIFTTIYVKPKNPITQKELHTLYESTYENAPFVRIQPENY
ARGC_HALWD      ----------------------------------------------------------------------
ARGC_SALTY      ----------------------------------------------------------------------
ARGC_SALTI      ----------------------------------------------------------------------
ARGC_SALPA      ----------------------------------------------------------------------
ARGC_PYRFU      ----------------------------------------------------------------------
ARGC_GEOSF      ----------------------------------------------------------------------
ARGC_OCHA4      LQLHGRLDRRPIFSPSVGRQGMIVQVPLFLGLEGTPSLAKVHSVLTDHGQDIVEVAP----LEESAKLAR
ARGC_METMP      ----------------------------------------------------------------------
ARGC_JANMA      ----------------------------------------------------------------------
ARGC_HERAR      ----------------------------------------------------------------------
ARGC_GEOUR      ----------------------------------------------------------------------
ARG56_CANAL     ----------------------------------------------------------------------
ARGC_METJA      ----------------------------------------------------------------------
ARGC_EXIS2      -----------ITGQQITVSLATYLVPLNRGIMATMTLQPLVEKTEAEWR--------TWFIEKYKQESF
ARGC_ECOL6      ----------------------------------------------------------------------
ARGC_BACLD      KQWNSAFK---------PITFSTHLVPMTRGIMATIYTELKDSMDAEQLQLIFSKYKDSYFVRVRETGSF
ARGC_SULSO      ----------------------------------------------------------------------
ARGC_RHOCA      ----------------------------------------------------------------------
ARGC_PYRKO      ----------------------------------------------------------------------
ARGC_LISMO      -KWDESI-------PAIQFSTSLI--PITRGIFTTIYVKPKNPITQKELHKLYESTYDNAPFVRIQPENY
ARGC_BRUSU      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BRUSI      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVDVVP----LEESAKLPR
ARGC_BRUMB      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BRUC2      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BRUAB      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BRUA2      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BRUA1      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BACWK      TEWNR--ETKPI-------TFSTHLIPISRGIMITLYAKVKEEMKIEQLQKLYEETEYSAFVRVRSQGEF
ARGC_BACCQ      ----------------------------------------------------------------------
ARGC_BACC7      ----------------------------------------------------------------------
ARGC_BACC1      ----------------------------------------------------------------------
ARGC_STRSV      RLQQIQFSTSLI--------------PLNRGIVATVYSKLKEPLTREELAAIYQ--------DCYQDKPF
ARGC_STRMU      ----------------------------------------------------------------------
ARGC_STAAW      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAAS      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAAC      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAA8      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_STAA3      ---------SIIAGQDVSVIFTPHLVPMTRGILSTIYVKLSSEYTTESLHKLMANQPFVRIRD---IGTF
ARGC_PELCD      ----------------------------------------------------------------------
ARGC_NITOC      ----------------------------------------------------------------------
ARGC_METB6      ----------------------------------------------------------------------
ARGC_IGNH4      ----------------------------------------------------------------------
ARGC_DESPS      ------QELGKLANTDFNITFTPHLLPISRGILSTIYADLNCEIEADEVQALYEE------MYKDEPFVR
ARGC_BACC3      ----------------------------------------------------------------------
ARGC_BACAN      ----------------------------------------------------------------------
ARGC_BACAC      ----------------------------------------------------------------------
ARGC_BACAA      ----------------------------------------------------------------------
ARGC_SHIFL      ----------------------------------------------------------------------
ARGC_PYRAB      ----------------------------------------------------------------------
ARGC_DICTD      --------LRVLFVPQL--------IPVFRGMFVSIYVPLRDEITSEDLYQIFKEVYEDEYFIKVLPPSC
ARGC_ACIF5      ----------------------------------------------------------------------
ARGC_ACIF2      ----------------------------------------------------------------------
ARGC_ECOLI      ----------------------------------------------------------------------
ARGC_BRUO2      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_THET2      ----------------------------------------------------------------------
ARGC_SULTO      ----------------------------------------------------------------------
ARGC_ECO57      ----------------------------------------------------------------------
ARGC_BRUME      ------LDRRPIFSPSVGRQGMIVQVPLFLSELESPSLAKVHAVLTEHGQDIVEVVP----LEESAKLPR
ARGC_BACA2      ----------------------------------------------------------------------
ARG56_SCHPO     ----------------------------------------------------------------------
ARGC_METM7      ----------------------------------------------------------------------
ARGC_RHILW      ----------------------------------------------------------------------
ARGC_GEOMG      ----------------------------------------------------------------------
ARG56_NEUCR     ----------------------------------------------------------------------
ARGC_SHEON      ----------------------------------------------------------------------
ARGC_SHELP      ----------------------------------------------------------------------
ARGC_RHIE6      ----------------------------------------------------------------------
ARGC_PYRAE      ----------------------------------------------------------------------
ARGC_PSYCK      ----------------------------------------------------------------------
ARGC_PELPB      ----MQTLGTSVTTPSFDFTFTPMIGSLVRGIYSILTVNLENPAEAEQIKEFYKEAPFVRVRD-------
ARGC_METM5      ----------------------------------------------------------------------
ARGC_BURCM      ----------------------------------------------------------------------
ARGC_AGRT5      ------LDRAPLFAPSVGRQGMIVQVPLFAADAEGTTIEIHAALTAHYAQDIVSVVP----LAESKGISR
ARGC_METM6      ----------------------------------------------------------------------
ARGC_META3      ----------------------------------------------------------------------
ARGC_BURS3      ----------------------------------------------------------------------
ARGC_AGRVS      ---HGLLDRAPLFSPSVGRQGMIVQVPLFLEDADGATVEIHAALSAHYAQDIVK----VVALEDSAKLGR
ARGC_YERPE      ----------------------------------------------------------------------
ARGC_SHEB5      ----------------------------------------------------------------------
ARGC_RHOBA      ----------------------------------------------------------------------
ARGC_RHISN      FPQGMIVQVPLYLDD-LAPGATLESIAALVEHYAGQSIVEVVPLSAQLAR--------------------
ARGC_RHIET      ----------------------------------------------------------------------
ARGC_RHIEC      ----------------------------------------------------------------------
ARGC_PSYA2      ----------------------------------------------------------------------
ARGC_PYRIL      ----------------------------------------------------------------------
ARGC_NITEC      ----------------------------------------------------------------------
ARGC_CLONN      ----------------------------------------------------------------------
ARGC_SHEWM      ----------------------------------------------------------------------
ARGC_SHEB8      ----------------------------------------------------------------------
ARGC_SHEB2      ----------------------------------------------------------------------
ARGC_RHIL3      ----------------------------------------------------------------------
ARGC_HALMA      ----------------------------------------------------------------------
ARGC_SYNFM      ----------------------------------------------------------------------
ARGC_SULDN      ----------------------------------------------------------------------
ARGC_SHESR      ----------------------------------------------------------------------
ARGC_SHESM      ----------------------------------------------------------------------
ARGC_SHESA      ----------------------------------------------------------------------
ARGC_PYRCJ      ----------------------------------------------------------------------
ARGC_CELJU      ----------------------------------------------------------------------
ARGC_BACAM      EIEQALNEWQPGLGP---ITFSAHLVPMTRGIMATMYTRLTCDLTADDLHDLYSEYQDSYFVRVRPKGQY
ARGC_YERPS      ----------------------------------------------------------------------
ARGC_SHEB9      ----------------------------------------------------------------------
ARGC_RALSO      ----------------------------------------------------------------------
ARGC_ORYSJ      ----------------------------------------------------------------------
ARGC_SINMW      -KMHGLLERAPVFSPSVGKFAMIVQVPLYVDDLAAATIESIHRALVDHGQSIVEVVP----LEESAKLAR
ARGC_ALTMD      ----------------------------------------------------------------------
ARGC2_ANASP     ----------------------------------------------------------------------
ARGC_UNCMA      ----------------------------------------------------------------------
ARGC_CLOBB      ----------------------------------------------------------------------
ARGC_NATPD      ----------------------------------------------------------------------
ARGC_EHRCJ      ED--------------INLQFVPNLIPVKRGMMSNIYLELEVGVSLTDVREALLRDSFFVVVDEEKA---
ARGC_CLOK5      ----------------------------------------------------------------------
ARGC_CLOK1      ----------------------------------------------------------------------
ARGC_ANAVT      ----------------------------------------------------------------------
ARGC2_PSEPK     ----------------------------------------------------------------------
ARGC_STAS1      ----------------------------------------------------------------------
ARGC_SHEFN      ----------------------------------------------------------------------
ARGC_SHEDO      ----------------------------------------------------------------------
ARGC_HALOH      ----------------------------------------------------------------------
ARGC_EHRCR      ED--------------INLQFVPNLIPVKRGMMSSIYLELEEGVSLTDVREALLKDSSFVFIDEEKA---
ARGC_ARATH      -----------VAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEG-
ARGC2_DEIRA     ----------------------------------------------------------------------
ARGC_RHIME      ----------------------------------------------------------------------
ARGC_PHOLL      ----------------------------------------------------------------------
ARGC_OCEIH      --------SQHVEESSVRVTLTTHLIPMTRGLMCTMYAPLQQDIDTADVIDLYKHYEQSSFIRIRKQGEY
ARGC_JANSC      ----------------------------------------------------------------------
ARGC_BACSK      ----------------------------------------------------------------------
ARGC_AERS4      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLITAKKKAA
DHAS_AQUAE      PMPIMAEGRDEVFVGRIRKDRVFEPGLSMWVVADNIRKGAATNAVQIAELLVKEGLI-------
DHAS_RICFE      ISPVEVVGEDAVYVSRIRNDVSKPNAINLWITCDNLRKGAALNSVQIAEELINNYL--------
DHAS_RICCN      ISPVEVVGEDAVYVSRIRNDVSRDNTINLWITCDNLRKGAALNSVQIAEELINNYL--------
DHAS_RICTY      ISPIEVVGKDAVYVSRIRNDLSKENTINLWITCDNLRKGAALNSVQIAEELINNYL--------
DHAS_RICPR      ISPIEVVGEDAVYVSRIRNDLSKDNTINLWITCDNLRKGAALNSVQIAEALINNYL--------
DHAS_VIBCH      PTQVDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
DHAS_LEGPN      PTAIKAVGHDDVFVGRIRQDISHPCGLNLWIVADNIRKGAATNAVQIAEIL-------------
DHAS_SHEVI      PTAVESAGTDPVYVGRVRKDISHSHGINLWVVSDNIRKGAALNSVQIAEVLI------------
DHAS_RICBR      ISPTEVVGEDAVYVSRIRDDESKENAINLWITCDNLRKGAALNSVQIAEELIKTYL--------
DHAS_SHESP      PTAVESAGTDPVYVGRVRKDISHSHGINLWVVSDNIRKGAALNSVQIAEVLI------------
DHAS_CAMJE      PMPLMTSDTNETYVGRIRADVYDKKILHLWCVADQIRVGAATNAVRIAQKWLELK---------
DHAS_VIBMI      PTQVDAGGKDHVLVGRVRNDISHHSGVNLWVVADN-----------------------------
DHAS_STRAK      PTPLQAAGKDPSYVGRIRSDETVDNGLALFVSNDNLRKGAALNAVQIAELV-------------
DHAS_PROMA      PMPIDVTGKDDIAVGRIRQDLSNPKALELWLCGDQIRKGAALNAIQIAELLLTR----------
DHAS_STRMU      PQAANAVGSRETFVGRIRKDLDIENGIHMWVVSDNLLKGAAWNSVQIAESLHERGLV-------
DHAS_BACSU      PMPADAVGKNDVFVGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV-------
DHAS_MYCTU      PTPLAAAGVDESLVGRIRRDPGVPDGLALFVSGDNLRKGAALNTIQIAELL-------------
DHAS_MYCBO      PTPLAAAGVDESLVGRIRRDPGVPDGLALFVSGDNLRKGAALNTIQIAELL-------------
DHAS_HELPJ      PTPLKASHTDSVFIGRLRKDLFDKKTLHGFCVADQLRVGAATNALKIA----------------
DHAS_HELPY      PTPLKASHTDSVFIGRLRKDLFDKKTLHGFCVADQLRVGAATNALKIA----------------
DHAS_MYCSM      PTPLAAAGIDDCLVGRIRQDPGVPDGLALFVSGDNLRKGAALNTIQIAELL-------------
DHAS_CORGL      PTPLAAAGIDESLVGRIRQDSTVDDGLVLVVSGDNLRKGAALNTIQIAELLV------------
DHAS_CORML      PTPLAAAGIDESLVGRIRQDSTVDDGLVLVVSGDNLRKGAALNTIQIAELLV------------
DHAS_CORFL      PTPLAAAGIDESLVGRIRQDSTVDDGLVLVVSGDNLRKGAALNTIQIAELLV------------
DHAS_SYNY3      PMPMDATGQDDVLVGRIRQDISHPNGLDLWLCGDQIRKGAALNAVQIAELLVER----------
USG_PSEAE       PTVVDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKGAALNAVLLGELLIKHYL--------
USG_AZOVI       IG--DAVGQDVAYVGRVRTGVDDACELDLWIASDNVRKGSALNAVQLAELLIKQ----------
USG_ECOLI       VG--DASGTPHLSVGCVRNDYGMPEQVQFWSVADNVRFGGALMAVKIAEKLVQEYL--------
DHAS_ARCFU      -RPQPRLDRDAITVGRIRKDG--ERGLKYIVLGHNTVRGAAGASILNAELMIKEKII-------
DHAS_METJA      LDRNEGNGM-SIVVGRIRKDPIFD--VKYTALEHNTIRGAAGASVLNAEYFVKK----------
DHAS_METTH      RMDRDMDGGMAVTVGRLREDAAFKNSLRYVLVGHNTVRGAALNAELINEIL-------------
DHAS_LEPIN      ----------------------------------------------------------------
DHAS_LEPIC      ----------------------------------------------------------------
DHAS_YEAST      SAPKQTRNRDSGYVGRIREDPLLDFKMVV--LSHNTIIGAAGSGVLIAEILLARNLI-------
DHAS_PSEAE      LTPAAVTGTLSVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPLRRMLRILLER----------
DHAS_HAEIN      LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
DHAS_BUCAI      LTPSSVTGTLNIPIGRLRKLNMGKKYLSAFTVGDQLLWGAAEPLRRMLNILIN-----------
DHAS_SHIFL      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_ECOLI      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_ECOL6      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_ECO57      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_SALTY      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_SALTI      LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
DHAS_ACTPL      ----------------------------------------------------------------
DHAS_NEIMB      ITPAKVTGTLSVPVGRIRKLGMGGEYISAFTVGDQLLWGAA-----------------------
DHAS_NEIMA      ITPAKVTGTLSVPVGRIRKLEMGGEYISAFTVGDQLLWGAA-----------------------
DHAS_BORPE      LTPVAVTGTLDIPVGRLRKLSMGLQYLGAFTVGDQLLWGAA-----------------------
DHAS_BUCBP      LTPAAVTGTLNTPVGRLRKLNIGQKYLSAFTVGDQLLWGAS-----------------------
DHAS_BUCAP      LTPSAVTDTLNIPIGRLRKLNIDDRYLSAFTVGDQLLWGAAEPLRRMLNLLVN-----------
DHAS_SCHPO      QPRLDRNNENAVSVGRIRSDSIFDIKFV--SLVHNTVLGAAGAGILNAEVAVKKGLM-------
ARGC_ARCFU      ----------------------------------------------------------------
USG_HAEIN       LNGEQENGEESVHLSQI---SAVENGVEFWSVADEQRFNLALLSVKLLE---------------
DHAS_AZOVI      LSPAAITGTLTVPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPVRRMLLILLER----------
ARGC_MORAB      DLAWQQQGQDLIVVSAI----------------DNLLKGAAAQAMQCINIRFGFAMTTS-----
ARGC_KOSOT      PSTKWTYGSNHAFISMAKDDRT--DTLILISVIDNLVKGASGQAVQNMNVMFS-----------
ARGC_GEOTN      PATKEVYGSNYCDIGLAYDERT--GRVTVVSVIDNLMKGAAGQAVQ------------------
ARGC_GEOKA      PATKEVYGSNYCDIGLAYDERT--GRVTVVSVIDNLMKGAAGQAVQ------------------
ARGC_BACHD      PATKEVFGSNRCHIGVTYDERT--NRITVVSVIDNLVKGAAGQAIQNYNVM-------------
ARGC_BACSU      PQTKEVYGSNFCDIAVTLDERT--NRVTIVSVIDNLMKGAAGQAVQ------------------
ARGC_NEIMB      ----------------------------------------------------------------
ARGC_NEIMA      ----------------------------------------------------------------
ARGC_NEIM0      ----------------------------------------------------------------
ARGC_METST      ----------------------------------------------------------------
ARGC_LISMC      PTVKQVTASNYCDIGLAYNEKT--NVITIVSVLDNLVKGAAGQAIQNLNIMAN-----------
ARGC_METKA      ----------------------------------------------------------------
ARGC_LISIN      PTVKQVTASNYCDIGLAYNEKT--NVITIVSVIDNLVKGAAGQAIQNLNIMAN-----------
ARGC_LISMF      PTVKQVTASNYCDIGLAYNEKT--NVITIVSVIDNLVKGAAGQAIQNLNIMAN-----------
ARGC_ALKMQ      VLPQTKAVSGSNYCDGFKVDPRT-NGLIVVSAIDNLVKGAAGQAVQNMNMMLGLK---------
ARGC_NEIMF      ----------------------------------------------------------------
ARGC_MORPR      ----------------------------------------------------------------
ARGC_METTH      ----------------------------------------------------------------
ARGC_STAES      PQLNEVIGTNYTDIGFVYNETT--GVLTISSVIDNLIKGAAGQAIQNMNLMFN-----------
ARGC_SILPO      ----------------------------------------------------------------
ARGC_STAEQ      PQLNEVIGTNYTDIGFVYNETT--GVLTISSVIDNLIKGAAGQAIQNMNLMFN-----------
ARGC_MAGSM      PATSDVRGSNACHMG--VTEDLRSGWLIIVSVIDNLVKGASGAAVQ------------------
ARGC_BACCN      ----------------------------------------------------------------
ARGC_NEIG2      ----------------------------------------------------------------
ARGC_NEIG1      ----------------------------------------------------------------
ARGC_HELMI      PQTKWSYGSNHAYIG--LTVEARTGRVIITTAIDNLVKGASGQAIQNMNIL-------------
ARGC_BACC4      ----------------------------------------------------------------
ARGC_SILST      ----------------------------------------------------------------
ARGC_PELPD      ----------------------------------------------------------------
ARGC_BACST      PATKDVYGSNYCDIGLAYDERT--ERVTVVSVIDNLMKGAAGQAVQ------------------
ARGC_CHLTE      ANPFVRLRDGVTEVSHVACDISLDGSLVIITAIDNLVKGAAGQAVQNMNLML------------
ARGC_DEHE1      ITPHTTRGTNMCFIYPV-VDALNERLIVISCI-DNLVKGAAGQAVQNMNIMLGLSEDTGLKAIA
ARGC_THESQ      PSTKWCYGSNHVFIGMQMEERT--NTLILMSAIDNLVKGASGQAVQNMNIM-------------
ARGC_PYRHO      ----------------------------------------------------------------
ARGC_THEP1      PSTKWCYGSNHVFIGMQMEERT--NTLILMSAIDNLVKGASGQAVQNMNIM-------------
ARGC_THEMA      VLPYPSTGSNHVFIGMQMEERT--NTLILMSAIDNLVKGASGQAVQNMNIM-------------
ARGC_LISW6      PTVKQVTASNYCDIGLAYNEIT--NVITIVSVIDNLVKGAAGQAIQNLNIMAN-----------
ARGC_NITEU      ----------------------------------------------------------------
ARGC_AGRRK      INAVELAGKDTMKLFVFGTPGTSQVNLV--ALLDNLGKGASGAAVQNMDLMLS-----------
ARGC_CLOB8      ----------------------------------------------------------------
ARGC_CALMQ      ----------------------------------------------------------------
ARGC_XYLFT      ----------------------------------------------------------------
ARGC_XYLFA      ----------------------------------------------------------------
ARGC_XYLF2      ----------------------------------------------------------------
ARGC_PELTS      LPQIKVAGTNHCDIG-LTVDRRTGRVVVLSAI-DNLVKGASGQAVQNMNII-------------
ARGC_METTP      ----------------------------------------------------------------
ARGC_GEOSM      ----------------------------------------------------------------
ARGC_GEOSL      ----------------------------------------------------------------
ARGC_DESAP      ----------------------------------------------------------------
ARGC_CLOTH      PETKFVAGSNFIDIGLV-VDKRL-NRVVILSAIDNLGKGAAGQAVQVLNIL-------------
ARG56_DICDI     PEVKSNSGKHTVTIGGFAVN---GNHLVVVTTLDNLLKGAATQALQ------------------
ARGC_PSYWF      ----------------------------------------------------------------
ARGC_METVS      ----------------------------------------------------------------
ARGC_GEOBB      ----------------------------------------------------------------
ARGC_STAAR      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTTGLKQS-
ARGC_STAAN      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAAM      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAA1      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_LISMH      PTVKQVTASNYCDIGLAYNEKT--NVITIVSVIDNLVKGAAGQAIQNLNIMAN-----------
ARGC_HALWD      ----------------------------------------------------------------
ARGC_SALTY      ----------------------------------------------------------------
ARGC_SALTI      ----------------------------------------------------------------
ARGC_SALPA      ----------------------------------------------------------------
ARGC_PYRFU      ----------------------------------------------------------------
ARGC_GEOSF      ----------------------------------------------------------------
ARGC_OCHA4      VDAEELAGKDGMKLFVFGTEG--DGEVNLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_METMP      ----------------------------------------------------------------
ARGC_JANMA      ----------------------------------------------------------------
ARGC_HERAR      ----------------------------------------------------------------
ARGC_GEOUR      ----------------------------------------------------------------
ARG56_CANAL     ----------------------------------------------------------------
ARGC_METJA      ----------------------------------------------------------------
ARGC_EXIS2      IRVGQAAGSNYCDIS-VYLD-TRTGRLTVVSVLDNMQKGAAGQAIQNANVI-------------
ARGC_ECOL6      ----------------------------------------------------------------
ARGC_BACLD      PATKEVYGSNFCDIGVTVDERT--NRVTIVSVIDNLMKGAAGQAVQ------------------
ARGC_SULSO      ----------------------------------------------------------------
ARGC_RHOCA      ----------------------------------------------------------------
ARGC_PYRKO      ----------------------------------------------------------------
ARGC_LISMO      PTVKQVTASNYCDIGLAYNEKT--NVITIVSVIDNLVKGAAGQAIQNLNIMAN-----------
ARGC_BRUSU      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUSI      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUMB      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUC2      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUAB      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUA2      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BRUA1      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BACWK      PSPKEVRGSNYCDIG-IAYDERTERVTVV-SVIDNMMKGAAGQAVQNANLL-------------
ARGC_BACCQ      ----------------------------------------------------------------
ARGC_BACC7      ----------------------------------------------------------------
ARGC_BACC1      ----------------------------------------------------------------
ARGC_STRSV      VRIQAALPNLHQVVGTNYTDNPVTNILTVVAVLDNLIKGAAGQAVQNMNLML------------
ARGC_STRMU      ----------------------------------------------------------------
ARGC_STAAW      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAAS      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAAC      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAA8      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_STAA3      PTTKEVLGSNYCDIG-IYVDETTQTA-ILVSVIDNLVKGASGQAIQNLNILYDFEVTT------
ARGC_PELCD      ----------------------------------------------------------------
ARGC_NITOC      ----------------------------------------------------------------
ARGC_METB6      ----------------------------------------------------------------
ARGC_IGNH4      ----------------------------------------------------------------
ARGC_DESPS      VLPLGSA--PATQYVRFAIDQTTGRIIVMSAI-DNVVKGAAGQAVQNMNIM-------------
ARGC_BACC3      ----------------------------------------------------------------
ARGC_BACAN      ----------------------------------------------------------------
ARGC_BACAC      ----------------------------------------------------------------
ARGC_BACAA      ----------------------------------------------------------------
ARGC_SHIFL      ----------------------------------------------------------------
ARGC_PYRAB      ----------------------------------------------------------------
ARGC_DICTD      SPEIKKVRGTNWAVISAQADKNTKNAVILVAI-DNLIKGAAGQAIQNMNIM-------------
ARGC_ACIF5      ----------------------------------------------------------------
ARGC_ACIF2      ----------------------------------------------------------------
ARGC_ECOLI      ----------------------------------------------------------------
ARGC_BRUO2      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_THET2      ----------------------------------------------------------------
ARGC_SULTO      ----------------------------------------------------------------
ARGC_ECO57      ----------------------------------------------------------------
ARGC_BRUME      VDAEELAGKDGMKLFVFGTE---DHGQVLVALLDNLGKGASGAAVQNMNLMLGK----------
ARGC_BACA2      ----------------------------------------------------------------
ARG56_SCHPO     ----------------------------------------------------------------
ARGC_METM7      ----------------------------------------------------------------
ARGC_RHILW      ----------------------------------------------------------------
ARGC_GEOMG      ----------------------------------------------------------------
ARG56_NEUCR     ----------------------------------------------------------------
ARGC_SHEON      ----------------------------------------------------------------
ARGC_SHELP      ----------------------------------------------------------------
ARGC_RHIE6      ----------------------------------------------------------------
ARGC_PYRAE      ----------------------------------------------------------------
ARGC_PSYCK      ----------------------------------------------------------------
ARGC_PELPB      -TMTEVRHVAHTNFCDIHIAHATANGLIIVTAIDNLLKGAAGQAIQNMNLML------------
ARGC_METM5      ----------------------------------------------------------------
ARGC_BURCM      ----------------------------------------------------------------
ARGC_AGRT5      IDAEELAGKDTMKLFVFGTPGGEHINLV--ALLDNLGKGASGAAVQNMELMLS-----------
ARGC_METM6      ----------------------------------------------------------------
ARGC_META3      ----------------------------------------------------------------
ARGC_BURS3      ----------------------------------------------------------------
ARGC_AGRVS      VDAEELVGQDTMKLFAFGNPGTGHVNLV--AVLDNLGKGASGAAVQNMDLMLS-----------
ARGC_YERPE      ----------------------------------------------------------------
ARGC_SHEB5      ----------------------------------------------------------------
ARGC_RHOBA      ----------------------------------------------------------------
ARGC_RHISN      IDATELAGKDTMKLFVFGTPGGAHVNLV--ALLDNLGKGASGAAVQNMDLMLS-----------
ARGC_RHIET      ----------------------------------------------------------------
ARGC_RHIEC      ----------------------------------------------------------------
ARGC_PSYA2      ----------------------------------------------------------------
ARGC_PYRIL      ----------------------------------------------------------------
ARGC_NITEC      ----------------------------------------------------------------
ARGC_CLONN      ----------------------------------------------------------------
ARGC_SHEWM      ----------------------------------------------------------------
ARGC_SHEB8      ----------------------------------------------------------------
ARGC_SHEB2      ----------------------------------------------------------------
ARGC_RHIL3      ----------------------------------------------------------------
ARGC_HALMA      ----------------------------------------------------------------
ARGC_SYNFM      ----------------------------------------------------------------
ARGC_SULDN      ----------------------------------------------------------------
ARGC_SHESR      ----------------------------------------------------------------
ARGC_SHESM      ----------------------------------------------------------------
ARGC_SHESA      ----------------------------------------------------------------
ARGC_PYRCJ      ----------------------------------------------------------------
ARGC_CELJU      ----------------------------------------------------------------
ARGC_BACAM      PQTKEVYGSNFCDIGVTLDERT--NRVTIVSVIDNLMKGAAGQAVQ------------------
ARGC_YERPS      ----------------------------------------------------------------
ARGC_SHEB9      ----------------------------------------------------------------
ARGC_RALSO      ----------------------------------------------------------------
ARGC_ORYSJ      ----------------------------------------------------------------
ARGC_SINMW      IDATELAGKDTMKLFVFGTDGGAHVNMV--ALLDNLGKGASGAAVQNMDLMLS-----------
ARGC_ALTMD      ----------------------------------------------------------------
ARGC2_ANASP     ----------------------------------------------------------------
ARGC_UNCMA      ----------------------------------------------------------------
ARGC_CLOBB      ----------------------------------------------------------------
ARGC_NATPD      ----------------------------------------------------------------
ARGC_EHRCJ      ITTRSVVGTNYCYLGIF--PGRLPNTIVIISVIDNLLKGAAGQAVQNFNVMMS-----------
ARGC_CLOK5      ----------------------------------------------------------------
ARGC_CLOK1      ----------------------------------------------------------------
ARGC_ANAVT      ----------------------------------------------------------------
ARGC2_PSEPK     ----------------------------------------------------------------
ARGC_STAS1      ----------------------------------------------------------------
ARGC_SHEFN      ----------------------------------------------------------------
ARGC_SHEDO      ----------------------------------------------------------------
ARGC_HALOH      ----------------------------------------------------------------
ARGC_EHRCR      MTTRSVVGTNYCYLGVF--PGRVPNTIIIMSVIDNLLKGAAGQAVQNFNVMMS-----------
ARGC_ARATH      VVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIML------------
ARGC2_DEIRA     ----------------------------------------------------------------
ARGC_RHIME      ----------------------------------------------------------------
ARGC_PHOLL      ----------------------------------------------------------------
ARGC_OCEIH      PSTKDVTGSNYCDIGAYVDKRT--NQLIISSAIDNLVKGAAGQAIQNINVM-------------
ARGC_JANSC      ----------------------------------------------------------------
ARGC_BACSK      ----------------------------------------------------------------
ARGC_AERS4      ----------------------------------------------------------------