[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE37891.1

[Show Plain Result]


## Summary of Sequence Search
    1::519
   69::351     3e-33  28%  600 aa  NU5M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   89::401     2e-32  32%  681 aa  NU5C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
   70::353     1e-29  28%  613 aa  NUOL_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit L;    
   81::370     6e-29  30%  748 aa  NU5C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::385     4e-28  27%  744 aa  NU5C_DAMDI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::351     5e-28  27%  658 aa  NU5M_PENMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     5e-28  33%  740 aa  NU5C_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::351     7e-28  34%  656 aa  NU5M_CRYPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     7e-28  32%  739 aa  NU5C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     7e-28  32%  739 aa  NU5C_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::401     9e-28  32%  740 aa  NU5C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::401     1e-27  32%  664 aa  NU5C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
   73::355     1e-27  34%  615 aa  NUOL_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   74::351     1e-27  32%  656 aa  NU5M_ASPNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   60::340     1e-27  33%  606 aa  NQO12_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 12;  
   69::360     2e-27  26%  670 aa  NU5M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   91::369     2e-27  28%  663 aa  NU5C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   84::393     3e-27  29%  633 aa  NUOL_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit L;    
   69::360     3e-27  26%  670 aa  NU5M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   70::351     3e-27  27%  715 aa  NU5M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     3e-27  28%  750 aa  NU5C_TECST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-27  29%  752 aa  NU5C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::350     7e-27  28%  606 aa  NU5M_CERSI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     7e-27  32%  742 aa  NU5C_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     7e-27  28%  757 aa  NU5C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::401     9e-27  27%  720 aa  NU5C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::362     1e-26  30%  653 aa  NUOL_RICPR RecName: Full=NADH-quinone oxidoreductase subunit L;    
   79::350     1e-26  28%  606 aa  NU5M_RHIUN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   81::385     1e-26  26%  740 aa  NU5C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   82::353     2e-26  28%  609 aa  NU5M_HALGR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     2e-26  28%  748 aa  NU5C_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-26  28%  742 aa  NU5C_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-26  28%  749 aa  NU5C_ATRJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::351     2e-26  30%  652 aa  NU5M_PODAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   99::361     2e-26  28%  666 aa  NU5M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   69::360     2e-26  26%  669 aa  NU5M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     3e-26  28%  603 aa  NU5M_RABIT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   82::353     3e-26  32%  609 aa  NU5M_PHOVI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     3e-26  28%  743 aa  NU5C_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-26  28%  741 aa  NU5C_FLARA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-26  28%  743 aa  NU5C_AMBTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::350     4e-26  31%  603 aa  NU5M_PAPHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     4e-26  31%  606 aa  NU5M_BALPH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     4e-26  31%  606 aa  NU5M_BALMU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     4e-26  28%  741 aa  NU5C_CICIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::364     4e-26  35%  741 aa  NU5C_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  101::374     5e-26  27%  686 aa  NU5M_SCHCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   81::385     5e-26  26%  740 aa  NU5C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::385     5e-26  26%  739 aa  NU5C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::385     5e-26  26%  737 aa  NU5C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::385     5e-26  26%  740 aa  NU5C_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::385     5e-26  26%  740 aa  NU5C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     5e-26  28%  735 aa  NU5C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::350     6e-26  28%  594 aa  NU5M_HIPAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   77::350     6e-26  33%  657 aa  NU5M_EMENI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   95::380     6e-26  28%  745 aa  NU5C_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     6e-26  27%  744 aa  NU5C_ADEHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     8e-26  28%  747 aa  NU5C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::361     1e-25  38%  605 aa  NU5M_STRCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   69::358     1e-25  27%  664 aa  NU5M_PHYIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     1e-25  30%  606 aa  NU5M_FELCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     1e-25  31%  606 aa  NU5M_CANLU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     1e-25  28%  750 aa  NU5C_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::370     1e-25  28%  744 aa  NU5C_GERJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     1e-25  27%  741 aa  NU5C_ATHGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   77::345     2e-25  34%  604 aa  NU5M_HORSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     2e-25  34%  606 aa  NU5M_EQUAS RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     2e-25  27%  709 aa  NU5C_PACAQ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-25  27%  741 aa  NU5C_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   75::362     2e-25  34%  653 aa  NUOL_RICTY RecName: Full=NADH-quinone oxidoreductase subunit L;    
   74::350     2e-25  32%  692 aa  NU5M_TRIRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   73::350     2e-25  32%  609 aa  NU5M_SCYCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     2e-25  27%  603 aa  NU5M_LEMCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   66::357     2e-25  29%  675 aa  NU5M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::369     2e-25  32%  744 aa  NU5C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   73::362     2e-25  29%  699 aa  NU5C_DIGGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::370     3e-25  29%  749 aa  NU5C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::373     3e-25  30%  746 aa  NU5C_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::350     4e-25  30%  606 aa  NU5M_SORFM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   76::346     4e-25  26%  599 aa  NU5M_GEOPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::346     4e-25  30%  601 aa  NU5M_DASNO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     4e-25  27%  710 aa  NU5C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::370     4e-25  27%  734 aa  NU5C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::347     5e-25  27%  606 aa  NU5M_PIG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
   79::347     5e-25  30%  603 aa  NU5M_DUGDU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     5e-25  40%  746 aa  NU5C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   76::350     7e-25  26%  602 aa  NU5M_DIDMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   67::357     7e-25  28%  668 aa  NU5M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::385     7e-25  27%  740 aa  NU5C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     7e-25  27%  707 aa  NU5C_MALAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   71::361     9e-25  28%  645 aa  NUOL_RICFE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   79::351     9e-25  26%  653 aa  NU5M_TRIRU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     9e-25  30%  606 aa  NU5M_SHEEP RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   72::350     1e-24  29%  598 aa  NU5M_PETMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     1e-24  26%  603 aa  NU5M_PANTR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     1e-24  27%  739 aa  NU5C_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   73::377     1e-24  29%  695 aa  NU5C_CAPBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   67::357     2e-24  28%  670 aa  NU5M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     2e-24  30%  606 aa  NU5M_BOVIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     2e-24  29%  603 aa  NU5M_PANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   80::386     2e-24  27%  666 aa  NU5C1_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::347     3e-24  31%  610 aa  NU5M_RAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
   79::347     3e-24  30%  606 aa  NU5M_BOSIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     3e-24  27%  741 aa  NU5C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   72::349     3e-24  34%  612 aa  NU5M_CHIMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     3e-24  30%  606 aa  NU5M_CANFA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   81::364     3e-24  31%  738 aa  NU5C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-24  28%  744 aa  NU5C_CICAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::376     3e-24  27%  746 aa  NU5C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   84::353     4e-24  32%  613 aa  NU5M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   80::349     4e-24  27%  602 aa  NU5M_MACRO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     4e-24  31%  603 aa  NU5M_GORGO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::371     4e-24  33%  747 aa  NU5C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::370     4e-24  34%  734 aa  NU5C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   66::342     6e-24  25%  596 aa  NUOL_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit L;    
   61::346     6e-24  27%  684 aa  NU5C_SESIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     6e-24  29%  738 aa  NU5C_LIGVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   69::358     6e-24  28%  801 aa  MRPA_BACSU RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
   79::347     7e-24  36%  605 aa  NU5M_ROUAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  110::371     7e-24  29%  772 aa  NU5C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::371     7e-24  29%  772 aa  NU5C_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::371     7e-24  29%  777 aa  NU5C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::371     7e-24  29%  772 aa  NU5C_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  110::371     7e-24  29%  772 aa  NU5C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::370     1e-23  32%  739 aa  NU5C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     1e-23  31%  741 aa  NU5C_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::351     1e-23  29%  607 aa  NU5M_MOUSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  240::370     1e-23  41%  741 aa  NU5C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   71::345     2e-23  34%  654 aa  NUOL_STRCO RecName: Full=NADH-quinone oxidoreductase subunit L;    
  240::401     2e-23  36%  702 aa  NU5C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-23  27%  746 aa  NU5C_VICFA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::371     2e-23  32%  740 aa  NU5C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   79::350     2e-23  30%  603 aa  NU5M_HYLLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   77::354     3e-23  25%  614 aa  NUOL_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit L;    
   80::344     3e-23  32%  605 aa  NU5M_CHICK RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   89::401     3e-23  28%  670 aa  NU5C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  143::401     3e-23  29%  648 aa  NU5C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   75::349     4e-23  32%  604 aa  NU5M_ORNAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   81::350     5e-23  35%  603 aa  NU5M_PONPY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   84::353     5e-23  30%  612 aa  NU5M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::347     6e-23  26%  654 aa  NU5M_RHIST RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::364     6e-23  32%  739 aa  NU5C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   73::345     8e-23  31%  604 aa  NU5M_XENLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::372     8e-23  32%  749 aa  NU5C_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   99::363     1e-22  26%  669 aa  NU5M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  240::364     1e-22  42%  738 aa  NU5C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   62::336     1e-22  29%  546 aa  NU5M_CHLRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  240::364     1e-22  41%  738 aa  NU5C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     1e-22  32%  750 aa  NU5C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   78::353     2e-22  29%  612 aa  NU5M_CROLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   64::339     2e-22  25%  598 aa  NU5M_BRALA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  232::356     2e-22  41%  702 aa  NU5C_POAPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-22  36%  746 aa  NU5C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::362     2e-22  27%  742 aa  NU5C_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     2e-22  40%  743 aa  NU5C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-22  26%  743 aa  NU5C_CARTI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   89::370     2e-22  26%  772 aa  NU5C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   72::362     2e-22  30%  657 aa  NUOL_RICCN RecName: Full=NADH-quinone oxidoreductase subunit L;    
   75::349     2e-22  29%  607 aa  NU5M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     2e-22  35%  746 aa  NU5C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-22  27%  751 aa  NU5C_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::370     2e-22  27%  743 aa  NU5C_CARCG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   81::350     3e-22  35%  603 aa  NU5M_PONAB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   75::349     3e-22  29%  607 aa  NU5M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     3e-22  26%  744 aa  NU5C_MUTAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-22  39%  746 aa  NU5C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     3e-22  38%  741 aa  NU5C_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     4e-22  38%  746 aa  NU5C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     4e-22  40%  741 aa  NU5C_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     4e-22  39%  739 aa  NU5C_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   93::349     5e-22  27%  601 aa  NU5M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   82::353     5e-22  35%  606 aa  NU5M_LOXAF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   64::340     5e-22  26%  599 aa  NU5M_BRAFL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     5e-22  38%  740 aa  NU5C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   52::361     5e-22  32%  798 aa  MNHA2_STAS1 RecName: Full=Putative antiporter subunit
   74::361     7e-22  33%  800 aa  MNHA2_STAES RecName: Full=Putative antiporter subunit
   74::361     7e-22  33%  800 aa  MNHA2_STAEQ RecName: Full=Putative antiporter subunit
   17::307     9e-22  30%  552 aa  NU5M_CANAL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   62::349     9e-22  27%  641 aa  NU5M_ALLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  240::370     9e-22  38%  741 aa  NU5C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     1e-21  40%  739 aa  NU5C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  237::364     2e-21  37%  642 aa  NUOL_RICBR RecName: Full=NADH-quinone oxidoreductase subunit L;    
   79::353     2e-21  26%  612 aa  NU5M_ONCMY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     2e-21  26%  745 aa  NU5C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-21  27%  746 aa  NU5C_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-21  26%  741 aa  NU5C_ASTCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   78::355     2e-21  25%  621 aa  NUOL_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit L;    
   79::353     2e-21  28%  612 aa  NU5M_SALSA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     2e-21  26%  741 aa  NU5C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-21  37%  746 aa  NU5C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  143::370     2e-21  45%  741 aa  NU5C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   74::351     3e-21  32%  610 aa  NU5M_SQUAC RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::350     3e-21  30%  603 aa  NU5M_HUMAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  143::372     3e-21  30%  760 aa  NU5C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  143::372     3e-21  30%  760 aa  NU5C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     3e-21  48%  746 aa  NU5C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     3e-21  48%  746 aa  NU5C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     3e-21  48%  746 aa  NU5C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     3e-21  26%  741 aa  NU5C_ANIIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   95::350     3e-21  32%  603 aa  NU5M_MYOGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   78::352     3e-21  27%  611 aa  NU5M_LATCH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
    4::124     3e-21  41%  124 aa  NU5C_PEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   66::362     5e-21  30%  712 aa  NUOL_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit L;    
   52::332     5e-21  27%  662 aa  NU5M_CRYNV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   79::353     6e-21  33%  612 aa  NU5M_TETNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   30::303     6e-21  29%  555 aa  NU5M_CANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     6e-21  26%  746 aa  NU5C_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   96::373     1e-20  30%  999 aa  PHAAB_RHIME RecName: Full=Probable K(+)/H(+) antiporter subunit
  258::386     1e-20  38%  637 aa  NU5M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   64::404     1e-20  29%  703 aa  NQO12_PARDE RecName: Full=NADH-quinone oxidoreductase chain 12;    
   63::361     2e-20  29%  800 aa  MNHA2_STAHJ RecName: Full=Putative antiporter subunit
  103::333     3e-20  33%  674 aa  NU5M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     3e-20  25%  732 aa  NU5C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     4e-20  49%  738 aa  NU5C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     4e-20  49%  738 aa  NU5C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     5e-20  49%  739 aa  NU5C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  257::381     7e-20  39%  638 aa  NU5M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   69::339     7e-20  26%  590 aa  NU5M_DINSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   98::353     9e-20  35%  606 aa  NU5M_ELEMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   68::359     9e-20  28%  805 aa  MNHA1_STAS1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::343     1e-19  38%  644 aa  NU5M_PICCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   80::345     3e-19  27%  605 aa  NU5M_PELSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   95::350     3e-19  35%  603 aa  NU5M_MAMPR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   85::370     4e-19  26%  739 aa  NU5C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  139::366     7e-19  28%  674 aa  NUOL_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit L;    
  139::366     7e-19  28%  674 aa  NUOL_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit L;    
   60::361     7e-19  25%  805 aa  MRPA_BACPF RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
   74::348     9e-19  27%  606 aa  NU5M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   89::370     1e-18  30%  670 aa  NU5C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  178::298     2e-18  35%  547 aa  NU5M_ASCSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  247::408     2e-18  35%  655 aa  NU5C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   85::370     2e-18  37%  740 aa  NU5C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     2e-18  38%  734 aa  NU5C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     2e-18  38%  734 aa  NU5C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     2e-18  38%  734 aa  NU5C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::364     2e-18  38%  734 aa  NU5C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  240::370     6e-18  37%  652 aa  NU5C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   78::343     8e-18  32%  615 aa  NUOL_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit L;    
  240::370     8e-18  38%  754 aa  NU5C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  102::325     1e-17  34%  655 aa  NU5M_YARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  240::370     2e-17  34%  729 aa  NU5C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   69::368     2e-17  28%  803 aa  MNHA1_STAHJ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  240::370     3e-17  35%  692 aa  NU5C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
   69::360     4e-17  27%  801 aa  MNHA1_STAES RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   69::360     4e-17  27%  801 aa  MNHA1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
 1456::1601    2e-16  31% 1849 aa  NU5H_NYCOV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
   84::375     3e-16  33%  643 aa  NU5M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  218::459     1e-15  32%  505 aa  NDHF_BACSU RecName: Full=Probable NADH-quinone oxidoreductase
   33::299     5e-15  27%  592 aa  NU5M_DEBHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   51::317     6e-15  32%  573 aa  NU5M_DROYA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  233::357     1e-14  37%  570 aa  NU5M_PARTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  241::364     1e-14  32%  618 aa  NU5C2_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
  220::348     3e-14  36%  479 aa  HYFD_ECOLI RecName: Full=Hydrogenase-4 component D;       
  222::359     4e-14  36%  801 aa  MNHA1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
  222::359     4e-14  36%  801 aa  MNHA1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
   41::300     5e-14  25%  545 aa  NU5M_ALBCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::361     2e-13  27%  800 aa  MNHA2_STAAR RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAW RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAU RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAT RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAS RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAN RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAM RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAE RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAAC RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAA9 RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAA8 RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAA3 RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAA2 RecName: Full=Putative antiporter subunit
   74::361     2e-13  27%  800 aa  MNHA2_STAA1 RecName: Full=Putative antiporter subunit
  191::317     3e-13  41%  572 aa  NU5M_DROME RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   74::361     3e-13  27%  800 aa  MNHA2_STAAB RecName: Full=Putative antiporter subunit
  193::317     1e-12  31%  574 aa  NU5M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
   46::311     7e-12  31%  552 aa  NU5M_RHISA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  177::297     9e-12  30%  527 aa  NU5M_CAEEL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  226::382     1e-10  32%  561 aa  NU4C2_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  224::378     4e-10  31%  560 aa  NU4C3_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-3;
  225::379     4e-10  31%  561 aa  NU4C2_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  228::355     4e-10  34%  526 aa  NU4C1_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  197::287     6e-10  39%  580 aa  NU5M_ANOGA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  197::287     6e-10  39%  384 aa  NU5M_ANOAR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  223::344     1e-09  34%  590 aa  NU5M_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  193::283     2e-09  39%  576 aa  NU5M_ANOQU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  197::287     2e-09  38%  580 aa  NU5M_AEDAE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  229::379     3e-09  30%  537 aa  NU4C3_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
  224::380     4e-09  29%  559 aa  NU4C2_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
  230::380     4e-09  30%  538 aa  NU4C1_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
   50::281     9e-09  32%  572 aa  NU5M_LOCMI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  251::444     9e-09  26%  551 aa  NU4C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  225::509     9e-09  30%  533 aa  NU4C1_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  225::509     9e-09  30%  533 aa  NU4C1_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  243::436     1e-08  26%  548 aa  NU4C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  226::380     1e-08  29%  553 aa  NU4C2_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  228::355     2e-08  31%  528 aa  NU4C1_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
   26::165     2e-08  30%  183 aa  NU5M_PEA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
  243::436     2e-08  26%  546 aa  NU4C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  225::384     2e-08  28%  550 aa  NU4C3_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
  251::437     3e-08  27%  563 aa  NU4C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  251::437     3e-08  27%  563 aa  NU4C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  231::424     3e-08  25%  533 aa  NU4C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  229::423     6e-08  26%  526 aa  NU4C2_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  250::390     8e-08  29%  546 aa  NU4C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  251::405     8e-08  26%  557 aa  NU4C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  250::390     8e-08  29%  546 aa  NU4C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  187::306     1e-07  29%  554 aa  NU5M_APILI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  229::356     1e-07  33%  534 aa  NU4C1_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  251::444     1e-07  25%  558 aa  NU4C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  255::395     1e-07  27%  544 aa  NU4C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  238::369     1e-07  28%  534 aa  NU4C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  238::369     1e-07  28%  534 aa  NU4C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  251::391     1e-07  29%  558 aa  NU4C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  238::369     1e-07  28%  534 aa  NU4C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  235::366     1e-07  28%  531 aa  NU4C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  197::239     2e-07  57%  265 aa  NU5M_ANOQN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  238::378     2e-07  28%  538 aa  NU4C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  238::378     2e-07  28%  538 aa  NU4C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  228::370     2e-07  28%  499 aa  NU4C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  232::516     2e-07  28%  534 aa  NU4C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  244::384     2e-07  27%  535 aa  NU4C2_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  228::418     2e-07  26%  527 aa  NU4C1_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  230::423     3e-07  27%  529 aa  NU4C1_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  244::384     4e-07  27%  534 aa  NU4C2_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  223::358     5e-07  27%  507 aa  NU4C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  225::352     5e-07  28%  526 aa  NU4C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
  230::419     5e-07  27%  525 aa  NU4C2_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
  230::419     5e-07  27%  525 aa  NU4C1_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  220::344     5e-07  32%  513 aa  NU2C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  224::478     6e-07  30%  500 aa  NU4C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::478     6e-07  30%  500 aa  NU4C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  227::414     6e-07  25%  525 aa  NU4C1_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-1;
  222::316     8e-07  35%  525 aa  NU2C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  229::356     1e-06  28%  527 aa  NU4C1_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
  224::359     1e-06  26%  503 aa  NU4C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  228::355     1e-06  29%  533 aa  NU4C2_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  232::425     1e-06  25%  534 aa  NU4C2_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  232::425     1e-06  25%  534 aa  NU4C2_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
  228::359     2e-06  26%  501 aa  NU4C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::356     2e-06  28%  500 aa  NU4C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  230::357     2e-06  27%  502 aa  NU4C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  238::332     2e-06  32%  513 aa  NU2C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  224::370     2e-06  27%  498 aa  NU4C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  222::316     2e-06  33%  515 aa  NU2C_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  232::364     2e-06  26%  513 aa  NQO13_PARDE RecName: Full=NADH-quinone oxidoreductase chain 13;    
  224::478     3e-06  30%  500 aa  NU4C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     3e-06  26%  500 aa  NU4C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  227::321     3e-06  34%  526 aa  NU2C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  223::317     4e-06  33%  521 aa  NU2C_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  223::317     4e-06  33%  521 aa  NU2C_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::320     4e-06  32%  500 aa  NU2C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  226::320     4e-06  33%  520 aa  NU2C_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::320     4e-06  33%  520 aa  NU2C_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
  226::358     5e-06  26%  491 aa  NUOM_RICPR RecName: Full=NADH-quinone oxidoreductase subunit M;    
  233::365     5e-06  26%  512 aa  NUOM_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit M;    
  224::370     7e-06  26%  497 aa  NU4C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     7e-06  28%  500 aa  NU4C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  190::279     9e-06  32%  640 aa  Y051_MYCTU RecName: Full=Uncharacterized protein Rv0083/MT0090;
  225::339     9e-06  31%  506 aa  NU4C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     9e-06  25%  500 aa  NU4C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::478     9e-06  29%  500 aa  NU4C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  222::316     9e-06  33%  497 aa  NU2C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  226::320     9e-06  33%  501 aa  NU2C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  224::478     1e-05  29%  500 aa  NU4C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     1e-05  27%  499 aa  NU4C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     1e-05  25%  500 aa  NU4C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::356     1e-05  28%  497 aa  NU4C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  239::366     2e-05  25%  509 aa  NUOM_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit M;    
  239::366     2e-05  25%  509 aa  NUOM_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit M;    
  224::478     2e-05  29%  500 aa  NU4C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     2e-05  23%  512 aa  NU4C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  217::349     3e-05  29%  486 aa  NUON_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit N;    
  224::359     3e-05  25%  500 aa  NU4C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  225::360     3e-05  25%  501 aa  NU4C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     3e-05  25%  502 aa  NU4C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::356     5e-05  25%  500 aa  NU4C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::320     5e-05  29%  498 aa  NU2C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  232::362     5e-05  29%  526 aa  HYFF_ECOLI RecName: Full=Hydrogenase-4 component F;       
  224::355     6e-05  26%  492 aa  NU4M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  224::359     6e-05  24%  500 aa  NU4C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     6e-05  24%  500 aa  NU4C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::320     6e-05  31%  501 aa  NU2C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
   51::318     8e-05  21%  568 aa  NU5M_MYTED RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  224::359     8e-05  24%  500 aa  NU4C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::356     8e-05  24%  500 aa  NU4C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     8e-05  24%  500 aa  NU4C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     8e-05  24%  500 aa  NU4C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     8e-05  24%  500 aa  NU4C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     8e-05  24%  500 aa  NU4C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::328     8e-05  29%  672 aa  HYFB_ECOLI RecName: Full=Hydrogenase-4 component B;       
  227::358     1e-04  29%  491 aa  NU4M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  229::356     1e-04  25%  500 aa  NU4C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     1e-04  25%  500 aa  NU4C_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     1e-04  24%  500 aa  NU4C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  224::359     1e-04  24%  500 aa  NU4C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     2e-04  24%  500 aa  NU4C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     2e-04  24%  516 aa  NU4C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  217::484     3e-04  31%  485 aa  NUON_PECCP RecName: Full=NADH-quinone oxidoreductase subunit N;    
   34::274     3e-04  30%  541 aa  NU5M_ARTSF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
  229::370     3e-04  24%  500 aa  NU4C_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     3e-04  24%  507 aa  NU4C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::370     3e-04  24%  500 aa  NU4C_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  229::359     3e-04  23%  500 aa  NU4C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
  226::320     3e-04  28%  502 aa  NU2C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
  217::383     4e-04  27%  485 aa  NUON_SHISS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_SHIFL RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_SHIBS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::449     4e-04  27%  485 aa  NUON_ENTS8 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOSM RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOSE RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOLC RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOHS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECOBW RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO8A RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO7I RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO5E RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO55 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO27 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     4e-04  27%  485 aa  NUON_ECO24 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     5e-04  27%  485 aa  NUON_SHIDS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     5e-04  27%  485 aa  NUON_SALCH RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::448     7e-04  26%  485 aa  NUON_ENT38 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  207::337     7e-04  28%  460 aa  NU4M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
  217::383     9e-04  27%  485 aa  NUON_SALTY RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALTI RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALSV RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALPB RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALPA RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALNS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALHS RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALG2 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALEP RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALDC RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALAR RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  27%  485 aa  NUON_SALA4 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  217::383     9e-04  26%  485 aa  NUON_CITK8 RecName: Full=NADH-quinone oxidoreductase subunit N;    
  206::336     9e-04  26%  459 aa  NU4M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
    1::519

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVSGTHVSPVLGLYGA
NU5M_METSE      ------------------------------------------------------------------LVTA
NU5C_SYNY3      ----------------------------------------------------------------------
NUOL_ECOLI      ----------------------------------------------------------------VGDFNI
NU5C_CUCSA      ----------------------------------------------------------------------
NU5C_DAMDI      ----------------------------------------------------------------------
NU5M_PENMA      ----------------------------------------------------------------------
NU5C_PIPCE      ----------------------------------------------------------------------
NU5M_CRYPA      ----------------------------------------------------------------------
NU5C_ACOCL      ----------------------------------------------------------------------
NU5C_ACOAM      ----------------------------------------------------------------------
NU5C_PSINU      ----------------------------------------------------------------------
NU5C_SYNP2      ----------------------------------------------------------------------
NUOL_PSEAE      -----------------------------------------------------------------GDFST
NU5M_ASPNG      ----------------------------------------------------------------------
NQO12_THET8     ------------------------------------------------------------------LPGI
NU5M_WHEAT      ------------------------------------------------------------------MFDA
NU5C_CHAVU      ----------------------------------------------------------------------
NUOL_MYCTU      ----------------------------------------------------------------------
NU5M_OENBE      ------------------------------------------------------------------MFDA
NU5M_NEUCR      -------------------------------------------------------------------YNI
NU5C_TECST      ----------------------------------------------------------------------
NU5C_MANES      ----------------------------------------------------------------------
NU5M_CERSI      ----------------------------------------------------------------------
NU5C_SPIOL      ----------------------------------------------------------------------
NU5C_DRIGR      ----------------------------------------------------------------------
NU5C_PHYPA      ----------------------------------------------------------------------
NUOL_RICPR      ----------------------------------------------------------------------
NU5M_RHIUN      ----------------------------------------------------------------------
NU5C_ATRBE      -------------------------------------------------------------------FSL
NU5M_HALGR      ----------------------------------------------------------------------
NU5C_PLAOC      ----------------------------------------------------------------------
NU5C_LACSA      ----------------------------------------------------------------------
NU5C_ATRJA      ----------------------------------------------------------------------
NU5M_PODAN      ----------------------------------------------------------------------
NU5M_CHOCR      ----------------------------------------------------------------------
NU5M_ARATH      ------------------------------------------------------------------MFDA
NU5M_RABIT      ----------------------------------------------------------------------
NU5M_PHOVI      ----------------------------------------------------------------------
NU5C_HELAN      ----------------------------------------------------------------------
NU5C_FLARA      ----------------------------------------------------------------------
NU5C_AMBTR      ----------------------------------------------------------------------
NU5M_PAPHA      ----------------------------------------------------------------------
NU5M_BALPH      ----------------------------------------------------------------------
NU5M_BALMU      ----------------------------------------------------------------------
NU5C_CICIN      ----------------------------------------------------------------------
NU5C_BRADI      ----------------------------------------------------------------------
NU5M_SCHCO      ----------------------------------------------------------------------
NU5C_TOBAC      -------------------------------------------------------------------FSL
NU5C_SOLTU      -------------------------------------------------------------------FSL
NU5C_SOLLC      -------------------------------------------------------------------FSL
NU5C_SOLBU      -------------------------------------------------------------------FSL
NU5C_NICSY      -------------------------------------------------------------------FSL
NU5C_GOSHI      ----------------------------------------------------------------------
NU5M_HIPAM      ----------------------------------------------------------------------
NU5M_EMENI      ----------------------------------------------------------------------
NU5C_GOSBA      ----------------------------------------------------------------------
NU5C_ADEHI      ----------------------------------------------------------------------
NU5C_LOTJA      ----------------------------------------------------------------------
NU5M_STRCA      ----------------------------------------------------------------------
NU5M_PHYIN      -----------------------------------------------------------------GLFNC
NU5M_FELCA      ----------------------------------------------------------------------
NU5M_CANLU      ----------------------------------------------------------------------
NU5C_SOYBN      ----------------------------------------------------------------------
NU5C_GERJA      ----------------------------------------------------------------------
NU5C_ATHGR      ----------------------------------------------------------------------
NU5M_HORSE      ----------------------------------------------------------------------
NU5M_EQUAS      ----------------------------------------------------------------------
NU5C_PACAQ      ----------------------------------------------------------------------
NU5C_GUIAB      ----------------------------------------------------------------------
NUOL_RICTY      -------------------------------------------------------------------FKV
NU5M_TRIRE      ----------------------------------------------------------------------
NU5M_SCYCA      ----------------------------------------------------------------MGPFNI
NU5M_LEMCA      ----------------------------------------------------------------------
NU5M_ACACA      ----------------------------------------------------------------IGLLKL
NU5C_PELHO      ----------------------------------------------------------------------
NU5C_DIGGR      ----------------------------------------------------------------------
NU5C_ILLOL      ----------------------------------------------------------------------
NU5C_AMBTC      ----------------------------------------------------------------------
NU5M_SORFM      ----------------------------------------------------------------------
NU5M_GEOPE      ----------------------------------------------------------------------
NU5M_DASNO      ----------------------------------------------------------------------
NU5C_IPOPU      ----------------------------------------------------------------------
NU5C_HUPLU      ----------------------------------------------------------------------
NU5M_PIG        ----------------------------------------------------------------------
NU5M_DUGDU      ----------------------------------------------------------------------
NU5C_LEPVR      ----------------------------------------------------------------------
NU5M_DIDMA      -------------------------------------------------------------------FNI
NU5M_DICCI      ----------------------------------------------------------------VGSLNV
NU5C_NICTO      ----------------------------------------------------------------------
NU5C_MALAR      ----------------------------------------------------------------------
NUOL_RICFE      ----------------------------------------------------------------VGNFKV
NU5M_TRIRU      ----------------------------------------------------------------------
NU5M_SHEEP      ----------------------------------------------------------------------
NU5M_PETMA      ------------------------------------------------------------------LFNI
NU5M_PANTR      ----------------------------------------------------------------------
NU5C_COFAR      ----------------------------------------------------------------------
NU5C_CAPBA      -------------------------------------------------------------------FSL
NU5M_DICDI      ----------------------------------------------------------------VGSLNV
NU5M_BOVIN      ----------------------------------------------------------------------
NU5M_PANPA      ----------------------------------------------------------------------
NU5C1_PAUCH     -----------------------------------------------------------------GTFNL
NU5M_RAT        ----------------------------------------------------------------------
NU5M_BOSIN      ----------------------------------------------------------------------
NU5C_LIRTU      ----------------------------------------------------------------------
NU5M_CHIMO      ----------------------------------------------------------------LPLFNI
NU5M_CANFA      ----------------------------------------------------------------------
NU5C_RANMC      -------------------------------------------------------------------FSL
NU5C_CICAR      ----------------------------------------------------------------------
NU5C_CARPA      ----------------------------------------------------------------------
NU5M_POLOR      ----------------------------------------------------------------------
NU5M_MACRO      ----------------------------------------------------------------------
NU5M_GORGO      ----------------------------------------------------------------------
NU5C_NYMAL      ----------------------------------------------------------------------
NU5C_EUCGG      ----------------------------------------------------------------------
NUOL_CAMJE      --------------------------------------------------------------------GV
NU5C_SESIN      ----------------------------------------------------------------------
NU5C_LIGVU      ----------------------------------------------------------------------
MRPA_BACSU      --------------------------------------------------------------------GI
NU5M_ROUAM      ----------------------------------------------------------------------
NU5C_OENPA      ----------------------------------------------------------------------
NU5C_OENGL      ----------------------------------------------------------------------
NU5C_OENEH      ----------------------------------------------------------------------
NU5C_OENBI      ----------------------------------------------------------------------
NU5C_OENAR      ----------------------------------------------------------------------
NU5C_CYCTA      ----------------------------------------------------------------------
NU5C_CERDE      ----------------------------------------------------------------------
NU5M_MOUSE      ----------------------------------------------------------------------
NU5C_CRYJA      ----------------------------------------------------------------------
NUOL_STRCO      --------------------------------------------------------------PVEG-FQA
NU5C_ZYGCR      ----------------------------------------------------------------------
NU5C_VICFA      ----------------------------------------------------------------------
NU5C_NUPAD      ----------------------------------------------------------------------
NU5M_HYLLA      ----------------------------------------------------------------------
NUOL_BUCAI      ----------------------------------------------------------------------
NU5M_CHICK      ----------------------------------------------------------------------
NU5C_STAPU      ----------------------------------------------------------------------
NU5C_NEPOL      ----------------------------------------------------------------------
NU5M_ORNAN      -------------------------------------------------------------------FNL
NU5M_PONPY      ----------------------------------------------------------------------
NU5M_GADMO      ----------------------------------------------------------------------
NU5M_RHIST      ----------------------------------------------------------------------
NU5C_HORVU      ----------------------------------------------------------------------
NU5M_XENLA      ----------------------------------------------------------------INTFDI
NU5C_VITVI      ----------------------------------------------------------------------
NU5M_MARPO      ----------------------------------------------------------------------
NU5C_MAIZE      ----------------------------------------------------------------------
NU5M_CHLRE      -------------------------------------------------------VFGTWFS--VGTFHA
NU5C_SORBI      ----------------------------------------------------------------------
NU5C_PHAVU      ----------------------------------------------------------------------
NU5M_CROLA      ------------------------------------------------------------------MFDI
NU5M_BRALA      ----------------------------------------------------------------LGGYSL
NU5C_POAPR      ----------------------------------------------------------------------
NU5C_LOBMA      ----------------------------------------------------------------------
NU5C_LEMMI      ----------------------------------------------------------------------
NU5C_CITSI      ----------------------------------------------------------------------
NU5C_CARTI      ----------------------------------------------------------------------
NU5C_ANGEV      ----------------------------------------------------------------------
NUOL_RICCN      ----------------------------------------------------------------VGTFKV
NU5M_CYPCA      -------------------------------------------------------------------FDV
NU5C_OLIPU      ----------------------------------------------------------------------
NU5C_FAGEA      ----------------------------------------------------------------------
NU5C_CARCG      ----------------------------------------------------------------------
NU5M_PONAB      ----------------------------------------------------------------------
NU5M_CARAU      -------------------------------------------------------------------FDV
NU5C_MUTAC      ----------------------------------------------------------------------
NU5C_DRANE      ----------------------------------------------------------------------
NU5C_DAUCA      ----------------------------------------------------------------------
NU5C_NASOF      ----------------------------------------------------------------------
NU5C_LOLPR      ----------------------------------------------------------------------
NU5C_CHLSC      ----------------------------------------------------------------------
NU5M_MYXGL      ----------------------------------------------------------------------
NU5M_LOXAF      ----------------------------------------------------------------------
NU5M_BRAFL      ----------------------------------------------------------------LGGYSL
NU5C_AETGR      ----------------------------------------------------------------------
MNHA2_STAS1     ------------------------------------------------------VMQGNFVSPWLTLLDI
MNHA2_STAES     ----------------------------------------------------------------------
MNHA2_STAEQ     ----------------------------------------------------------------------
NU5M_CANAL      ---------------------------------------------------------GTWIS--LGDIVI
NU5M_ALLMA      -----------------------------------------------------------YLSPWMNVIGA
NU5C_PANGI      ----------------------------------------------------------------------
NU5C_WHEAT      ----------------------------------------------------------------------
NUOL_RICBR      ----------------------------------------------------------------------
NU5M_ONCMY      -------------------------------------------------------------------FDI
NU5C_JASNU      ----------------------------------------------------------------------
NU5C_DIOEL      ----------------------------------------------------------------------
NU5C_ASTCO      ----------------------------------------------------------------------
NUOL_BUCBP      ----------------------------------------------------------------------
NU5M_SALSA      -------------------------------------------------------------------FDI
NU5C_NANDO      ----------------------------------------------------------------------
NU5C_CAPBU      ----------------------------------------------------------------------
NU5C_ARAHI      ----------------------------------------------------------------------
NU5M_SQUAC      ----------------------------------------------------------------IGPFDI
NU5M_HUMAN      ----------------------------------------------------------------------
NU5C_POPTR      ----------------------------------------------------------------------
NU5C_POPAL      ----------------------------------------------------------------------
NU5C_CRUWA      ----------------------------------------------------------------------
NU5C_BARVE      ----------------------------------------------------------------------
NU5C_ARATH      ----------------------------------------------------------------------
NU5C_ANIIN      ----------------------------------------------------------------------
NU5M_MYOGL      ----------------------------------------------------------------------
NU5M_LATCH      -------------------------------------------------------------------FNI
NU5C_PEA        ----------------------------------------------------------------------
NUOL_RHOCA      -----------------------------------------------------------------GALDT
NU5M_CRYNV      -------------------------------------------------------LSGSPVSIVIGSWDS
NU5M_TETNG      -------------------------------------------------------------------FDI
NU5M_CANPA      ----------------------------------------------------------------------
NU5C_CALFG      ----------------------------------------------------------------------
PHAAB_RHIME     --------------------------------------------------------------------GL
NU5M_STRPU      ----------------------------------------------------------------------
NQO12_PARDE     ---------------------------------------------------------------VTGDFHA
MNHA2_STAHJ     --------------------------------------------------------------PWMPAIDV
NU5M_USTMA      ----------------------------------------------------------------------
NU5C_ANTFO      ----------------------------------------------------------------------
NU5C_SACOF      ----------------------------------------------------------------------
NU5C_SACHY      ----------------------------------------------------------------------
NU5C_AGRST      ----------------------------------------------------------------------
NU5M_PARLI      ----------------------------------------------------------------------
NU5M_DINSE      ----------------------------------------------------------------------
NU5M_ELEMA      ----------------------------------------------------------------------
MNHA1_STAS1     -------------------------------------------------------------------FGM
NU5M_PICCA      ----------------------------------------------------------------------
NU5M_PELSU      ----------------------------------------------------------------------
NU5M_MAMPR      ----------------------------------------------------------------------
NU5C_BUXMI      ----------------------------------------------------------------------
NUOL_NEIMB      ----------------------------------------------------------------------
NUOL_NEIMA      ----------------------------------------------------------------------
MRPA_BACPF      -----------------------------------------------------------HTIPWVPSLGI
NU5M_DANRE      -------------------------------------------------------------------FNV
NU5C_CHAGL      ----------------------------------------------------------------------
NU5M_ASCSU      ----------------------------------------------------------------------
NU5C_CHLAT      ----------------------------------------------------------------------
NU5C_AETCO      ----------------------------------------------------------------------
NU5C_ORYSJ      ----------------------------------------------------------------------
NU5C_ORYSI      ----------------------------------------------------------------------
NU5C_ORYSA      ----------------------------------------------------------------------
NU5C_ORYNI      ----------------------------------------------------------------------
NU5C_MESVI      ----------------------------------------------------------------------
NUOL_BUCAP      ----------------------------------------------------------------------
NU5C_MORIN      ----------------------------------------------------------------------
NU5M_YARLI      ----------------------------------------------------------------------
NU5C_ADICA      ----------------------------------------------------------------------
MNHA1_STAHJ     --------------------------------------------------------------------GM
NU5C_MARPO      ----------------------------------------------------------------------
MNHA1_STAES     --------------------------------------------------------------------GM
MNHA1_STAEQ     --------------------------------------------------------------------GM
NU5H_NYCOV      ----------------------------------------------------------------------
NU5M_ASTPE      -------------------------------------------------------IPDTTVSLFNWLPNN
NDHF_BACSU      ----------------------------------------------------------------------
NU5M_DEBHA      ----------------------------------------------------------------------
NU5M_DROYA      ----------------------------------------------------------------------
NU5M_PARTE      ----------------------------------------------------------------------
NU5C2_PAUCH     ----------------------------------------------------------------------
HYFD_ECOLI      ----------------------------------------------------------------------
MNHA1_STAAW     ----------------------------------------------------------------------
MNHA1_STAAU     ----------------------------------------------------------------------
MNHA1_STAAT     ----------------------------------------------------------------------
MNHA1_STAAS     ----------------------------------------------------------------------
MNHA1_STAAR     ----------------------------------------------------------------------
MNHA1_STAAN     ----------------------------------------------------------------------
MNHA1_STAAM     ----------------------------------------------------------------------
MNHA1_STAAE     ----------------------------------------------------------------------
MNHA1_STAAC     ----------------------------------------------------------------------
MNHA1_STAAB     ----------------------------------------------------------------------
MNHA1_STAA9     ----------------------------------------------------------------------
MNHA1_STAA8     ----------------------------------------------------------------------
MNHA1_STAA3     ----------------------------------------------------------------------
MNHA1_STAA2     ----------------------------------------------------------------------
MNHA1_STAA1     ----------------------------------------------------------------------
NU5M_ALBCO      ----------------------------------------------------------------------
MNHA2_STAAR     ----------------------------------------------------------------------
MNHA2_STAAW     ----------------------------------------------------------------------
MNHA2_STAAU     ----------------------------------------------------------------------
MNHA2_STAAT     ----------------------------------------------------------------------
MNHA2_STAAS     ----------------------------------------------------------------------
MNHA2_STAAN     ----------------------------------------------------------------------
MNHA2_STAAM     ----------------------------------------------------------------------
MNHA2_STAAE     ----------------------------------------------------------------------
MNHA2_STAAC     ----------------------------------------------------------------------
MNHA2_STAA9     ----------------------------------------------------------------------
MNHA2_STAA8     ----------------------------------------------------------------------
MNHA2_STAA3     ----------------------------------------------------------------------
MNHA2_STAA2     ----------------------------------------------------------------------
MNHA2_STAA1     ----------------------------------------------------------------------
NU5M_DROME      ----------------------------------------------------------------------
MNHA2_STAAB     ----------------------------------------------------------------------
NU5M_LUMTE      ----------------------------------------------------------------------
NU5M_RHISA      ----------------------------------------------------------------------
NU5M_CAEEL      ----------------------------------------------------------------------
NU4C2_TRIEI     ----------------------------------------------------------------------
NU4C3_ANASP     ----------------------------------------------------------------------
NU4C2_ANAVT     ----------------------------------------------------------------------
NU4C1_SYNJA     ----------------------------------------------------------------------
NU5M_ANOGA      ----------------------------------------------------------------------
NU5M_ANOAR      ----------------------------------------------------------------------
NU5M_TRYBB      ----------------------------------------------------------------------
NU5M_ANOQU      ----------------------------------------------------------------------
NU5M_AEDAE      ----------------------------------------------------------------------
NU4C3_ANAVT     ----------------------------------------------------------------------
NU4C2_SYNY3     ----------------------------------------------------------------------
NU4C1_ANASP     ----------------------------------------------------------------------
NU5M_LOCMI      ----------------------------------------------------------------------
NU4C_SYNPW      ----------------------------------------------------------------------
NU4C1_SYNP6     ----------------------------------------------------------------------
NU4C1_SYNE7     ----------------------------------------------------------------------
NU4C_SYNS9      ----------------------------------------------------------------------
NU4C2_MICAN     ----------------------------------------------------------------------
NU4C1_SYNJB     ----------------------------------------------------------------------
NU5M_PEA        ----------------------------------------------------------------------
NU4C_SYNPX      ----------------------------------------------------------------------
NU4C3_SYNP2     ----------------------------------------------------------------------
NU4C_PROMM      ----------------------------------------------------------------------
NU4C_PROM3      ----------------------------------------------------------------------
NU4C_SYNSC      ----------------------------------------------------------------------
NU4C2_SYNP2     ----------------------------------------------------------------------
NU4C_PROMP      ----------------------------------------------------------------------
NU4C_PROMA      ----------------------------------------------------------------------
NU4C_PROM5      ----------------------------------------------------------------------
NU5M_APILI      ----------------------------------------------------------------------
NU4C1_SYNP2     ----------------------------------------------------------------------
NU4C_SYNS3      ----------------------------------------------------------------------
NU4C_SYNR3      ----------------------------------------------------------------------
NU4C_PROMS      ----------------------------------------------------------------------
NU4C_PROM9      ----------------------------------------------------------------------
NU4C_PROM4      ----------------------------------------------------------------------
NU4C_PROM2      ----------------------------------------------------------------------
NU4C_PROM0      ----------------------------------------------------------------------
NU5M_ANOQN      ----------------------------------------------------------------------
NU4C_PROMT      ----------------------------------------------------------------------
NU4C_PROM1      ----------------------------------------------------------------------
NU4C_CRYJA      ----------------------------------------------------------------------
NU4C_ACAM1      ----------------------------------------------------------------------
NU4C2_SYNJA     ----------------------------------------------------------------------
NU4C1_TRIEI     ----------------------------------------------------------------------
NU4C1_THEEB     ----------------------------------------------------------------------
NU4C2_SYNJB     ----------------------------------------------------------------------
NU4C_MESVI      ----------------------------------------------------------------------
NU4C_GLOVI      ----------------------------------------------------------------------
NU4C2_ANASP     ----------------------------------------------------------------------
NU4C1_ANAVT     ----------------------------------------------------------------------
NU2C_GLOVI      ----------------------------------------------------------------------
NU4C_TOBAC      ----------------------------------------------------------------------
NU4C_NICSY      ----------------------------------------------------------------------
NU4C1_SYNY3     ----------------------------------------------------------------------
NU2C_SYNJA      ----------------------------------------------------------------------
NU4C1_MICAN     ----------------------------------------------------------------------
NU4C_IPOPU      ----------------------------------------------------------------------
NU4C2_THEEB     ----------------------------------------------------------------------
NU4C2_SYNP6     ----------------------------------------------------------------------
NU4C2_SYNE7     ----------------------------------------------------------------------
NU4C_PHYPA      ----------------------------------------------------------------------
NU4C_PELHO      ----------------------------------------------------------------------
NU4C_HUPLU      ----------------------------------------------------------------------
NU2C_STAPU      ----------------------------------------------------------------------
NU4C_PHAVU      ----------------------------------------------------------------------
NU2C_THEEB      ----------------------------------------------------------------------
NQO13_PARDE     ----------------------------------------------------------------------
NU4C_SOLLC      ----------------------------------------------------------------------
NU4C_JASNU      ----------------------------------------------------------------------
NU2C_SYNP2      ----------------------------------------------------------------------
NU2C_SYNP6      ----------------------------------------------------------------------
NU2C_SYNE7      ----------------------------------------------------------------------
NU2C_CHAGL      ----------------------------------------------------------------------
NU2C_ANAVT      ----------------------------------------------------------------------
NU2C_ANASP      ----------------------------------------------------------------------
NUOM_RICPR      ----------------------------------------------------------------------
NUOM_RHOCA      ----------------------------------------------------------------------
NU4C_LOTJA      ----------------------------------------------------------------------
NU4C_CYCTA      ----------------------------------------------------------------------
Y051_MYCTU      ----------------------------------------------------------------------
NU4C_CHAGL      ----------------------------------------------------------------------
NU4C_CARPA      ----------------------------------------------------------------------
NU4C_ATRBE      ----------------------------------------------------------------------
NU2C_ZYGCR      ----------------------------------------------------------------------
NU2C_PHYPA      ----------------------------------------------------------------------
NU4C_SOLTU      ----------------------------------------------------------------------
NU4C_CITSI      ----------------------------------------------------------------------
NU4C_ARAHI      ----------------------------------------------------------------------
NU4C_ADICA      ----------------------------------------------------------------------
NUOM_ECOLI      ----------------------------------------------------------------------
NUOM_ECO57      ----------------------------------------------------------------------
NU4C_NICTO      ----------------------------------------------------------------------
NU4C_ZYGCR      ----------------------------------------------------------------------
NUON_PSEAE      ----------------------------------------------------------------------
NU4C_DRANE      ----------------------------------------------------------------------
NU4C_BUXMI      ----------------------------------------------------------------------
NU4C_RANMC      ----------------------------------------------------------------------
NU4C_NUPAD      ----------------------------------------------------------------------
NU2C_ADICA      ----------------------------------------------------------------------
HYFF_ECOLI      ----------------------------------------------------------------------
NU4M_CHOCR      ----------------------------------------------------------------------
NU4C_AETGR      ----------------------------------------------------------------------
NU4C_AETCO      ----------------------------------------------------------------------
NU2C_MARPO      ----------------------------------------------------------------------
NU5M_MYTED      ----------------------------------------------------------------------
NU4C_OLIPU      ----------------------------------------------------------------------
NU4C_NYMAL      ----------------------------------------------------------------------
NU4C_NASOF      ----------------------------------------------------------------------
NU4C_CRUWA      ----------------------------------------------------------------------
NU4C_CAPBU      ----------------------------------------------------------------------
NU4C_ARATH      ----------------------------------------------------------------------
HYFB_ECOLI      ----------------------------------------------------------------------
NU4M_METSE      ----------------------------------------------------------------------
NU4C_LOBMA      ----------------------------------------------------------------------
NU4C_CERDE      ----------------------------------------------------------------------
NU4C_MORIN      ----------------------------------------------------------------------
NU4C_MANES      ----------------------------------------------------------------------
NU4C_OENPA      ----------------------------------------------------------------------
NU4C_OENAR      ----------------------------------------------------------------------
NUON_PECCP      ----------------------------------------------------------------------
NU5M_ARTSF      ------------------------------------------------------------------LFAF
NU4C_OENGL      ----------------------------------------------------------------------
NU4C_OENEH      ----------------------------------------------------------------------
NU4C_OENBI      ----------------------------------------------------------------------
NU4C_LEPVR      ----------------------------------------------------------------------
NU2C_MESVI      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SHIFL      ----------------------------------------------------------------------
NUON_SHIBS      ----------------------------------------------------------------------
NUON_ENTS8      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
NUON_SHIDS      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
NU4M_DANRE      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
NU4M_POLOR      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GFSLRLDAVSAVMLLLVSFIGWVVVRYAGTYLDGEARQGPFTGWLCMXXXXXXXXXXXGNLVQLVLCWIA
NU5M_METSE      YFGLQFDSLTAVMLIVVTSISTLVHIFSTAYMDGDPHVPRFMSYLSLFTFFMILLVTSDNYPQLFIGWEG
NU5C_SYNY3      -----IDHLSALMLVIVTSVALLVMIYTDGYMAHDPGYVRFYAYLSLFASSMLGLVISPNLVQVYIFWEL
NUOL_ECOLI      GFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMYLGWEG
NU5C_CUCSA      -FSLELDPLTCIMAILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSLFNTSMLGLVTSSNLIQIYIFWEL
NU5C_DAMDI      -FGYLIDPLTSIMSILITTVGIMVLSYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_PENMA      -WSFKFDSLTVSMLIPVLIVSSLVHIYSISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEG
NU5C_PIPCE      -FGYLIDSLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYLNFFNASMLGLVTSSNLIQIYIFWEL
NU5M_CRYPA      -WGFQFDSLTVSMLLPVLIISSLVHIYSISYMSGDPHNQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEG
NU5C_ACOCL      -FGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_ACOAM      -FGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_PSINU      -----IDPLTSIMLILVTTVGVLVMIYSDSYMSHDQGYVRFFVYLSFFTASMLGLVLSSNLVQIYIFREL
NU5C_SYNP2      -----VDHLSALMSVIVTTVALLVMIYTDGYMAHDPGYVRFYAYLSIFSSSMLGLVFSPNLVQVYIFWEL
NUOL_PSEAE      NFTLYLDGLSVTMLGVVTGVGFLIHLFASWYMRGETGYSRFFAYTNLFIASMXXXXXXXXXXXXXXGWEG
NU5M_ASPNG      -WNFRFDSLTVSMFITVLIVSSLVHIYSISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLIMFVGWEG
NQO12_THET8     PFSLLLDNLSGFMLLIVTGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEG
NU5M_WHEAT      SWGFLFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEG
NU5C_CHAVU      -----IDPLSSLMLFLVTSVAVLVMSYSHGYMSHDQSYVRFFAYLSLFTASMLGLVLSPNLFQIYIFWEL
NUOL_MYCTU      -FGLQIDQLSMCFVLLISGVGSLIHIYSVGYMAEDPDRRRFFGYLNLFLASMLLLVVADNYVLLYVGWEG
NU5M_OENBE      SWGFVFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMPMLVTGDNFLQLFLGWEG
NU5M_NEUCR      LWGFQFDSLTVAMLIPVLIISSLVHIYSISYMSHDPHNQRFFSYLSLFTFMMIILVTANNYLLMFVGWEG
NU5C_TECST      -FGYLIDPLTSIMSMLITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMFGLVTSSNLIQIYIFWEL
NU5C_MANES      -FGHLIDPLTSILSVLITTVGILVLFYSDNYMSHDQGYLRFFAYMSFFTTSMLGLVTSSNLIQIYIFWEL
NU5M_CERSI      --SFKLDYFSMIFVPVALFVTWSIMEFSMWYMHSDPHITQFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5C_SPIOL      -FGYLMDPLTSIMSMLITTVAILVLIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_DRIGR      -FGHLIDPLTSIMSILITTVGIMVLIYSDKYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWEL
NU5C_PHYPA      -----IDPLTSIMLVLITTVGVLVMIYSDSYMSYDQGYVRFFAYLSLFTASMLGLVLSPNLIQIYIFWEL
NUOL_RICPR      -WSIYIDQLTSIMFIAVTFVSSVVHIYSLGYMAEDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFCGWEG
NU5M_RHIUN      --SFKLDYFSMIFVPVALFVTWSIMEFSIWYMHSDPHITQFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5C_ATRBE      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_HALGR      --SFKLDHFSMIFVPVALFVTWSIMEFSMWYMHSDPFINRFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5C_PLAOC      -FGYLIDPLTSIMSILITTVGIMVLVYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWEL
NU5C_LACSA      -FGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_ATRJA      -FGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_PODAN      -WGFQFDSLTVSMLIPVLIISSLVHIYSISYMSSDPHNQRFFSYLSLFTFMMIILVTANNYLLMFVGWEG
NU5M_CHOCR      --------------------------YSIKYMENDPHQPRFMSYLEIFTFFMLILVTADNLIQMFLGWEG
NU5M_ARATH      SWGFLFDSLTVVMLIVVTSISSLVHLYSISYMSEDPHSPRFMCYLSIFTFFMLMLVTGDNFLQLFLGWEG
NU5M_RABIT      --SFKLDYFSMLFTPIALFVTWSIMEFSMWYMHSDPKINQFFKYLLMFLITMLILVTANNMFQLFIGWEG
NU5M_PHOVI      --SFKLDHFSMIFVPVALFVTWSIMEFSMWYMHSDPFINRFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5C_HELAN      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_FLARA      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_AMBTR      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_PAPHA      --SFKLDYFSMMFIPIALFITWSIMEFSLWYMSSDPNINQFFKYXXXXXXXXXXXXXANNLFQLFIGWEG
NU5M_BALPH      --SFKMDYFSLMFMPVALFITWSIMEFSMWYMHSDPYINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5M_BALMU      --SFKMDYFSLMFMPVALFITWSIMEFSMWYMHSDPYINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5C_CICIN      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_BRADI      -FGYLIDPLTSIMLMLITTVGILVLIYSDGYMSHDEGYLRFFIYISFFNISMLGLVTSSNLIQIYFFWEL
NU5M_SCHCO      --------ITLPFLFTVLFISFLIHLFSVNYMANDPHIQRFFSYLSLFTFFMAILVTGANYFVLFVGWEG
NU5C_TOBAC      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_SOLTU      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_SOLLC      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_SOLBU      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_NICSY      DFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_GOSHI      -FGYFIDSLTSIMSILITTVGIFVLIYSDNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWEL
NU5M_HIPAM      --SFKADYFSIVFAPVALFVTWSIMEFSMWYMHSDPHINQFFKYLLLFLITMMILVTANNLFQLFIGWEG
NU5M_EMENI      ----RFDSLTVSMFITVLIVSSLVHIYSISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLIMFVGWEV
NU5C_GOSBA      -FGYFIDSLTSIMSILITTVGIFVLIYSDNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWEL
NU5C_ADEHI      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_LOTJA      -FGYLIDSLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQVYIFWEL
NU5M_STRCA      --SFKMDQYSMLFLPVALFVTWSILQFAMWYMASEPHVTKFFIYLLMFLIAMLTLTIANNMFMLFIGWEG
NU5M_PHYIN      NWCFLFDSLTMIMLVVVTSISTLVHLYSSQYMAHDPHLSRFMSYLSLFTFFMIILVTGDNFMQMFVGWEG
NU5M_FELCA      --SFKMDYFSTIFIPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5M_CANLU      --SFKLDYFSMIFVPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLLFLITMMVLVTANNMFQLFIGWEG
NU5C_SOYBN      -FGYLIDSLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYLTLFNISMLGLVTSSNLIQIYVFWEL
NU5C_GERJA      -FSLELDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_ATHGR      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_HORSE      --SFKLDYFSMIFVPVALFVTWSIMEFSLWYMHSDPYITRFFKYLLTFLITMMILVTANNLFQLFIGWEG
NU5M_EQUAS      --SFKLDYFSMIFVPVALFVTWSIMEFSLWYMHSDPYITRFFKYLLTFLITMMILVTANNLFQLFIGWEG
NU5C_PACAQ      -FGYFIDSLTSIMSILITTVGIFVLIYXDNYMSHDQGYLRFFAYMSLFNTSMLGLLTXSNLIQIYXFWEL
NU5C_GUIAB      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NUOL_RICTY      NWSIYIDQLTSIMFIVVTFVSSVVHIYSLGYMANDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFCGWEG
NU5M_TRIRE      -WNFQFDSLTVSMLIPVLVISSLVHFYSIGYMSHDPHSQRFFSYLSLFTFMMIILVTGNNYLLMFVGWEG
NU5M_SCYCA      NMSFKFDLYSIMFTPVALYVTWSILEFALWYMHLDPNINRFFKYLLLFLISMIILVTANNMFQLFIGWEG
NU5M_LEMCA      --SFKLDYFSMLFMPVALFVTWSIMEFSMWYMHSDPNMNQFFKYLLMFLITMLILVTANNLFQLFIGWEG
NU5M_ACACA      NWLFLFDSITSXXXXXXXXXXXXXXXYSIDYMSGDPHIIRFLGYLSLFTFFMLMLVTSGNFVQLFLGWEG
NU5C_PELHO      -FGHLVDPLTSIMSXXXXXXXXXXXXYSEKYMFHDQGYLRFFSYMTLFHVSMLGLVTSSNLIQIYICWEF
NU5C_DIGGR      -FSLELDPLTSIMSMLITIVGITVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_ILLOL      -FSLELDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFASMSFSNTSMLGLVTSSNLIQIYIFWEL
NU5C_AMBTC      -FGYLIDSLTSIMSILIATVGMMVLIYSDNYMSHDKGYLRFFAYMSFFNTSMLGLVISPNLIQIYIFWEL
NU5M_SORFM      --NFKLDYFSMIFTPVALFVTWSIMEFSMWYMHSDPNMNRFFKYLLMFLITMMILVTANNLFQLFIGWEG
NU5M_GEOPE      --SFKLDLYSITFMPVALYVTWSIMEYSTWYMKHDPHLKRFLNYLSLFLITMLILVTANNMFQLFIGWEG
NU5M_DASNO      --SFKLDFFSIIFVSVALFVTWSIMEFSLWYMHSDPYINQFFKYLLLFLITMMILVTANNMFQLFIGWEG
NU5C_IPOPU      -FGYLIDPLTSIMSILVTTVGILVLIYSDNYMAHDQGYLRFFTYMSFFCAAMLGLVTSSNFIQIYIFWEL
NU5C_HUPLU      -----IDPLTSIMLVLVTTIGVTVMIHSDSYMSHDQGYVRFFAYLSLSTASMLGLVISPNLIQIYIFREL
NU5M_PIG        --SFKMDYFSVMFIPVALFVTWSIMEFSMWYMHSDPFINRFFKYLVLFLITMMILVTANNLFQLFIGWEG
NU5M_DUGDU      --SFKLDYFSLIFMPVALFVTWSIMEFSLWYMNSDPYINRFFKYXXXXXXXXXXXXXANNLFQLFIGWEG
NU5C_LEPVR      -FGYFIDPLTSIMSILISTVGILVLIYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWEL
NU5M_DIDMA      SMSFKMDFFSIIFIPIALFVTWAILEFSLWYMHSDPNISQFFKYLIIFLLTMIILVSANNLFQLFIGWEG
NU5M_DICCI      EYGLLYDSLTSIMIIVITCISSMVHLYSMDYMKADPHKTRFFSYLSLFTFFMMLLVTADNFVQLFFGWEG
NU5C_NICTO      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_MALAR      -FGYFIDSLTSIMSILITTVGIFVLIYSDNYMSHDQGYLRFFAYMSLFNTSMLGLVTSSNLIQIYIFWEL
NUOL_RICFE      NWSIYIDQLTSIMFIAVTWVSSVVHIYSLGYMAEDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFFGWEG
NU5M_TRIRU      ------DSLTVSMLIPVLIVSSLVHIYSIGYMSHDPHNQRFFSYLSLFTFMMIILVTANNYLLMFLGVEG
NU5M_SHEEP      --SFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5M_PETMA      ALSFKIDKYTVIFTPIALMITWSIMEFSQWYMAKERHMDKFFKYXXXXXXXXXXXXSANNLLQLFIGWEG
NU5M_PANTR      --SFKLDYFSMTFIPVALFVTWSIMEFSLWYMDSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEG
NU5C_COFAR      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQAYLRFFAYMGFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_CAPBA      DFGYLIDPLTSIMXXLITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_DICDI      EYGLLYDSLTSIMIIVITCISSMVHLYSMDYMKEDPHKTRFFSYLSLFTFFMMLLVTADNFVQLFFGWEG
NU5M_BOVIN      --SFKMDYFSMMFIPVALFVTWSIMEFSMWYMYSDPNINKFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5M_PANPA      --SFKLDYFSMTFIPVALFVTWAIMEFSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEG
NU5C1_PAUCH     EMGYRVDPIGATMLALVSTVAILVMVYSDGYMSHDKSYVRFFTYLGLFTSSMLALILSPNLLEIYVFWEL
NU5M_RAT        --SFKIDYFSILFLSVSLFVTWSIMQFSSWYMHSDPHINRFIKYLMMFLNNMLILTSANNLFQLFIGWEG
NU5M_BOSIN      --SFKMDYFSMMFTPVALFVTWSIMEFSMWYMHSDPNINKFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5C_LIRTU      -FGHLIDPLTSIMSILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIHIFWEL
NU5M_CHIMO      NLSFKFDMYSIMFTSVALYVTWSILDFTSWYMYSDPNINRFFKYXXXXXXXXXXXVTANNMFQLFIGWEG
NU5M_CANFA      --SFKLNYFSMIFVPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLLFLITMMVLVTANNMFQLFIGWEG
NU5C_RANMC      DFGNFIDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWEL
NU5C_CICAR      -FGYLIDSLTSIMSXXXXXXXXXXXXYSDSYMSHDQSYLRFFTYLSFFNTSMLGLVTSSNLIQVYIFWEL
NU5C_CARPA      -FGNLIDPLTSIMSXXXXXXXXXXXXYSDSYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQVYIFWEL
NU5M_POLOR      --SLQFDQYSMIFMTIALYVTWSILEFAIYYMHTDILINRFFKYLLTFLIAMMILVTANNMFQLFIGWEG
NU5M_MACRO      --SFKLDYFSIIFIPIALYVTWSILEFSLWYMHSDPYIHRFFKYLITFLLTMIILVSANNLFQLFIGWEG
NU5M_GORGO      --SFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEG
NU5C_NYMAL      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDRGYLRFFAYMSFFNTAMLGLVTSPNLIQIHIFWEL
NU5C_EUCGG      --------------------------YSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWEL
NUOL_CAMJE      NFGFDIDAISLTMMSVVGIVATCVHFYSIFYMAHDEGFNKFFAYLGLFVFSMLFLVMSDNFLGLFVGWEG
NU5C_SESIN      -FGYLIDPLTSIMSMLXTTVGIMVLIYSDNYMAHDQGYLIFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_LIGVU      -FGYLIDPLTSIMSMLITTVGIMVLIYSDNYMAHDQGYLRXXXXXXXXXXXXLGLVTSSNLIQIYIFWEL
MRPA_BACSU      NFTVYIDGLGLLFALLITGIGSLVTLYSIFYLSKEKEQGPFYVYLLMFMGAMLGVVLVDNVMVLYMFWEL
NU5M_ROUAM      --SFKLDYFSMILMPVALSVTWSIMEFSMWYMHSDPYINRFFKYXXXXXXXXXXXVTANNLFQLFIGWEG
NU5C_OENPA      --------------------------YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_OENGL      --------------------------YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_OENEH      --------------------------YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_OENBI      --------------------------YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_OENAR      --------------------------YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWEL
NU5C_CYCTA      -----IDPLTSIMPISVTTVGIMVMIYSDNYMSHDQGYVRFFAYLSLFNASMLGLVISPNLVQIYIFWEL
NU5C_CERDE      -FGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFSYLSFFNASMLGLVTSSNLIQIYIFWEL
NU5M_MOUSE      --SFKTDFFSILFTSVALFVTWSIMQLSSWYMHSDPNINRFIKYXXXXXXXXXXXXSANNMFQLFIGWEG
NU5C_CRYJA      ----------------------------------------------------------------------
NUOL_STRCO      DVAFRLDQLSMTFVLLITGVGSLIHLYSVAYMEHDERRRRFFGYLNLFLAAMLILVLADNYLLLYVGWEG
NU5C_ZYGCR      ----------------------------------------------------------------------
NU5C_VICFA      -FGYLIDSLTSIMSXXXXXXXXXXXXYSDSYMSHDQGYLRFFTYMSFFNTSMLGLVTSSNLIQVYIFWEL
NU5C_NUPAD      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSPNLIQIHIFWEL
NU5M_HYLLA      --SFKLDYFSMMFIPIALFVTWSIMEFSLWYMHSDPNINQFFKYLLIFLTTMLILVTANNLFQLFIGWEG
NUOL_BUCAI      -FGFFLDGLSLSMLFVITGVGLLIHIFSSWYMRYKEGQSRFFAYTNLFIASMSVLVLADNFLFMYLGWEG
NU5M_CHICK      --SLKMDMYSMMFFPIALFVTWSILEFATWYMASEPFITKFFTYLLTFLIAMLTLTIANNMFLLFVGWEG
NU5C_STAPU      -----IDPLSSIMLVLVTTVGIAVMIYTDGYMSHDQGYVRFFLYLSLFTASMLGLVLSSNLVQIYAFWEL
NU5C_NEPOL      -----------------------------------------------------------NLVQVYGFWEL
NU5M_ORNAN      SMNFKLDLYTIMFLPIALLITWSIMEFSIWYMSSDPKINQFMKYXXXXXXXXXXXXSANNLFQLFIGWEG
NU5M_PONPY      ----KLDYFSMTFLPVALFVTWSIMEFSLWYMASDPNINQFFKYXXXXXXXXXXXXXANNLLQLFIGWEG
NU5M_GADMO      --SFKFDHYSIIFIPIALYVTWSILEFATWYMHSDPFMNRFFKYLLTFLVAMLILVSANNLFQLFIGWEG
NU5M_RHIST      ------DSLTVSMLLPVLIVSALVHIYSTNYMSEDPHNQRFFAYLSMFTFFMLMLVTGDNYLVMFIGWEG
NU5C_HORVU      -FGYLIDPLTSIMXXXXXXXXXXXXXYSDGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWEL
NU5M_XENLA      NMSFKFDIYSSIFIPIALFVTWSILEFATWYMASDPMISRFFKYLLTFLVAMVILVTANNFFQFFIGWEG
NU5C_VITVI      -FGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWEL
NU5M_MARPO      --------------------------YSISYMSEDPHSPRFFCYLSIFTFFMLMLVTGDNFIQLFLGWEG
NU5C_MAIZE      ----------------------------------------------------------------------
NU5M_CHLRE      GWTFNFDLLTANMLFTVTGVSMAVHMYACDYMRQDPHLNLFLGYLSYFTGFMCVLVAADNLLVMLVGWEG
NU5C_SORBI      ----------------------------------------------------------------------
NU5C_PHAVU      -FGYLIDSLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMTLFNISMLGLVTSSNLIQIYFFWEL
NU5M_CROLA      NISFKFDYYSLVFTPIALYVTWSILEFASWYMHADPYVNRFFKYLLTFLIAMITLVTANNMFQLFIGWEG
NU5M_BRALA      MISFRFDLYTCCFFVVGLYVTWNILMFSFYYMSTDPRIDLFCKYLGLFLIAMLLLVSAESLFQLLIGWEG
NU5C_POAPR      ----------------------------------------------------------------------
NU5C_LOBMA      -FGYFIDPLTSIMXXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWEL
NU5C_LEMMI      -FGYFIDPLTSVMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWEL
NU5C_CITSI      ----------------------------------------------------------------------
NU5C_CARTI      -FGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_ANGEV      -----IDPLTSTMLVSVTSVGILVMIYSDSYMSHDQGYVRFFAYLSLFTASMLGLVLSPNPVQIYIFWEL
NUOL_RICCN      NWSIYIDQLTSIMFIAVTWVSSIVHIYSLGYMAEDKGIIRXXXXXXXXXXXXXXXXXXDNFLQLFFGWEG
NU5M_CYPCA      NISFKFDHYSLIFVPIALYVTWSILEFALWYMHSDPNIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEG
NU5C_OLIPU      -FGYFIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWEL
NU5C_FAGEA      -FGYLVDPLTSIMSMLITTVGILVLIYSDNYMVHDQGYLRFFAYLSFFNTSMLGLVTSSNFIQIYIFWEL
NU5C_CARCG      -FSLELDPLTSIMLILITTVGIMVLIYSDSYMSHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_PONAB      ----KLDYFSMTFLPVALLITWSIMEFSLWYMASDPNXXXXXXXXXXXXXXXXXXVTANNLLQLFIGWEG
NU5M_CARAU      NISFKFDHYSLIFVPIALYVTWSILEFALWYMHSDPYIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEG
NU5C_MUTAC      -FGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDHGYLRFFVYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5C_DRANE      -FGYFIDPLTSIMXXXXXXXXXXXXXYSDNYMAHDQGYLRFFAYLGFFTTSMLGLVTSSNLIQVYFFWEL
NU5C_DAUCA      ----------------------------------------------------------------------
NU5C_NASOF      -FGYFIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWEL
NU5C_LOLPR      ----------------------------------------------------------------------
NU5C_CHLSC      ----------------------------------------------------------------------
NU5M_MYXGL      ------------------YITWSIMQFSLWYMH-EHNNTLFFKYLTMFLISMLFFLSANNLLQLILGWEG
NU5M_LOXAF      --SFKLDFFSLTFMPIALFITWSIMEFSLWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEG
NU5M_BRAFL      MISFRFDLYTCCFFVVGLYVTWNILMFSFYYMSTDPRIDLFCKYLGLFLIAMLLLVSAESLFQLLIGWEG
NU5C_AETGR      -FGYFIDPLSCIMVILITTVGIFVLIYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYFFWEL
MNHA2_STAS1     NIDFRLDXXXXXXXXXXXXXXXAVVYYATQYLSKEHDNLPFYVYLLLFMFSMLGIVTANNTILMYVFWEL
MNHA2_STAES     ---LRLDGLSLMFGLIISLIGVGVFFYATQYLSHSTDNLPFFIYLLLFMFSMIGIVIANNTILMYVFWEL
MNHA2_STAEQ     ---LRLDGLSLMFGLIISLIGVGVFFYATQYLSHSTDNLPFFIYLLLFMFSMIGIVIANNTILMYVFWEL
NU5M_CANAL      PFGLSLDSLAMTVIVPVGIITLCVLAYAIEYMSHDPNRNRFYIILSIFAVFMTILVVSDNYLMMFIGWEF
NU5M_ALLMA      DWAFYFDSISITMCXXXXXXXXXXHLYSIGYMQGDPHIQRFFSYLSLFTFFMLLLVTGNNYLLMFVGWEG
NU5C_PANGI      ----------------------------------------------------------------------
NU5C_WHEAT      ----------------------------------------------------------------------
NUOL_RICBR      ----------------------------------------------------------------------
NU5M_ONCMY      NLSFKFDHYSIIFTPIALYVTWSILEFASWYMHADPNMNRFFKYLLLFLIAMIILVTANNMFQLFIGWEG
NU5C_JASNU      -FGYLIDPLTSIMSMLITTVGIMVLVYSDNYMAHDQGYLRXXXXXXXXXXXXLGLVTSSNLIQIYIFWEL
NU5C_DIOEL      -FGYLIDPLTSIMSLLISTVGIMVLMYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIHIFWEL
NU5C_ASTCO      -FGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NUOL_BUCBP      -FNFMLDGLSITMLTMTTSIGFLIHLFSSWYIKLQDEYTRFFSYMNLFIASMVXXXXXXXXXVMYIGWEG
NU5M_SALSA      NLSFKFDHYSIIFTPIALYVTWSILEFASWYMHADPNMNRFFKYLLLFLIAMIILVTANNMFQLFIGWEG
NU5C_NANDO      -FGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFSNASMLGLVTSCNLIQIYIFWEL
NU5C_CAPBU      -FGYFIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWEL
NU5C_ARAHI      -----------------------------------------------------------NLIQVYFFWEL
NU5M_SQUAC      NMSFKFDMYSIIFTPVALYVTWSILEFALWYMHSDPNMNRFFKYLLLFLISMIILVTANNMFQLFIGWEG
NU5M_HUMAN      --SFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEG
NU5C_POPTR      -----------------------------------------------------------NLIQIYIFWEL
NU5C_POPAL      -----------------------------------------------------------NLIQIYIFWEL
NU5C_CRUWA      ----------------------------------------------------------------------
NU5C_BARVE      ----------------------------------------------------------------------
NU5C_ARATH      ----------------------------------------------------------------------
NU5C_ANIIN      -FGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWEL
NU5M_MYOGL      ------------------FVTWSIMEFSLWYMHSDPYINRFFKYLLLFLITMIILVTANNLFQLFIGWEG
NU5M_LATCH      NISFKFDQYSIVFIPIALYVTWSILEFANWYMHQDPKMNQFFKYLLLFLITMMILVTANNMFQLFIGWEG
NU5C_PEA        ----------------------------------------------------------------------
NUOL_RHOCA      SWGIRLDRLTAIMLIVVTTVSALVHLYSWGYMHHEAYKARFFAYLSFFTFAMLMLVTSDNLVQMFFGWEG
NU5M_CRYNV      EFMLLFDSLTVSMLLPVLIVSSLVHLYSISYMAGDPHNQRFFSYLSMFTFFMLVLVAGDNYFIMFVGWEG
NU5M_TETNG      NISLKFDHYSIIFTPVALYVTWSILEFASWYMHADPFMNRFFKYLLTFLIAMIILVTANNMFQLFIGWEG
NU5M_CANPA      -YGLSLDSLAMTVMIPVGIVTLCVLLYAIEYMSHDPNRNTFYIILSVFAIFMTILVVSDNYIMMFIGWEF
NU5C_CALFG      -FGHLIDPLTSIMSILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWEL
PHAAB_RHIME     NFTLRMDGFAWLFSALITAIGVLVALYARYYMAEEDPVPRFFALFLAFMGSMLGVVLSGNLILLAVFWEL
NU5M_STRPU      ----------------------------------------------------------------------
NQO12_PARDE     EWAIRLDRLTAIMLIVVTTVSALVHMYSLGYMHDEHYKARFFAYLSFFTFAMLMLVTADNLLQMFFGWEG
MNHA2_STAHJ     NLDFRLDGLGLMFGLIISIIGVAVFFYATQYLSVNRDNLPXXXXXXXXXXXXXGIVVSNNTILMYVFWEL
NU5M_USTMA      ------------------------------YMSADPHNQRFFAYLSMFTFFMLVLVTGDNYLIMFVGWEG
NU5C_ANTFO      -FGYLIDPLTCIMLVLVTSVAIIVMIYSDGYMSHDEGYVRFFVYLSLFTASMLGLVLSPNLIQIYIFWEL
NU5C_SACOF      ----------------------------------------------------------------------
NU5C_SACHY      ----------------------------------------------------------------------
NU5C_AGRST      ----------------------------------------------------------------------
NU5M_PARLI      ----------------------------------------------------------------------
NU5M_DINSE      --SITLDTASLLFTPIALFITWSITEFSLWYMATDPNINKFIKYLLTFLITMLVIITANNMYQLFIGWEG
NU5M_ELEMA      ------------------FITWSIMEFSLWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEG
MNHA1_STAS1     NFNLYVDGLGLLFSLLITGIGCLIVLYSISYLSRQEQLGHFYCYLLLFMGAMLGLVLSDNLIILYLFWEX
NU5M_PICCA      ----------------------------------------------------------------------
NU5M_PELSU      --SIKIDYYSLIFISIALFITRAILQYTKWYMASDRDLKKXXXXXXXXXXXXXXXXAANNFFPMLVGWGT
NU5M_MAMPR      ------------------FITWSIMEFSLWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEG
NU5C_BUXMI      -FGLLIDSLTSIMXXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMSFSNISMLGLVTSSNLIQIHIFWEL
NUOL_NEIMB      -----------------------------------------------------------NFIQLFFGWEA
NUOL_NEIMA      -----------------------------------------------------------NFIQLFFGWEA
MRPA_BACPF      NFTVFVDGLSLLFAXXXXXXXXXXXXYSIFYLSKKTESNNFYVYLLMFMGAMLGVVLSDNLIVLYVFWEL
NU5M_DANRE      DLSFKFDYYSVTFTSIALFITWSILEFASWYMASYPQXXXXXXXXXXXXMSMIILVTANNLFQLFIGWEG
NU5C_CHAGL      -----IDPLTSIMLVLVTSVAVTVMIYSDGYMLHDQGYIRFFAYLSLFTASMLGLIVSPNLIQVYVFWEL
NU5M_ASCSU      ----------------------------------------------------------------------
NU5C_CHLAT      ----------------------------------------------------------------------
NU5C_AETCO      -FGYFIDPLTCIMXXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYFFWEL
NU5C_ORYSJ      ----------------------------------------------------------------------
NU5C_ORYSI      ----------------------------------------------------------------------
NU5C_ORYSA      ----------------------------------------------------------------------
NU5C_ORYNI      ----------------------------------------------------------------------
NU5C_MESVI      ----------------------------------------------------------------------
NUOL_BUCAP      --SLILDGLSLSMLAMXXXXXXXXHIFSTWYMKDKEGYSRFFAYTNLFIASMSLLVLADNFLFMYLGWEI
NU5C_MORIN      ----------------------------------------------------------------------
NU5M_YARLI      --------------------------YSIGYMETDPHQVRFFSLLSMFTFWMIILVTGSNYFVLFVGWEF
NU5C_ADICA      ----------------------------------------------------------------------
MNHA1_STAHJ     NFDLYLDGLSILFSLLITGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNLIILYLFWEX
NU5C_MARPO      ----------------------------------------------------------------------
MNHA1_STAES     NFNLYVDGLGLLFSLLITGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEX
MNHA1_STAEQ     NFNLYVDGLGLLFSLLITGIGSLVVLYSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEX
NU5H_NYCOV      ----------------------------------------------------------------------
NU5M_ASTPE      GFSLRFDLKFNTFLSVALIVSWSILEFSYYYMXXXXXXXXXXXXXXXXXXXXXXXTSTNNIFLLFIGWEG
NDHF_BACSU      ----------------------------------------------------------------------
NU5M_DEBHA      -----LDSLSMVVMVPVGIVTLSVLIYAIDYMRYDPNRNRFYIILSVFAIFMTVLVISDNYIMMFMGWEF
NU5M_DROYA      ------DWMSLLFMSFVLMIASLVIFYSKEYMESDENINRXXXXXXXXXXXXXXXXXXPNLVSILLGWDG
NU5M_PARTE      ----------------------------------------------------------------------
NU5C2_PAUCH     ----------------------------------------------------------------------
HYFD_ECOLI      ----------------------------------------------------------------------
MNHA1_STAAW     ----------------------------------------------------------------------
MNHA1_STAAU     ----------------------------------------------------------------------
MNHA1_STAAT     ----------------------------------------------------------------------
MNHA1_STAAS     ----------------------------------------------------------------------
MNHA1_STAAR     ----------------------------------------------------------------------
MNHA1_STAAN     ----------------------------------------------------------------------
MNHA1_STAAM     ----------------------------------------------------------------------
MNHA1_STAAE     ----------------------------------------------------------------------
MNHA1_STAAC     ----------------------------------------------------------------------
MNHA1_STAAB     ----------------------------------------------------------------------
MNHA1_STAA9     ----------------------------------------------------------------------
MNHA1_STAA8     ----------------------------------------------------------------------
MNHA1_STAA3     ----------------------------------------------------------------------
MNHA1_STAA2     ----------------------------------------------------------------------
MNHA1_STAA1     ----------------------------------------------------------------------
NU5M_ALBCO      --ALICDKVSTSFLVVVLLISSCVFLFANEYMSEDHYNIRF-GWILISFVASMGILILSGSIFTXXXXXX
MNHA2_STAAR     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYLYLTLFMFSMLGIVLADNTILMYVFWEL
MNHA2_STAAW     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAU     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAT     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAS     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAN     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAM     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAE     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAAC     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAA9     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAA8     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAA3     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAA2     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
MNHA2_STAA1     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
NU5M_DROME      ----------------------------------------------------------------------
MNHA2_STAAB     ---LRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPFYFYLTLFMFSMIGIVLSDNTILMYIFWEL
NU5M_LUMTE      ----------------------------------------------------------------------
NU5M_RHISA      -FYILLDWMSCMFSFTVLMISSMVLWYSHSYMSSDKNKTSFCWXXXXXXXXXXXXXXXPNVFMLILGWDG
NU5M_CAEEL      ----------------------------------------------------------------------
NU4C2_TRIEI     ----------------------------------------------------------------------
NU4C3_ANASP     ----------------------------------------------------------------------
NU4C2_ANAVT     ----------------------------------------------------------------------
NU4C1_SYNJA     ----------------------------------------------------------------------
NU5M_ANOGA      ----------------------------------------------------------------------
NU5M_ANOAR      ----------------------------------------------------------------------
NU5M_TRYBB      ----------------------------------------------------------------------
NU5M_ANOQU      ----------------------------------------------------------------------
NU5M_AEDAE      ----------------------------------------------------------------------
NU4C3_ANAVT     ----------------------------------------------------------------------
NU4C2_SYNY3     ----------------------------------------------------------------------
NU4C1_ANASP     ----------------------------------------------------------------------
NU5M_LOCMI      -----IDWMSLVFMSFVMYISSLVIYYSNDYMHNEKNINRFIMIVLMFILSMAFXXXXXXXXXXXXGWDG
NU4C_SYNPW      ----------------------------------------------------------------------
NU4C1_SYNP6     ----------------------------------------------------------------------
NU4C1_SYNE7     ----------------------------------------------------------------------
NU4C_SYNS9      ----------------------------------------------------------------------
NU4C2_MICAN     ----------------------------------------------------------------------
NU4C1_SYNJB     ----------------------------------------------------------------------
NU5M_PEA        -----------------------------------------------------------NSLQLFLGWEG
NU4C_SYNPX      ----------------------------------------------------------------------
NU4C3_SYNP2     ----------------------------------------------------------------------
NU4C_PROMM      ----------------------------------------------------------------------
NU4C_PROM3      ----------------------------------------------------------------------
NU4C_SYNSC      ----------------------------------------------------------------------
NU4C2_SYNP2     ----------------------------------------------------------------------
NU4C_PROMP      ----------------------------------------------------------------------
NU4C_PROMA      ----------------------------------------------------------------------
NU4C_PROM5      ----------------------------------------------------------------------
NU5M_APILI      ----------------------------------------------------------------------
NU4C1_SYNP2     ----------------------------------------------------------------------
NU4C_SYNS3      ----------------------------------------------------------------------
NU4C_SYNR3      ----------------------------------------------------------------------
NU4C_PROMS      ----------------------------------------------------------------------
NU4C_PROM9      ----------------------------------------------------------------------
NU4C_PROM4      ----------------------------------------------------------------------
NU4C_PROM2      ----------------------------------------------------------------------
NU4C_PROM0      ----------------------------------------------------------------------
NU5M_ANOQN      ----------------------------------------------------------------------
NU4C_PROMT      ----------------------------------------------------------------------
NU4C_PROM1      ----------------------------------------------------------------------
NU4C_CRYJA      ----------------------------------------------------------------------
NU4C_ACAM1      ----------------------------------------------------------------------
NU4C2_SYNJA     ----------------------------------------------------------------------
NU4C1_TRIEI     ----------------------------------------------------------------------
NU4C1_THEEB     ----------------------------------------------------------------------
NU4C2_SYNJB     ----------------------------------------------------------------------
NU4C_MESVI      ----------------------------------------------------------------------
NU4C_GLOVI      ----------------------------------------------------------------------
NU4C2_ANASP     ----------------------------------------------------------------------
NU4C1_ANAVT     ----------------------------------------------------------------------
NU2C_GLOVI      ----------------------------------------------------------------------
NU4C_TOBAC      ----------------------------------------------------------------------
NU4C_NICSY      ----------------------------------------------------------------------
NU4C1_SYNY3     ----------------------------------------------------------------------
NU2C_SYNJA      ----------------------------------------------------------------------
NU4C1_MICAN     ----------------------------------------------------------------------
NU4C_IPOPU      ----------------------------------------------------------------------
NU4C2_THEEB     ----------------------------------------------------------------------
NU4C2_SYNP6     ----------------------------------------------------------------------
NU4C2_SYNE7     ----------------------------------------------------------------------
NU4C_PHYPA      ----------------------------------------------------------------------
NU4C_PELHO      ----------------------------------------------------------------------
NU4C_HUPLU      ----------------------------------------------------------------------
NU2C_STAPU      ----------------------------------------------------------------------
NU4C_PHAVU      ----------------------------------------------------------------------
NU2C_THEEB      ----------------------------------------------------------------------
NQO13_PARDE     ----------------------------------------------------------------------
NU4C_SOLLC      ----------------------------------------------------------------------
NU4C_JASNU      ----------------------------------------------------------------------
NU2C_SYNP2      ----------------------------------------------------------------------
NU2C_SYNP6      ----------------------------------------------------------------------
NU2C_SYNE7      ----------------------------------------------------------------------
NU2C_CHAGL      ----------------------------------------------------------------------
NU2C_ANAVT      ----------------------------------------------------------------------
NU2C_ANASP      ----------------------------------------------------------------------
NUOM_RICPR      ----------------------------------------------------------------------
NUOM_RHOCA      ----------------------------------------------------------------------
NU4C_LOTJA      ----------------------------------------------------------------------
NU4C_CYCTA      ----------------------------------------------------------------------
Y051_MYCTU      ----------------------------------------------------------------------
NU4C_CHAGL      ----------------------------------------------------------------------
NU4C_CARPA      ----------------------------------------------------------------------
NU4C_ATRBE      ----------------------------------------------------------------------
NU2C_ZYGCR      ----------------------------------------------------------------------
NU2C_PHYPA      ----------------------------------------------------------------------
NU4C_SOLTU      ----------------------------------------------------------------------
NU4C_CITSI      ----------------------------------------------------------------------
NU4C_ARAHI      ----------------------------------------------------------------------
NU4C_ADICA      ----------------------------------------------------------------------
NUOM_ECOLI      ----------------------------------------------------------------------
NUOM_ECO57      ----------------------------------------------------------------------
NU4C_NICTO      ----------------------------------------------------------------------
NU4C_ZYGCR      ----------------------------------------------------------------------
NUON_PSEAE      ----------------------------------------------------------------------
NU4C_DRANE      ----------------------------------------------------------------------
NU4C_BUXMI      ----------------------------------------------------------------------
NU4C_RANMC      ----------------------------------------------------------------------
NU4C_NUPAD      ----------------------------------------------------------------------
NU2C_ADICA      ----------------------------------------------------------------------
HYFF_ECOLI      ----------------------------------------------------------------------
NU4M_CHOCR      ----------------------------------------------------------------------
NU4C_AETGR      ----------------------------------------------------------------------
NU4C_AETCO      ----------------------------------------------------------------------
NU2C_MARPO      ----------------------------------------------------------------------
NU5M_MYTED      ------DNVSMIFVGTVLVISGSVATYCKWYMAEELYYNRFMGLVWLFVLSMVFMILVPNLLMLLIGWDG
NU4C_OLIPU      ----------------------------------------------------------------------
NU4C_NYMAL      ----------------------------------------------------------------------
NU4C_NASOF      ----------------------------------------------------------------------
NU4C_CRUWA      ----------------------------------------------------------------------
NU4C_CAPBU      ----------------------------------------------------------------------
NU4C_ARATH      ----------------------------------------------------------------------
HYFB_ECOLI      ----------------------------------------------------------------------
NU4M_METSE      ----------------------------------------------------------------------
NU4C_LOBMA      ----------------------------------------------------------------------
NU4C_CERDE      ----------------------------------------------------------------------
NU4C_MORIN      ----------------------------------------------------------------------
NU4C_MANES      ----------------------------------------------------------------------
NU4C_OENPA      ----------------------------------------------------------------------
NU4C_OENAR      ----------------------------------------------------------------------
NUON_PECCP      ----------------------------------------------------------------------
NU5M_ARTSF      GLSSVLWLAKTIIHLLSSLNSSQVMIYSSYYMMGETFVNRFMYMMLGFISSMVLLIMSSDGLSLMLGWDG
NU4C_OENGL      ----------------------------------------------------------------------
NU4C_OENEH      ----------------------------------------------------------------------
NU4C_OENBI      ----------------------------------------------------------------------
NU4C_LEPVR      ----------------------------------------------------------------------
NU2C_MESVI      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SHIFL      ----------------------------------------------------------------------
NUON_SHIBS      ----------------------------------------------------------------------
NUON_ENTS8      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
NUON_SHIDS      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
NU4M_DANRE      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
NU4M_POLOR      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TSVFLHRLLLFYPDRLPXXXXXXKKLVTARLGDVALIGSXXXXXXXYGTADIGSILQAARXXXXXXXXXX
NU5M_METSE      VGLCSYLLINFWLTRIEANKAAIKAMLVNRVGDIGFVLAMLAIWDQFGCLDFASVFNIVALAPSDNTTLI
NU5C_SYNY3      VGMCSYLLIGFWYDRKAAADACQKAFVTNRVGDFXXXXXXXXXYWATGSFDFGTIGEVSSGVLSGXXXXX
NUOL_ECOLI      VGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAHFADGNNMLMW
NU5C_CUCSA      VGMCSYLLIGFWFTRPTAANACQKAFVTNRVGDFXXXXXXXXXYWTTGSFEFRDLFQIFNNLIDNNEVNF
NU5C_DAMDI      VGMCSYLLIGFWFTRPLAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFQISNNEVNFLFVTF
NU5M_PENMA      VGICSYLLINFWFTRIAANQSSISALLTNRVGDCFLTIGIFAMLWSFGNIDYNLIFSLA-PYYNENIITM
NU5C_PIPCE      VGMCSYLLIGFWFTRPSAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEVHNNTINXXXXXX
NU5M_CRYPA      VGVCSYLLVSFWFTRIAANQSSISAFLTNRVGDCFLTIGMFAILWSLGNLDYATVFSLA-PYXXXXXXXX
NU5C_ACOCL      VGMCSYLLIGFWFTRPTAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEILKNLIHNNEVNX
NU5C_ACOAM      VGMCSYLLIGFWFTRPTAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEILKNLIHNNEVNX
NU5C_PSINU      VGMCSYLLIGFWFTRPSAANACQKAFITNRVGDFXXXXXXXXXYWITGSFEIHDLSERXXXXXXXXXXXT
NU5C_SYNP2      VGMCSYLLIGFWYDRKAAADACQKAFVTNRVGDFXXXXXXXXXYWATGSFEMGDRLMVSTGQISSXXXXX
NUOL_PSEAE      VGLCSYLLIGFYYSNRNNGNAALKAFIVTRVGDVFMAFGLFILFQQFGTLNIQELLVLAKFPEGNLWXXX
NU5M_ASPNG      VGVCSYLLVNFWFTRIAANQSSLSALLTNREGDTLLTVGMFAILWSFGNIDYSTVFALA-PYYNENXXXX
NQO12_THET8     VGLASFLLIGFWYKNPQYADSARKAFIVNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDXXX
NU5M_WHEAT      VGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGIFGCFTLFQTVDFSTIFACASAPRNEWIFCN
NU5C_CHAVU      VGMCSYLLIGFWFTRPNAASACQKAFITNRIGDFCLLLGILGLYWFTNSFDFITVTKRSNNNSHLYFFIF
NUOL_MYCTU      VGLASYLLIGFWYHKPSAATAAKKAFVMNRVGDAGLAVGMFLTFSTFGTLSYAGVF-AGVPAASRAVLTA
NU5M_OENBE      VGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGILGCFTLFQTVDFSTIFACASAPRNSWISCN
NU5M_NEUCR      VGVCSYLLVSFWFTRIAANQSSMSAFLTNRVGDCFLTIGMFVVLWTLGNLDYATVFSLA-PYINSDIATI
NU5C_TECST      VGMCSYLLIGFWFTRPPAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNSPFVTL
NU5C_MANES      VGVCSYLLIGFWFTRPIASNACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFKIFNNLIYNNQVNF
NU5M_CERSI      VGIMSFLLISWWYGRTDANTAALQAILYNRIGDIGFIMSMAWFLFNTNSWDLQQIFSL-----NYNHTDL
NU5C_SPIOL      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIKNNEVNSXXXXX
NU5C_DRIGR      VGMCSYLLIGFWFTRPIAANACQKALVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIFNNLIHNNGVNS
NU5C_PHYPA      VGMCSYLLIGFWFTRPSAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFEILFKVINHEVNLYFANF
NUOL_RICPR      VGVCSYLLIGFWHSKESANKAAIKAFITNRVSDFAFILGIITIIVYYGSANYKDVFSSAKLLSNTKIFVH
NU5M_RHIUN      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMSMAWFLSNMNSWDLQQIFTL-----DPNHTNL
NU5C_ATRBE      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFESSNNEVNFLFVTL
NU5M_HALGR      VGIMSFLLIGWWHGRTDANTAALQAVLYNRIGDVGFIMAMAWFLINLNTWELQQIFISHHNNLNVPLMGL
NU5C_PLAOC      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNRVNS
NU5C_LACSA      VGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFLFVTL
NU5C_ATRJA      VGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFVFVTL
NU5M_PODAN      VGVCSYLLVSFWFTRIAANQSSISAFLANRVGDCFLTIGMFAILWSLGNLDYSTVFSLA-PYINSKVVXX
NU5M_CHOCR      VGLASYLLINFWYTRLAANQSAIKALIVNRVGDFGLSLGIFLIFWVFNSVDYSVIFSLVPLFDNQFLTFL
NU5M_ARATH      VGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGILGCFTLFQTVDFSTIFACASVPRNSWIFCN
NU5M_RABIT      VGIMSFLLIGWWHGRTDANTAALQAILYNRIGDIGFIMALAWFAINLNTWELQQIF-----ILDNNITIL
NU5M_PHOVI      VGIMSFLLIGWWHGRTDANTAALQAVLYNRIGDVGFIMAMAWFLINLNTWELQQIFISHHXXXXXXXXXX
NU5C_HELAN      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNSVFVTL
NU5C_FLARA      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNLLFVTL
NU5C_AMBTR      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFLFVTL
NU5M_PAPHA      VGIMSFLLISWWHARTDANTAAIQAVLYNRIGDIGLILAMVWFLLHYNSWDFQQMLAL-----NPHPSPL
NU5M_BALPH      VGIMSFLLIGWWFGRTDANTAALQAILYNRIGDIGLLASMAWFLSNMNTWDLEQIFMLNQNPLNFPLMGL
NU5M_BALMU      VGIMSFLLIGWWFGRTDANTAALQAILYNRIGDIGLLASMAWFLSNMNTWDLQQIFMLNQNPLNFPLMGL
NU5C_CICIN      VGVCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFSDLFQISNNEVNFLFVTL
NU5C_BRADI      VGMCSYLLIGFWFTRPIAASACQKAFVTNRXXXXXXXXXXXXXXXXTGSLEFRDLFQTANNWIPNNGXXX
NU5M_SCHCO      IGVVSYLLINFWFTRIQANKAAILAFNTNRIGDMALSIAYFVMLPAFGSADFSTVFSLPAYINQTTITII
NU5C_TOBAC      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVDF
NU5C_SOLTU      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVNF
NU5C_SOLLC      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNELNF
NU5C_SOLBU      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVNF
NU5C_NICSY      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVDF
NU5C_GOSHI      VGMCSYLLIGFWFTRPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNEVHF
NU5M_HIPAM      VGIMSFLLIGWWHGRTDANTAAIQAILYNRIGDVGFIMAMAWFLSNLNTWDMQQIFMI-----NPTHSNL
NU5M_EMENI      VGVCSYLLVNFWFTRIAANQSSLSALLTNRVGDTLLTVGMFAILWSFGNIDYSTVFALA-PYYNENXXXX
NU5C_GOSBA      VGMCSYLLIGFWFTRPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNEVHF
NU5C_ADEHI      VGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRNLFQISNNEVNLLFVTL
NU5C_LOTJA      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQIIQNEVNIFFITL
NU5M_STRCA      VGIMSFLLISWWHGRAEANTAALQAVIYNRIGDVGLILSMAWLASTLNTWEIQQISYESQXXXXXXXXXX
NU5M_PHYIN      VGFCSYLLINFWFTRLQANKAAIKAMLVNRISDLILLLGVLTIFYNIRTIEYFSTFAAISIVKDFKFIFF
NU5M_FELCA      VGIMSFLLIGWWYGRADANTAALQAILYNRIGDVGFIMAMAWFLTNSNAWDFQQIFITQHENLNIPXXXX
NU5M_CANLU      VGIMSFLLIGWWYGRTDANTAALQAVLYNRIGDVGFIMTMAWFLLNLNTWDLQQIFITTNDNFNXXXXXX
NU5C_SOYBN      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQIIKNEVNIFFLTL
NU5C_GERJA      VGIRSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRNLFQISNNEVNFLFVTL
NU5C_ATHGR      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFLFVTL
NU5M_HORSE      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMAMAWFLFNTNTWDLQQIFML-----DXXXXXX
NU5M_EQUAS      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMAMAWFLFNTNTWDLQQIFML-----DXXXXXX
NU5C_PACAQ      VGMCSYLLIGFWFTXPAAANACQKAFVTNRICDFGLSLXILRXYWITGXFEFQDLFEIFNNLIYNNEVHF
NU5C_GUIAB      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFVFVTL
NUOL_RICTY      VGVCSYLLIGFWYSKESANKAAMKAFITNRVSDFAFXXXXXXXXXYNGSANYKDVFLSAKLLSNTKILVH
NU5M_TRIRE      VGVCSYLLVSFWFTRIAANQSSLSAFLTNRVGDCFLTIGMFVILWSLGNLDYSTVFSLA-PYXXXXXXXX
NU5M_SCYCA      VGIMSFLLIGWWYSRTDANTAALQAVIYNRIGDIGLILSMAWLAMNLNSWEIQQIFILSKDKDXXXXXXX
NU5M_LEMCA      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLMYSNTWEFQQMFML-----NYHPDMI
NU5M_ACACA      VGLSSYLLINFWYTRIQANKSAMKAIIVNRFGDFGIYXXXXXXXXXXXXXXXXXXXNLVQFLDTQPRMSF
NU5C_PELHO      VGMFSYLLIGFWFTRPVAANACQKAFVTNRVGDFSFLLGILGLYWITGSFEFRDLFEVHNNEIPXXXXXX
NU5C_DIGGR      VGVCSYLLIGFWFTRPLAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIVNNQVNYLFVTL
NU5C_ILLOL      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFKIFNNLIHNNGVNS
NU5C_AMBTC      VGMCSYLSIGFWFTRPSAANACQKAFVTNRVGDFXXXXXXXXXYWIAGSFEFXXXXXXXXXXXXXXFAIL
NU5M_SORFM      VGIMSFLLIGWWYGRADANTAALQAILYNRIGDIGFILAMAWFLFNSNSWELQQIFML-----DTNQNXX
NU5M_GEOPE      VGIMSFLLIGWWYGRTDANTAALQAIIYNRVGDIGLVIAMAWFYKNSNSWELQQIFSLGTTSNLPLIGLI
NU5M_DASNO      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILTMAWLLLHLNSWDLQQIFMLK------PTNXX
NU5C_IPOPU      VGLCSYLLIGFWFTRPGAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRELFQISSKEVNLLFVTL
NU5C_HUPLU      VGMCSYLLIGFWFTRPSAANACQKAFITNRVGDFGLLLGTSGFYWITGSFKFEDLFERANHEVSLFLATP
NU5M_PIG        VGIMSFLLIGWWHGRTDANTAALQAILYNRIGDIGFVLSMAWFLTHSNAWDLQQIFMLNNECPNMPLIGL
NU5M_DUGDU      VGIMSFLLIGWWYGRTDANTAALQAMIYNRIGDVGFVAAMAWFLLHSNSWELQQIFLTV-----PKGNTL
NU5C_LEPVR      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXXXXX
NU5M_DIDMA      VGIMSFLLIGWWYGRSDANTAALQAILYNRIGDIGFMLTMAWLMLNCNSWDLQHIFSM-------NMHPI
NU5M_DICCI      VGIMSYLLINFWYTRLQANKSALKAVILNRXXXXXXXXXXXXXXXXXKSVDFSVIFTVAPFITEYTINLL
NU5C_NICTO      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSXXXXXXXXXXNNEVDFLFVTL
NU5C_MALAR      VGMCSYLLIGFWFTRPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQXLFEIFNNLIYNNEVHL
NUOL_RICFE      VGVCSYLLIGFWYSKESANKAAIKAFITNRASDFAFILGIITIIVYCGSANYKDVFSSAKIFLQFSILDV
NU5M_TRIRU      VGVCSYLLVNFWFTRIAANQSSISAFLTNRVGDCFLTIGMFIIIWSFGNLDYSTVFSLA-PYFNQEFITL
NU5M_SHEEP      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMAWFLINLNTWDLQQIFML-----NPNDSNL
NU5M_PETMA      VGIMSFLLISWWSGRTKANISALQAVAYNRIGDIGLMMSMVWMCSNTNSWD----LQQITMLLSDQQYLI
NU5M_PANTR      VGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFVLALAWFLLHSNSWDPQQMILLSTNTDLTPLLGF
NU5C_COFAR      VGMCSYLLIGFWFTRPLAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYDNEVNS
NU5C_CAPBA      VGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVNF
NU5M_DICDI      VGIMSYLLINFWYTRLQANKSALKAVILNRXXXXXXXXXXXXXXXXXKSVDFSVIFTIAPFITEYTINLL
NU5M_BOVIN      VGIMSFLLIGWWYGRADANTAALQAILYNRIGDIGFILAMAWFLTNLNTWDLQQIFML-----NPSDSNM
NU5M_PANPA      VGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILALAWFLLHSNSWDPQQMVXXXXXXXXXXXXGF
NU5C1_PAUCH     VGMCSYLLIGFWYEREDAANAAQKAFVVNRVXXXXXXXXXXXXXWATNSFDFQIVASISDGSIPHWAAIA
NU5M_RAT        VGIMSFLLIGWWYGLADANTAALQAILYNRVGDIGFILAMTWFCLNMNSWELQQIFXXXXXXXXXXXXXX
NU5M_BOSIN      VGIMSFLLIGWWYGRADANTAALQAVLYNRIGDIGFILAMAWFLTNLNTWDLQQIFML-----NPSDSNM
NU5C_LIRTU      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFEIFNNLIHTNGVNS
NU5M_CHIMO      VGIMSFLLIGWWYGRADANTAALQAVIYNRIGDIGLILSMIWLATNLNSWEMNQFMVLSKXXXXXXXXXX
NU5M_CANFA      VGIMSFLLIGWWYGRTDANTAALQAVLYNRIGDVGFIMTMAWFLLNLNTWDLQQIFITTNDNFNXXXXXX
NU5C_RANMC      VGMCSYLLIGFWFTRPLAANACQKAFVTNRVGDFSLFLGILGLYWITGSFEFRDFFEIAKNLIDNNGYNX
NU5C_CICAR      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFQIFKNEVNIFFVTL
NU5C_CARPA      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNQVHF
NU5M_POLOR      VGIMSFLLIGWWYGRADANMAALQAVIYNRVGDIGLMMTMSWLLINTNSWDIQQLFGLTKNMDXXXXXXX
NU5M_MACRO      VGIMSFMLIGWWFGRTDANTAALQAVLYNRIGDIGFMLAMAWLMINNSSWDLQHIFMT-------NMDTL
NU5M_GORGO      VGIMSFLLIGWWYARTDANTAAVQAILYNRIGDIGFILALAWFLLHSNSWDPQQM-----SXXXXXXXXX
NU5C_NYMAL      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXX
NU5C_EUCGG      VGMCSYLLIGFWFTRPSAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFQILNNLIYNNEVPX
NUOL_CAMJE      VGLCSWLLIGFWYKNDTYSFAANEAFIMNRIADLGMLLGIFWLYLQAGTLKYDEVFSMAQSLDHNALILI
NU5C_SESIN      VGMCSYLLIGFWFTRPSAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNQVNS
NU5C_LIGVU      VGMCSYLLIGFWFTRPLAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEISKNEVNSSFGTL
MRPA_BACSU      TSLSSFLLIGYWYKREKSRYGAAKSLLITVSGGLCMLGGFILLYLITDSFSIREMVHQVQLIAGHELFIP
NU5M_ROUAM      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDVGFLVAMAWFLFNLNTWELQQIFXXXXXXXXXXXXXX
NU5C_OENPA      VGMCSYLLIGFWFTRPIAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVH
NU5C_OENGL      VGMCSYLLIGFWFTRPIAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVH
NU5C_OENEH      VGMCSYLLIGFWFTRPIAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVH
NU5C_OENBI      VGMCSYLLIGFWFTRPIAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVH
NU5C_OENAR      VGMCSYLLIGFWFTRPIAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVH
NU5C_CYCTA      VGMCSYLLIGSWFTRPSAANACQKAFITNRXXXXXXXXXXXXXYQITGSFKFRYLLSIASNEVSSXXXXX
NU5C_CERDE      VGMCSYLLIGFWFARPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFELCNNLIPNNGVNS
NU5M_MOUSE      VGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGL
NU5C_CRYJA      ----------------------------------------------------------------------
NUOL_STRCO      VGLASYLLIGFWQHKPSAATAAKKAFLVNRVGDMGLSIGIMLMFLWFGTFAFGPVXXXXXXXXXXXXXXX
NU5C_ZYGCR      ----------------------------------------------------------------------
NU5C_VICFA      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFQIFKNLIYKNEVNI
NU5C_NUPAD      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXX
NU5M_HYLLA      VGIMSFLLIGWWHAREEANTAAIQAILYNRIGDIGFILALAWFLLHTNSWEPQQMI-----LLNSNPNFX
NUOL_BUCAI      VSVCSYLLIGFYYTELKNNLCAFKAFILTRVSDVFLMIGMFLIYREFNSFNFQEILSSFLNVENFYYLDY
NU5M_CHICK      VGIMSFLLIGWWQGRAEANTAALQAMIYNRIGDIGLILSMAWLASSLNTWEIQQITHPNQTPTLPLLGLI
NU5C_STAPU      VGMCSYLLVGFWFSRPSAAAACQKAFVTNRVXXXXXXXXXXXXYWITGSFDFETITTRFSELLNTNNVNV
NU5C_NEPOL      VGMCSYLLVGFWFTRPTAAEASQKAFITNRVGDFGLLLGILALYWMTGSFEFASIADRLAIPSLRTIACI
NU5M_ORNAN      VGIMSFMLIGWWHARTDANTAALQAILYNRIGDIGFILAMAWFLIHTNSWEFQQMFXXXXXXXXXXXXXX
NU5M_PONPY      VGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILTLAWFLLHSNSWELQQVFXXXXXXXXXXXXXX
NU5M_GADMO      VGIMSFLLIGWWHGRADANTAALQAVLYNRVGDIGLILGMAWLATNVNSWDIQQMFILSKNLDMTLPLLG
NU5M_RHIST      VGISSYLLINFWFTRLQANKAAIKALVMNRVGDWGFSIGLWAIFWTFGNLDFTTVFSLA-PFINEELITI
NU5C_HORVU      VGMCSYLLIGFWFTRPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFQIANNWIPNNGINS
NU5M_XENLA      VGIMSFLLIGWWYARAEPNTAALQAVIYNRVGDIGLILSMAWVAMNLNSWEMQQVFML-----NSDNXXX
NU5C_VITVI      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEXXXXXXXXXXXXX
NU5M_MARPO      VGLASYLLINFWFTRIQANKAAIKAMLINRVGDFGLALGIMGCFTIFQTVDFSTIFACASAFSEPHHYFL
NU5C_MAIZE      ----------------------------------------------------------------------
NU5M_CHLRE      IGVCSYLLIGYWSHRLSAVKSAQKAILVNRVSDGLLMWGVLWVWYHLGSLDLLNVYSAS---------GF
NU5C_SORBI      ----------------------------------------------------------------------
NU5C_PHAVU      IGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQISKNEMNXXXXXX
NU5M_CROLA      VGIMSFLLIGWWYGRADANTAALQAWIYNRVGDIGLIMSMAWLAMNLNSWEIQQIFFLSKDFDMTLPLMG
NU5M_BRALA      VGIMSYLLISWWYARSDANTAALQAIFYNRVGDIGLLIMLMWSLVTLGDWSFTGLYAL------DFVNTF
NU5C_POAPR      ----------------------------------------------------------------------
NU5C_LOBMA      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLILTNRVNX
NU5C_LEMMI      VGMCSYLLIGFWFTRPSAASACQKAFITNRVXXXXXXXXXXXXYWITGSFEFRDLFETLNNEGNSLFPTL
NU5C_CITSI      ----------------------------------------------------------------------
NU5C_CARTI      VGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFLFVTL
NU5C_ANGEV      VGMCSYLLIGFWFSRPSAANACQKAFITNRVGDFGLLLGILGTYWITGSFDIHSLSERFNDLIDSNGVNL
NUOL_RICCN      VGVCSYLLIGFWYSKESXXXXXXXXXXXXXXSDFAFILGVITIIVYCGSANYKDVLSSAKIFLHFSILDI
NU5M_CYPCA      VGIMSFLLIGWWHGRADANTAALQAVIYNRVGDIGLIMTMAWLAMNLNSWEIQQIFALSKNFDMTIPLMG
NU5C_OLIPU      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFKNLILNNRVNX
NU5C_FAGEA      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFRDLFEIFNTLIYNNEVHF
NU5C_CARCG      VGMCSYLLIGFWFTRPLAANACQKAFVTNRXXXXXXXXXXXXFYWITGSFEFRDLFQIVNNEVNLVFLTI
NU5M_PONAB      VGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILALAWFLLHSNSWELQQVFXXXXXXXXXXXXXX
NU5M_CARAU      VGIMSFLLIGWWHGRADANTAALQAVIYNRVGDIGLIMTMAWFAMNLNSWEIQQIFVLSKNFDMTIPLMG
NU5C_MUTAC      VGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRNLFQISNNEVNFLFVTL
NU5C_DRANE      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXX
NU5C_DAUCA      ----------------------------------------------------------------------
NU5C_NASOF      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIXXXXXXXXXXXX
NU5C_LOLPR      ----------------------------------------------------------------------
NU5C_CHLSC      ----------------------------------------------------------------------
NU5M_MYXGL      MGIMSFLLINWWHNRLEANSAAMQAIIYNRIGDTGLIIFMIWSALFTNSWNMKQIFILQNNSMDLWLPLL
NU5M_LOXAF      VGIMSFLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMAWFTIHLNSWEFQQIFXXXXXXXXXXXXXX
NU5M_BRAFL      VGIMSYLLISWWYARSDANTAALQAIFYNRVGDIGLLIMLMWSLVTLGDWSFTGLYAL------DFVNTF
NU5C_AETGR      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWVTGSFEFQDXXXXXXXXXXXXXXXX
MNHA2_STAS1     TSVSSFLLIVYWYSKGDSQFGAIQSFMITVFGGLALLAGFIMIYIVTGTNSITSIIEQSDKIAQSHXXXX
MNHA2_STAES     TSISSFLLISYWYNNGESQLGAIQSFMITVFGGLALLTGFIILYIITGTNTITDILNQRNAISRHXXXXX
MNHA2_STAEQ     TSISSFLLISYWYNNGESQLGAIQSFMITVFGGLALLTGFIILYIITGTNTITDILNQRNAISRHXXXXX
NU5M_CANAL      VGVISYLLISFWSTRITAMKSALSAILLNRMGDTFFVIALGLMINYYHAVDYDTIALVT-PYMNXXXXXX
NU5M_ALLMA      IGVSSYLLINFWFTRIQANKASMQAMLVNRVGDXXXXXXXXXXXXXXXSSDYDTVGIIA-YKLDEQYITI
NU5C_PANGI      ----------------------------------------------------------------------
NU5C_WHEAT      ----------------------------------------------------------------------
NUOL_RICBR      ----------------------------------------------------------------------
NU5M_ONCMY      VGIMSFLLIGWWHGRADANTAAMQAVIYNRVGDIGLILSMAWFATNLNSWEIQQMFASSKGLDLTLPLMG
NU5C_JASNU      VGMCSYLLIGFWFTRPLAANACQKAFVTNRVGDFCLLLGILGFYWITGSFEFRDFFEILKNLIYNNEVNS
NU5C_DIOEL      VGMCSYLLIGFWFTRPIAASACQKAFVINRVXXXXXXXXXXXXYWITGSLEFRDLFEIVNNLIHNNGVNF
NU5C_ASTCO      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISTNQVNFLFVTL
NUOL_BUCBP      VGLCSYLLVGFYYSKINSGYAAIKGFIITRIGDIFLILAIFFIYKNFGTLELKLIFETTNVVENFKFLNY
NU5M_SALSA      VGIMSFLLIGWWYGRADANTAAMQAVIYNRVGDIGLILSMAWFATNLNSWEIQQMFASSKELDLTLPLMG
NU5C_NANDO      VGMCSYLLIGFWFTRPIAASACQKAFVTNRVXXXXXXXXXXXXXXITGSFEFRDLFEITNNLMDNGGVNS
NU5C_CAPBU      VGMCSYLLIGFWFTRPVAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNX
NU5C_ARAHI      VGMCSYLLIGFWFTRPIPANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXX
NU5M_SQUAC      VGIMSFLLIGWWYSRADANTAALQAVIYNRVGDIGLILSMAWLAMNLNSWEIQQLFILSKDKDXXXXXXX
NU5M_HUMAN      VGIMSFLLISWWYARADANTAAIQAILYNRIGDIGFILALAWFILHSNSWDPQQMA-----LLNANPSXX
NU5C_POPTR      VGMCSYLLIGFWFTRPIVSNACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNDNEV
NU5C_POPAL      VGMCSYLLIGFWFTRPIVSNACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNDNEV
NU5C_CRUWA      ----------------------------------------------------------------------
NU5C_BARVE      ----------------------------------------------------------------------
NU5C_ARATH      ----------------------------------------------------------------------
NU5C_ANIIN      VGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQISNNEVNFFFVTL
NU5M_MYOGL      VGIMSFLLIGWWYGRPDANTAALQAVLYNRIGDIGFVLSMAWFLMHSSSWEXXXXXXXXXXXXXXXXXXX
NU5M_LATCH      VGIMSFLLIGWWHGRANANTAALQAVIYNRVGDIGLTLSMVWFAINLNTWE----MQQMFIMSYNTDMTI
NU5C_PEA        ----------------------------------------------------------------------
NUOL_RHOCA      VGVASYLLIGFYYKKPSANAAAIKAFVVNRVGDFGFALGIMGLFFLTDSIDMDVIFASAPELAKTELHFL
NU5M_CRYNV      IGISSYLLINFWYTRMQANKAGMKALTVNRVGDMFLSVGFFAIFWVFGNVDYASVFSVA-PYINETAITI
NU5M_TETNG      VGIMSFLLIGWWYARADANTAALQAVLYNRVGDIGLVFSMAWMATHLNSWEIQQIFFSSKDMDXXXXXXX
NU5M_CANPA      VGVISYLLISFWSTRIAAMKAALSAILLNRMGDTFFMLALGIFLSYFHAVDFDTLSLAA-PYTXXXXXXX
NU5C_CALFG      VGMCSYLLIGFWFTRPTAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNGVNSLFATL
PHAAB_RHIME     TSIVSFLLIGYWHHNAHARDGARMALTITGTGGLAMFVGLIIIGKIVGSYELDAVLASGDAIRNHPLYGT
NU5M_STRPU      ----------------------------------------------------------------------
NQO12_PARDE     VGVASYLLIGFYYXXXXXXXXXXXXFIVNRVGDXXXXXXXXXXYWLTGSVQFDEIFRQVPQLAQTEIDFL
MNHA2_STAHJ     TSVSSFLLISYWYSNAESQLGAIQSFIITVLGGLALLTGFIMLYIITGTNTISELLTQSHSISEHALFIP
NU5M_USTMA      IGISSYLLINFWFTRIQANKSAIKALVVNRVGDMFLSIGFFAIFFVFGNLDYSTVFSIA-PFINEXXXXX
NU5C_ANTFO      VGMCSYLLIGFWFTRPSAANACQKAFITNRXXXXXXXXXXXXXYWITGSFEFENLFKGFKDLLINNEVSP
NU5C_SACOF      ----------------------------------------------------------------------
NU5C_SACHY      ----------------------------------------------------------------------
NU5C_AGRST      ----------------------------------------------------------------------
NU5M_PARLI      ----------------------------------------------------------------------
NU5M_DINSE      VGIMSFLLIGWWHGRQDANTAALQAIIYNRIGDIGLIMTTAWMMTT------SSINMQELMIQHEVVNII
NU5M_ELEMA      VGIMSFLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMAWFIIHLNSWEFQQIFXXXXXXXXXXXXXX
MNHA1_STAS1     XXXXXXXXXXXWRDKQASIYGAQKSMLVTVFXXXXXXXXXXXXXXXXXTTSIQELINNASEIQTSPFFIF
NU5M_PICCA      ----------------------------------------------------------------------
NU5M_PELSU      MGLMSYLLISWWHGRTEATTSGLQAILYNRLADIGFILTFSWCITYMSSLDLNTFFATSTLVTGVPILGM
NU5M_MAMPR      VGIMSFLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMAWFIIHLNSWEFQQIFXXXXXXXXXXXXXX
NU5C_BUXMI      VGVCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNQVNS
NUOL_NEIMB      VGLVSYLLIGFYFKRPSATFANLKAFLINRVGDFGFLLGIGLVLAYFGGSDVFAYLPNVQNATIQLFPGV
NUOL_NEIMA      VGLVSYLLIGFYFKRPSATFANLKAFLINRVGDFGFLLGIGLVLAYFGGSDVFAYLPNVQNATIQLFPGV
MRPA_BACPF      TSLASSLLISYWFHREKSTYGAQKSMLITVFGGFAMLGGFSLLYVMTGTFSIRGIIENVDLVTSSELFLP
NU5M_DANRE      VGIMSFLLIGWWFGRTEANTASLQAVIYNRMGDIGFILTLAWMAMYLNSWDIQQIFILSKDFDMTIPQIG
NU5C_CHAGL      IGMCSYLLVGFWSTRPTAASACQKAFITNRVXXXXXXXXXXXXYWLTGSFQFDIIQDRXXXXXXXXXXXX
NU5M_ASCSU      ----------------------------------------------------------------------
NU5C_CHLAT      ----------------------------------------------------------------------
NU5C_AETCO      VGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWVTGSFEFQDXXXXXXXXXXXXXXXX
NU5C_ORYSJ      ----------------------------------------------------------------------
NU5C_ORYSI      ----------------------------------------------------------------------
NU5C_ORYSA      ----------------------------------------------------------------------
NU5C_ORYNI      ----------------------------------------------------------------------
NU5C_MESVI      ----------------------------------------------------------------------
NUOL_BUCAP      VSICSYLLIGFYYKTTNNTSCALKAFVFTRISDVFLIISMFLIYNKYGTFNFQEILSNFLNVEDCFDXXX
NU5C_MORIN      ----------------------------------------------------------------------
NU5M_YARLI      IGVTSYLLISFWVTRLQAMKSALSAVLMNRFGDAFFVLGLCVIAYVFGTLNYSTIFATA-YLINTDXXXX
NU5C_ADICA      ----------------------------------------------------------------------
MNHA1_STAHJ     XXXXXXXXXXXWREKKASIYGAQKSLIITVXXXXXXXXXXXXXXXAGDSLSLHELIANASEIQHSPLFIF
NU5C_MARPO      ----------------------------------------------------------------------
MNHA1_STAES     XXXXXXXXXXXWREKKASIYGAQKSLIITVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFIL
MNHA1_STAEQ     XXXXXXXXXXXWREKKASIYGAQKSLIITVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFIL
NU5H_NYCOV      ----------------------------------------------------------------------
NU5M_ASTPE      VGFLSFLLISWWTSRANANNSAIQAVIYNRVGDIGXXXXXXXXXXXXNTWSLPEIFSISAPNTFNNXXXX
NDHF_BACSU      ----------------------------------------------------------------------
NU5M_DEBHA      VGVVSYLLISFWNTRIAAMKSALSAILLNRMGDTLFVICIGTMLSYFHAVDFET-MELMTPHTDTYXXXX
NU5M_DROYA      LGLVSYCLVIYFQN-IKSYNAGMLTALSNRIGDVALLLAIAWMLN-YGSWNYIFYLEVMQNEFSMLMIGS
NU5M_PARTE      ----------------------------------------------------------------------
NU5C2_PAUCH     ----------------------------------------------------------------------
HYFD_ECOLI      ----------------------------------------------------------------------
MNHA1_STAAW     ----------------------------------------------------------------------
MNHA1_STAAU     ----------------------------------------------------------------------
MNHA1_STAAT     ----------------------------------------------------------------------
MNHA1_STAAS     ----------------------------------------------------------------------
MNHA1_STAAR     ----------------------------------------------------------------------
MNHA1_STAAN     ----------------------------------------------------------------------
MNHA1_STAAM     ----------------------------------------------------------------------
MNHA1_STAAE     ----------------------------------------------------------------------
MNHA1_STAAC     ----------------------------------------------------------------------
MNHA1_STAAB     ----------------------------------------------------------------------
MNHA1_STAA9     ----------------------------------------------------------------------
MNHA1_STAA8     ----------------------------------------------------------------------
MNHA1_STAA3     ----------------------------------------------------------------------
MNHA1_STAA2     ----------------------------------------------------------------------
MNHA1_STAA1     ----------------------------------------------------------------------
NU5M_ALBCO      XXXXTSFALIAYYDNYNASSSAFLTLMTNRLGDVLIIA----------TFSVILVTGLTVHFPPYTLVWL
MNHA2_STAAR     TSVSSFLLISYWYNNGDSQFGAMQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHALFIP
MNHA2_STAAW     TSVSSFLLISYWYNNGDSQFGAMQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAAU     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAAT     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAAS     TSVSSFLLISYWYNNGDSQFGAMQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAAN     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIP
MNHA2_STAAM     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIP
MNHA2_STAAE     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAAC     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAA9     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIP
MNHA2_STAA8     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAA3     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQADHIKNHGLFIP
MNHA2_STAA2     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIP
MNHA2_STAA1     TSVSSFLLISYWYNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFIP
NU5M_DROME      ----------------------------------------------------------------------
MNHA2_STAAB     TSVSSFLLISYWYNNGDNQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQADHIKNHGLFMP
NU5M_LUMTE      ----------------------------------------------------------------------
NU5M_RHISA      LGLTSYCLVIFYQSS-NSYNSGMMTIISNRVGDVMVI-MMIIFAINFNSFELTSIKS---------FEXX
NU5M_CAEEL      ----------------------------------------------------------------------
NU4C2_TRIEI     ----------------------------------------------------------------------
NU4C3_ANASP     ----------------------------------------------------------------------
NU4C2_ANAVT     ----------------------------------------------------------------------
NU4C1_SYNJA     ----------------------------------------------------------------------
NU5M_ANOGA      ----------------------------------------------------------------------
NU5M_ANOAR      ----------------------------------------------------------------------
NU5M_TRYBB      ----------------------------------------------------------------------
NU5M_ANOQU      ----------------------------------------------------------------------
NU5M_AEDAE      ----------------------------------------------------------------------
NU4C3_ANAVT     ----------------------------------------------------------------------
NU4C2_SYNY3     ----------------------------------------------------------------------
NU4C1_ANASP     ----------------------------------------------------------------------
NU5M_LOCMI      LGLVSYCLVIYYQN-VKSYNAGMLTALSNRIGDVAILISISWMLN-FGS---WNXXXXXXFISDSFEXXX
NU4C_SYNPW      ----------------------------------------------------------------------
NU4C1_SYNP6     ----------------------------------------------------------------------
NU4C1_SYNE7     ----------------------------------------------------------------------
NU4C_SYNS9      ----------------------------------------------------------------------
NU4C2_MICAN     ----------------------------------------------------------------------
NU4C1_SYNJB     ----------------------------------------------------------------------
NU5M_PEA        VGLASYLLIHFWFTRLQADKAATKAMPVNRVGDFGLAPGISGRFTLFQTVDFSTIFARASAPRNSWISCN
NU4C_SYNPX      ----------------------------------------------------------------------
NU4C3_SYNP2     ----------------------------------------------------------------------
NU4C_PROMM      ----------------------------------------------------------------------
NU4C_PROM3      ----------------------------------------------------------------------
NU4C_SYNSC      ----------------------------------------------------------------------
NU4C2_SYNP2     ----------------------------------------------------------------------
NU4C_PROMP      ----------------------------------------------------------------------
NU4C_PROMA      ----------------------------------------------------------------------
NU4C_PROM5      ----------------------------------------------------------------------
NU5M_APILI      ----------------------------------------------------------------------
NU4C1_SYNP2     ----------------------------------------------------------------------
NU4C_SYNS3      ----------------------------------------------------------------------
NU4C_SYNR3      ----------------------------------------------------------------------
NU4C_PROMS      ----------------------------------------------------------------------
NU4C_PROM9      ----------------------------------------------------------------------
NU4C_PROM4      ----------------------------------------------------------------------
NU4C_PROM2      ----------------------------------------------------------------------
NU4C_PROM0      ----------------------------------------------------------------------
NU5M_ANOQN      ----------------------------------------------------------------------
NU4C_PROMT      ----------------------------------------------------------------------
NU4C_PROM1      ----------------------------------------------------------------------
NU4C_CRYJA      ----------------------------------------------------------------------
NU4C_ACAM1      ----------------------------------------------------------------------
NU4C2_SYNJA     ----------------------------------------------------------------------
NU4C1_TRIEI     ----------------------------------------------------------------------
NU4C1_THEEB     ----------------------------------------------------------------------
NU4C2_SYNJB     ----------------------------------------------------------------------
NU4C_MESVI      ----------------------------------------------------------------------
NU4C_GLOVI      ----------------------------------------------------------------------
NU4C2_ANASP     ----------------------------------------------------------------------
NU4C1_ANAVT     ----------------------------------------------------------------------
NU2C_GLOVI      ----------------------------------------------------------------------
NU4C_TOBAC      ----------------------------------------------------------------------
NU4C_NICSY      ----------------------------------------------------------------------
NU4C1_SYNY3     ----------------------------------------------------------------------
NU2C_SYNJA      ----------------------------------------------------------------------
NU4C1_MICAN     ----------------------------------------------------------------------
NU4C_IPOPU      ----------------------------------------------------------------------
NU4C2_THEEB     ----------------------------------------------------------------------
NU4C2_SYNP6     ----------------------------------------------------------------------
NU4C2_SYNE7     ----------------------------------------------------------------------
NU4C_PHYPA      ----------------------------------------------------------------------
NU4C_PELHO      ----------------------------------------------------------------------
NU4C_HUPLU      ----------------------------------------------------------------------
NU2C_STAPU      ----------------------------------------------------------------------
NU4C_PHAVU      ----------------------------------------------------------------------
NU2C_THEEB      ----------------------------------------------------------------------
NQO13_PARDE     ----------------------------------------------------------------------
NU4C_SOLLC      ----------------------------------------------------------------------
NU4C_JASNU      ----------------------------------------------------------------------
NU2C_SYNP2      ----------------------------------------------------------------------
NU2C_SYNP6      ----------------------------------------------------------------------
NU2C_SYNE7      ----------------------------------------------------------------------
NU2C_CHAGL      ----------------------------------------------------------------------
NU2C_ANAVT      ----------------------------------------------------------------------
NU2C_ANASP      ----------------------------------------------------------------------
NUOM_RICPR      ----------------------------------------------------------------------
NUOM_RHOCA      ----------------------------------------------------------------------
NU4C_LOTJA      ----------------------------------------------------------------------
NU4C_CYCTA      ----------------------------------------------------------------------
Y051_MYCTU      ----------------------------------------------------------------------
NU4C_CHAGL      ----------------------------------------------------------------------
NU4C_CARPA      ----------------------------------------------------------------------
NU4C_ATRBE      ----------------------------------------------------------------------
NU2C_ZYGCR      ----------------------------------------------------------------------
NU2C_PHYPA      ----------------------------------------------------------------------
NU4C_SOLTU      ----------------------------------------------------------------------
NU4C_CITSI      ----------------------------------------------------------------------
NU4C_ARAHI      ----------------------------------------------------------------------
NU4C_ADICA      ----------------------------------------------------------------------
NUOM_ECOLI      ----------------------------------------------------------------------
NUOM_ECO57      ----------------------------------------------------------------------
NU4C_NICTO      ----------------------------------------------------------------------
NU4C_ZYGCR      ----------------------------------------------------------------------
NUON_PSEAE      ----------------------------------------------------------------------
NU4C_DRANE      ----------------------------------------------------------------------
NU4C_BUXMI      ----------------------------------------------------------------------
NU4C_RANMC      ----------------------------------------------------------------------
NU4C_NUPAD      ----------------------------------------------------------------------
NU2C_ADICA      ----------------------------------------------------------------------
HYFF_ECOLI      ----------------------------------------------------------------------
NU4M_CHOCR      ----------------------------------------------------------------------
NU4C_AETGR      ----------------------------------------------------------------------
NU4C_AETCO      ----------------------------------------------------------------------
NU2C_MARPO      ----------------------------------------------------------------------
NU5M_MYTED      LGLTSFLLVAYYQNNKSLSAAMLTAL-TNRIGDVLVLISISIFL-----SEGGWLIYSYHPVQMWLNLGF
NU4C_OLIPU      ----------------------------------------------------------------------
NU4C_NYMAL      ----------------------------------------------------------------------
NU4C_NASOF      ----------------------------------------------------------------------
NU4C_CRUWA      ----------------------------------------------------------------------
NU4C_CAPBU      ----------------------------------------------------------------------
NU4C_ARATH      ----------------------------------------------------------------------
HYFB_ECOLI      ----------------------------------------------------------------------
NU4M_METSE      ----------------------------------------------------------------------
NU4C_LOBMA      ----------------------------------------------------------------------
NU4C_CERDE      ----------------------------------------------------------------------
NU4C_MORIN      ----------------------------------------------------------------------
NU4C_MANES      ----------------------------------------------------------------------
NU4C_OENPA      ----------------------------------------------------------------------
NU4C_OENAR      ----------------------------------------------------------------------
NUON_PECCP      ----------------------------------------------------------------------
NU5M_ARTSF      LGITSYLLIMFYKNYNSSSSGMIT-ILSNRVGDVLILWSLGLMFYS----------KSWDYXXXXXXXXX
NU4C_OENGL      ----------------------------------------------------------------------
NU4C_OENEH      ----------------------------------------------------------------------
NU4C_OENBI      ----------------------------------------------------------------------
NU4C_LEPVR      ----------------------------------------------------------------------
NU2C_MESVI      ----------------------------------------------------------------------
NUON_SHISS      ----------------------------------------------------------------------
NUON_SHIFL      ----------------------------------------------------------------------
NUON_SHIBS      ----------------------------------------------------------------------
NUON_ENTS8      ----------------------------------------------------------------------
NUON_ECOSM      ----------------------------------------------------------------------
NUON_ECOSE      ----------------------------------------------------------------------
NUON_ECOLI      ----------------------------------------------------------------------
NUON_ECOLC      ----------------------------------------------------------------------
NUON_ECOHS      ----------------------------------------------------------------------
NUON_ECOBW      ----------------------------------------------------------------------
NUON_ECO8A      ----------------------------------------------------------------------
NUON_ECO7I      ----------------------------------------------------------------------
NUON_ECO5E      ----------------------------------------------------------------------
NUON_ECO57      ----------------------------------------------------------------------
NUON_ECO55      ----------------------------------------------------------------------
NUON_ECO27      ----------------------------------------------------------------------
NUON_ECO24      ----------------------------------------------------------------------
NUON_SHIDS      ----------------------------------------------------------------------
NUON_SALCH      ----------------------------------------------------------------------
NUON_ENT38      ----------------------------------------------------------------------
NU4M_DANRE      ----------------------------------------------------------------------
NUON_SALTY      ----------------------------------------------------------------------
NUON_SALTI      ----------------------------------------------------------------------
NUON_SALSV      ----------------------------------------------------------------------
NUON_SALPB      ----------------------------------------------------------------------
NUON_SALPA      ----------------------------------------------------------------------
NUON_SALNS      ----------------------------------------------------------------------
NUON_SALHS      ----------------------------------------------------------------------
NUON_SALG2      ----------------------------------------------------------------------
NUON_SALEP      ----------------------------------------------------------------------
NUON_SALDC      ----------------------------------------------------------------------
NUON_SALAR      ----------------------------------------------------------------------
NUON_SALA4      ----------------------------------------------------------------------
NUON_CITK8      ----------------------------------------------------------------------
NU4M_POLOR      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXKSAQFPAHGWLTEVMETPTPVSALLHAGVINAGGFLLIRFADXXXXXXXXXXXXXXIGG
NU5M_METSE      CLFLFIGAVG-KSAQLGLHTWLPDAMEGPTPVSALIHAAMVTAGVFLLIRSSPLLEQAPMALMVVTIVGS
NU5C_SYNY3      XXXXVFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMYPVFEPIPVVMNTIAFTGC
NUOL_ECOLI      ATLMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAAMVTAGVYLIARTHGLFLMTPEVLHLVGIVGA
NU5C_CUCSA      LFLTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIAIPYIMNLIALIGI
NU5C_DAMDI      CALLLFTGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLIARLLPLFIVIPHIMNFISLIGI
NU5M_PENMA      IGICLVIGATAKSSQVGLHIWLPQAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLIICLWLGA
NU5C_PIPCE      XXXXXXXGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFINLPYIMYFISLIGI
NU5M_CRYPA      XXXXXXXGAMAKSSQVGLHVWLPMAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLLICLWLGA
NU5C_ACOCL      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFTVIPYIMNFISLIGI
NU5C_ACOAM      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFTVIPYIMNFISLIGI
NU5C_PSINU      CAILLFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMFHFFKALPLTMSFISWIGA
NU5C_SYNP2      XXXXXXXGPVAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMYPVFEPIPEAMNVIAWTGA
NUOL_PSEAE      XXXXXXXXXVGKSAQLPLQTWLADAMAGPTPVSALIHAAMVTAGVYLIARCHGLFTLAPDILELVGIVGA
NU5M_ASPNG      XXXXXXXXXXXKSSQVGLHIWLPQAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLVLCLWLGA
NQO12_THET8     XXXXXXXXXXXKSAQIPLMVWLPDAMAGPTPVSALIHAAMVTAGVYLIARSSFLYSVLPDVSYAIAVVGL
NU5M_WHEAT      MRLNAITLICIKSAQIGLHTWLPDAMEGPTPVSALIHAAMVTAGVFMIARCSPLFEYSPTALIVITFAGA
NU5C_CHAVU      CSFLLFCGPIAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFQLFPSIMNLITCIGI
NUOL_MYCTU      IGLLMLLGACAKSAQVPLQAWLGDAMEGPTPVSALIHAAMVTAGVYLIVRSGPLYNLAPTAQLAVVIVGA
NU5M_OENBE      MRLNAITLICIKSAQIGLHTWLPDAMEGPTPVSALIHAAMVTAGVFMIARCSPLFEYSPTALIVITFAGA
NU5M_NEUCR      IGICLLIGAMAKSSQVGLHVWLPMAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLLLCLWLGA
NU5C_TECST      CAALLFAGAVAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGFLVARLLTLFIVIPYILNIISLIGL
NU5C_MANES      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFVIIPFIMNLIALIGI
NU5M_CERSI      PLMGLLLAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMENNKTVQTFTLCLGA
NU5C_SPIOL      XXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVVIPYIMYVISFIGI
NU5C_DRIGR      LFATLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFTVIPYIMNLISLIGV
NU5C_PHYPA      CALLLFLGPIAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGFLVARWFPLFQLLPFVMTIISWVGA
NUOL_RICPR      FSILDIICLLLKSAQIGLHVWLPDAMEGPTPVSALIHAAMVTAGVFLVARCSYLFEYSPIVLQFITIIGG
NU5M_RHIUN      PLMGLLLAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMENNKTAQTLTLCLGA
NU5C_ATRBE      CAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5M_HALGR      LLAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMEHNTMMQTTTLCLGA
NU5C_PLAOC      LFVTLCASLLFKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFTVIPYIMNLISLIGI
NU5C_LACSA      CAILLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5C_ATRJA      CAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPHIMNFISLIGI
NU5M_PODAN      XXXXXXXXAMAKSSQVGLHVWLPMAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYNSTVLLLCLWLGA
NU5M_CHOCR      GFKLHVLTLISKSAQLGLHTWLPDAMEGPTPVSALIHAAMVTAGVFLMIRFSPLLEFSPTILFILITFGS
NU5M_ARATH      MRLNAISLICIKSAQIGLHTWLPDAMEGPTPVSALIHAAMVTAGVFMIARCSPLFEYSPTALIVITSAGA
NU5M_RABIT      PLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFYPLLENNKTAQTLILCLGA
NU5M_PHOVI      XXAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMEHNTMMQTTTLCLGA
NU5C_HELAN      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISFIGI
NU5C_FLARA      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5C_AMBTR      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNLISLIGI
NU5M_PAPHA      PLMGLLLAAVGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMENDTLTQNLTLCLGA
NU5M_BALPH      VLAAAG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLVRFYPLMENNKLIQTVTLCLGA
NU5M_BALMU      VLAAAG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLVRFYPLMENNKLIQTVTLCLGA
NU5C_CICIN      CAILLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5C_BRADI      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLLPLFISLPLIMTFISLVGT
NU5M_SCHCO      GFLLLVGAMA-KSSQIPLHNWLPGSMEGPTPVSALIHAALVTAGSYLLIRSSPILEYAPTVLLVITIIGA
NU5C_TOBAC      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_SOLTU      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_SOLLC      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_SOLBU      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_NICSY      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_GOSHI      LFVTLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPYIMNLISLIGI
NU5M_HIPAM      PLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFYPMMENNNLMQTITMCLGA
NU5M_EMENI      XXXXXXXXXXXKSSQVGLHIWLPQAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLVLCLWLGA
NU5C_GOSBA      LFVTLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFIVIPYIMNLISLIGI
NU5C_ADEHI      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPHIMNFISLIGI
NU5C_LOTJA      CALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPFFIAIPSIMNGIAFIGI
NU5M_STRCA      XXXXX------KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLVRIHPLLANNQXXXXXXXXXXX
NU5M_PHYIN      NYILSIIDVACKSAQIFLHLWLPDAMEGPTPVSALIHAAMVTAGVYLTARCSPMFEYSMFSLKIITIIGA
NU5M_FELCA      XXAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFYPLMEQNKTMQTLTLCLGA
NU5M_CANLU      XXAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMEHNQTIQTLTLCLGA
NU5C_SOYBN      VALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVLPAIMNGIAFIGI
NU5C_GERJA      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPHIMNFISLIGI
NU5C_ATHGR      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5M_HORSE      XXXXXXXXXXXKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMENNKTIQSLTLCLGA
NU5M_EQUAS      XXXXXXXXXXXKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMENNKTIQSLTLCLGA
NU5C_PACAQ      LFVTLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVPRLLPLFIVIPYIMNLISLIGI
NU5C_GUIAB      CAILLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFPVARLMPLFIVIPHIMNFISLIGI
NUOL_RICTY      FXXXXXXXXXXKSAQIGLHVWLPDAMEGPTPVSALIHAAMVTAGIFLVARCSYLFEYSPIVLQFITIIGG
NU5M_TRIRE      XXXXXXXXAMAKSSQVGLHIWLPMAMEGPTPVSALIHAAMVTAGVYLLIRSSPLIEYSSTVLLICLWLGA
NU5M_SCYCA      XXXXXXG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPLIQDNQFILTTCLCLGA
NU5M_LEMCA      PLIGLLLAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLMENNKTIQTLMLCLGA
NU5M_ACACA      LGFSLNRVDLIKSAQLGLHTWLPDAMEGPTPVSALIHAAMVTAGVFVLIRSSPILEYSSTGLFLVSLIGG
NU5C_PELHO      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVMPYILNLISFIGI
NU5C_DIGGR      CAALLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAEGFLVARLLPLFIVIPYIMNFISLIGI
NU5C_ILLOL      LFVTFFASLLFKSAQFPLHIWLPDAMEGPTPISALIHAAMVVAGIFLVARLLPLFTVIPYIMNLISLIGV
NU5C_AMBTC      CASLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLLTVIPYIMNLISLIGV
NU5M_SORFM      XXXXXXXAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLIETNKTMQTLILCMGA
NU5M_GEOPE      LAAMG------KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMSNNSMIMTTILCIGA
NU5M_DASNO      XXXXXXVAAAGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLVRFYPLMQNNPTILTMTLCLGA
NU5C_IPOPU      CAALLFVGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATLVAAGFLVARLLPLFLVIPYIMYFISLIGI
NU5C_HUPLU      CALLFPLGPVAKSAQFPLHVWLPDAMEGPTPISAPIHAATMVAAGFLVARMFPLFQTLPLVMSSISWVGG
NU5M_PIG        LLAAAG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFYPLMETNKLVQTMTLCLGA
NU5M_DUGDU      PLTGLLLAAMGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMEMNPSILTLTLCVGA
NU5C_LEPVR      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5M_DIDMA      ALLGLIIAATGKSAQFSLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFHPMLENNKTMLTITLCLGA
NU5M_DICCI      GYEVNAITLIGKSAQLGLHMWLPDAMEGPTPVSALLHAAMVTAGVFLVLRTSPLLSYSITILNILTIIGA
NU5C_NICTO      CAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVIPYIMYLISVIGI
NU5C_MALAR      LFVTLCASLLFKSAQFPLHVWLPDAMXGPTPISALIHAATMVATGFLVARLLPLFIVIPYIMNLISLIGI
NUOL_RICFE      ICLLLFIGCMGKSAQIGLHVWLPDAMEGPTPVSALIHAAMVTAGVFLVARCSYLFEYSPLVLQFITIIGG
NU5M_TRIRU      IGICLLIGAMAKSSQIGLHVWLPQAMEGPTPVSALIHAAMVTAGVYLLMRSSPLIEYSSTVLILCLWLGA
NU5M_SHEEP      PLMGLILAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLTENNKFGQSIMLCLGA
NU5M_PETMA      PTLGFLIAATGKSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGVFLLIRLHPLFQNYPLMLEMTLCLGA
NU5M_PANTR      LLAAAG-----KSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLAENNPLIQTLTLCLGA
NU5C_COFAR      LFVTLCAGLVFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLIPLFIVIPYIMNFISLIGI
NU5C_CAPBA      LFVTLCAVLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFRVXXXXXXXXXXXXX
NU5M_DICDI      GYEVNAITLIGKSAQLGLHMWLPDAMEGPTPVSALLHAAMVTAGVFLVLRTSPLLSYSITILNILTIIGA
NU5M_BOVIN      PLIGLALAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLTENNKYIQSITLCLGA
NU5M_PANPA      LLAAAG-----KSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLAENNPLIQTLTLCLGA
NU5C1_PAUCH     LCLLLFMGPMAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARLEPLYSQVPDVQIIVAVIGT
NU5M_RAT        XIAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLMIRFHPLTSNNSTIMTAMLCLGA
NU5M_BOSIN      PLIGLALAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLTENNKFIQSITLCLGA
NU5C_LIRTU      LFATLCAFLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPIFTVIPYIMNLISLLGI
NU5M_CHIMO      XXXXXXX----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLVRLNPLFQNNKEILTVCLCLGA
NU5M_CANFA      XXAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLMEHNQTIQTLTLCLGA
NU5C_RANMC      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLFPLFTVIPYIMNXXXXXXX
NU5C_CICAR      CALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPSIMSGIALIGI
NU5C_CARPA      LFVTLCAFLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIGIPYIMYLISLIGI
NU5M_POLOR      XXXXXXX----KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRLHPLIENNNNILTAALCLGA
NU5M_MACRO      ALMGLVIAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFHPMIKDNPTILTTTLCLGA
NU5M_GORGO      XXXGFLLAAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFRHLAENNSLAQTLTLCLGA
NU5C_NYMAL      XXXATLCAFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIAIPYIMNIISLIGV
NU5C_EUCGG      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIIIPYIMNFISLIGI
NUOL_CAMJE      ATCLFIGAMG-KSAQFPFHTWLADAMAGPTPVSALIHAAMVTAGVYLVIRASTLYDLVPEVSYIIALLGA
NU5C_SESIN      PFVTLCAALLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPYIMNFISLIGI
NU5C_LIGVU      CAALLFTGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPYIMNFISFIGI
MRPA_BACSU      AMILILLGAFTKSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGIYVIARFSPIFAFSAQWFWIVSLVGL
NU5M_ROUAM      XXXXXX-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFYPLTESNKTIQTMMLCLGA
NU5C_OENPA      FLFVTLCSFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVITPYIMNLISLIGI
NU5C_OENGL      FLFVTLCSFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVITPYIMNLISLIGI
NU5C_OENEH      FLFVTLCSFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVITPYIMNLISLIGI
NU5C_OENBI      FLFVTLCSFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVITPYIMNLISLIGI
NU5C_OENAR      FLFVTLCSFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVITPYIMNLISLIGI
NU5C_CYCTA      XXXXXXXGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFKALPFIMNLISWTGG
NU5C_CERDE      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPYIMNLISLIGV
NU5M_MOUSE      LIAATG-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLVRFHPLTTNNNFILTTMLCLGA
NU5C_CRYJA      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLFKALPLIMYLISWIGG
NUOL_STRCO      XKXXXXXXXXXKSAQVPLQSWLGDAMEGPTPVSALIHAAMVTAGVYLIVRSGAIFNGAPDAQLVVTIVGA
NU5C_ZYGCR      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVYLVARLLPLFQEVPLVMDIVAWTGG
NU5C_VICFA      LFVTLCALLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPSIMSGIALIGI
NU5C_NUPAD      XXXATLCAFLLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIGIPYIMNIISLIGL
NU5M_HYLLA      XXXXXXXXXRGKSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLTENNQLIQTLTLCLGA
NUOL_BUCAI      ITLFLLLGVIGKSAQLPLQTWLSDAMVGPTPVSALIHAAMVTAGVYLIARTHFLFLLTPGILYLVGLIGT
NU5M_CHICK      LAATG------KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRTHPFLSSNKXXXXXXXXXXX
NU5C_STAPU      SFAIVCSLLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPIFQNLPIVMDTIAITGV
NU5C_NEPOL      ACILVFMGPIAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMFPVFDQLPLVMELIAWTGT
NU5M_ORNAN      AATG-------KSAQFGLHPWLPFAMEGPTPVSALLHSSMVVAGIFLLVRFSPLLEQNSTALTMALCLGA
NU5M_PONPY      XXXXXX-----KSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFHPLMENNPPIQTLALCLGA
NU5M_GADMO      LILAATG----KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRMSPLMENNQXXXXXXXXXXX
NU5M_RHIST      ISICLLVAAMGKSAQIGLHTWLPDAMEGPTPVSALIHAAMVTAGVYLLLRSSPILEFGSTALILITWVXX
NU5C_HORVU      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLLPLFISLPLIMSFISLVGT
NU5M_XENLA      XXXXXXXXXXXKSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRISPMMNNNQTALTICLCLGA
NU5C_VITVI      XXLFVSLCALFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLFPLFIVIPYIMNXXXXXXX
NU5M_MARPO      FCNMGFHAITVKSAQIGLHTWLPDAMEGPTPVSALIHAAMVTAGVFMIARCSPLFEYSPNALIVITFVGA
NU5C_MAIZE      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLLPLFISLPWIMSFISLIGT
NU5M_CHLRE      VGLSILIGAMGKSAQILFHVWLADAMEGPTPVSALIHAALVTAGVYLLVRL------HIHDEMFVIIVGS
NU5C_SORBI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLLPLFISLPLIMSFISLVGT
NU5C_PHAVU      XXXXXXCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIXXXXXXXXXXXXXXQIMNTIAIGL
NU5M_CROLA      LILAATG----KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRLHAIMENNQXXXXXXXXXXX
NU5M_BRALA      FLLGVVLAAAGKSAQLGLHPWLPAAMEGPTPVSSLLHSSMVVAGVFLLIRFSPIILNHKEIQLMVFFLGT
NU5C_POAPR      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLFPLFISIPLIMTLISLVGT
NU5C_LOBMA      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPXXXXXXXXXXXXXXXXX
NU5C_LEMMI      CAFLLFLGAIAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFTGIPYIMNIISXXXX
NU5C_CITSI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPYAMNLISLIGI
NU5C_CARTI      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5C_ANGEV      FLANMCALLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFFVARMFHFFEALPFTMNIISWVXX
NUOL_RICCN      ICLLLFIGCMGKSAQIGLHVWLPDAMEGPTPVSALIHAAMVTAGVFLVARCSYLFEYSPLILQFITIIGG
NU5M_CYPCA      LALAATG----KSAQFGLHPWLPVAMEGPTPVSALLHSSMVVAGIFLLIRLHPRMENNQXXXXXXXXXXX
NU5C_OLIPU      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_FAGEA      LVGTVCTFLLFKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLFPLLIVTPFILNLIALVGI
NU5C_CARCG      CAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFIVIPYILNLISFXXX
NU5M_PONAB      XXXXXX-----KSAQLGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFHPLTENSPHIQTLTLCLGA
NU5M_CARAU      LALAATG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPLMENNQXXXXXXXXXXX
NU5C_MUTAC      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPHIMNFISLIGI
NU5C_DRANE      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_DAUCA      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLIPLFIVIPHIMNFISLVGV
NU5C_NASOF      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_LOLPR      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLLARLFPLFISLPLIMTLISLVGT
NU5C_CHLSC      -----------KSAQFPLHVWLPDAMEVPTPISALIHAATMVAAGFLVARLLPIFTVIPYIMNLIALIGV
NU5M_MYXGL      GIVLAATG---KSAQFMLHPWLLSAMEGPTPVSALLHSSMVVSGVFLLIRFYPMIKNSQMIISIILCLGA
NU5M_LOXAF      XXXXXXXX-----AQFGLHPWLPSAMEGPTPVSALLHSSMVMAGVFTLIRFYPLMENNLTIQTSTLCLGA
NU5M_BRAFL      FLLGVVLAAAGKSAQLGLHPWLPAAMEGPTPVSSLLHSSMVVAGVFLLIRFSPIILNHKEIQLMVFFLGT
NU5C_AETGR      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFXXXXXXXXXXXXXXX
MNHA2_STAS1     XXXXXXXGAFTKSAQFPFHIWLPKAMAAPTPVSAYLHATMVKAGIFLLFRFTSVLGLSDFYIYSVTFVGL
MNHA2_STAES     XXXXXXXGAFTKSAQFPFHIWLPKAMAAPTPVSAYLHATMVKAGIFLLFRFTPLLGLSNVYIYTVTFVGL
MNHA2_STAEQ     XXXXXXXGAFTKSAQFPFHIWLPKAMAAPTPVSAYLHATMVKAGIFLLFRFTPLLGLSNVYIYTVTFVGL
NU5M_CANAL      XXXXXXXXXXXXXXXXGLHAWLLQAMEGPTPVSALLHAAMVCAGVYVLVRSYMILEYTPTMLLIICWLGG
NU5M_ALLMA      VTLFLLIAAIGKSAQLGLHTWLPSAMEGPTPVSALIHAALVTAGVYLILRSSPLFELAPTSLICVCVIGS
NU5C_PANGI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLIPLFIVIPHIMNLISLVGI
NU5C_WHEAT      -----------KSAQFPLHVWLPDAMEGPTPISALIQAATMVAAGFLLARLLPLFISLPLIMSFISLVGT
NUOL_RICBR      -----------KSAQIGLHVWLPDAMEGPTPVSALIHAAMVTAGVFLVARCSYLFEYSPMVLQFITIIGG
NU5M_ONCMY      LILAATG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPLMEDNQTALTVXXXXXX
NU5C_JASNU      SFLTLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFIVIPYIMNFISXXXX
NU5C_DIOEL      RFAILCACLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLRPLFIVIPYIMNXXXXXXX
NU5C_ASTCO      CAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPHIMNFISLIGI
NUOL_BUCBP      VSLFLLIAAIAKSAQVPLQTWLIDAMAGPTPASALIHSSMVTAGVYLIARMNFLFSLSPIILYILGIISC
NU5M_SALSA      LILAATG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPLMENNQXXXXXXXXXXX
NU5C_NANDO      LFLTLCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFTVIPYVMNFISXXXX
NU5C_CAPBU      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_ARAHI      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5M_SQUAC      XXXXXXG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPLMQDNQLIXXXXXXXXX
NU5M_HUMAN      XXXXXXXXXXXXXXXXXXHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRFHPLAENSPLIQTLTLCLGA
NU5C_POPTR      HFLFVTLCAFLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVVIPYIMKLIALIGI
NU5C_POPAL      HFLFVTLCAFLKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFVVIPYIMKLIALIGI
NU5C_CRUWA      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_BARVE      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_ARATH      -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_ANIIN      CAVLLFGGAIAKSAQFPLHVWLPDAMEGPTPISALIRAATMVAAGFLVARLMPLFIVIPHIMNFISLIGI
NU5M_MYOGL      XXXXXX-----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRFYPFIKNNQLVQSIIMCLGA
NU5M_LATCH      PLLGLTLAAAGKSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGIFLLIRLHPLMDNNKLIXXXXXXXXX
NU5C_PEA        -----------KSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGFLVARLLPLFIVIPSIMTGIALIGI
NUOL_RHOCA      AWEFXXXXXXXKSAQLFLHTWLPDAMEGPTPVSALIHAAMVTAGVFLVCRMSPLFEYAPEAKMMXXXXXX
NU5M_CRYNV      IGLLLLVGAMAKSANIPLHTWLPDAMEGPTPVSALIHAALVTAGVYLMLRSSPIIEYGPTVLVVITWVXX
NU5M_TETNG      XXXXXXG----KSAQFGLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRTSPLMENNPXXXXXXXXXXX
NU5M_CANPA      XXXXXXXXXXXXXXXXGLHAWLLQAMEGPTPVSALLHAAMVCAGVYVLVRSYFILEYAPSLLIGICWLGG
NU5C_CALFG      CAFLLFVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFTVIPYIMNLISXXXX
PHAAB_RHIME     XXXXXXXGALTKSAQFPFHFWLPHAMAAPTPVSAYLHATMVKAGVFLLVRFWPVMAGTEAWFWIVXXXXX
NU5M_STRPU      -----------KSAQFGLHPWLPALLEGPTPVSALLHSSMVVAGVFLLVRTSELFSSPLITHSLVLILGG
NQO12_PARDE     WRDWNAANLLGKSAQLLLHTWLPDAMEGPTPVSALIHAAMVTAGVFLVCRMSPLYEFAPDAKNXXXXXXX
MNHA2_STAHJ     MMIMLLIGAFTKSAQFPFHIWLPKAMAAPTPVSAYLHATMVKAGIFLLFKFTPILGLSDSYIYIVTFVGL
NU5M_USTMA      XXXXXXXAAMGKSAQLGLHTWLPDPMEGPTPVSALIHAALVTAGVYLLLRSSPVIEYGPTTLIVITWVGA
NU5C_ANTFO      FFAILCASFLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIYLVARMFPLFETLPFVMSVISWXXX
NU5C_SACOF      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGXXXXXXXXXXXXXXXXXXXXXXXVGT
NU5C_SACHY      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGXXXXXXXXXXXXXXXXXXXXXXXVGT
NU5C_AGRST      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGXXXXXXXXXXXXXXXXXXXXXXXVGT
NU5M_PARLI      -----------KSAQFGLHPWLPAAMEGPTPVSALLHSSMVVAGVFLLVRTSELFSNYPNANTIVLVLGG
NU5M_DINSE      PLLGLVAAATGKSAQFSLHPWLPSAMEGPTPVSALLHSSMVVAGVFLLIRLHPILHNNKIMLTCCLILGX
NU5M_ELEMA      XXXXXXXX-----AQFGLHPWLPSAMEGPTPVSALLHSSMVMAGVFTLIRFYPLMENNLTIQTSTLCLGA
MNHA1_STAS1     SMILVLIGAMTKSAQFPFYVWLPDAMEAPTPVSAYLHATMVKAGLYLVARMTPIFAVSQGWIWTVTAVGL
NU5M_PICCA      -----------KSAQFGLHNWLIWAMAGPTPVSVLLHAALVIAGIYLLMRSSPILENCPNILLFNLWLGA
NU5M_PELSU      LMAAMG-----KSAQFGMHPWLPAAMEGPTPVSALLHSSMVTAGVYLLIGMHPILSQTQGFSEACLTMGA
NU5M_MAMPR      XXXXXXXXX-----QFGLHPWLPSAMEGPTPVSALLHSSMVMAGVFTLIRFYPLMENNLTVQTSTLCLGA
NU5C_BUXMI      LFVILCASLLFKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFTVIPYIMNXXXXXXX
NUOL_NEIMB      EWSLITVTCLLKSAQFPLHVWLPDSMEGPTPISALIHAAMVTAGLFMVSRMSPIYEMSSTALSVIMVIGA
NUOL_NEIMA      EWSLITVTCLLKSAQFPLHVWLPDSMEGPTPISALIHAAMVTAGLFMVSRMSPIYEMSSTALSVIMVIGA
MRPA_BACPF      AMILVLLGAFTKSAQFPFHIWLPDAMEAPTPVSAYLHATMVKAGIYLVARLTPVFAGSAEWFWLLTGFGV
NU5M_DANRE      LIIAATG----KSAQFTLHPWLPSAMEGPTPVSALLHSSMVVAGIFLLIRLHPIMETNKLAPTIXXXXXX
NU5C_CHAGL      XXXIISSVLLFKSAQFPLHIWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPIFQLSPLLMILIAFTGA
NU5M_ASCSU      -----------KSAQFPFSGWLPKAMSAPTPISSLVHSSTLVTAGLVLIMNFSEMILNKDVIMIIMVVGV
NU5C_CHLAT      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMFPIFNQFPIVMGFXXXXXX
NU5C_AETCO      XXXXXXXXXXXKSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLVARLLPLFXXXXXXXXXXXXXXX
NU5C_ORYSJ      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLIARLLPLFISLPLIMSFISXXXX
NU5C_ORYSI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLIARLLPLFISLPLIMSFISXXXX
NU5C_ORYSA      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLIARLLPLFISLPLIMSFISXXXX
NU5C_ORYNI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLIARLLPLFISLPLIMSFISXXXX
NU5C_MESVI      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGVFLVARMFPIFSQFPFLMDLXXXXXX
NUOL_BUCAP      XXXXXXXGVMGKSAQLPLHTWLSDAMVGPTPVSALIHAAMVTAGVYLIARTHFLFLLTPKXXXXXXXXXX
NU5C_MORIN      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFLGARLLPLFIVMPYIMNXXXXXXX
NU5M_YARLI      XXXXXXXXXXXKSAQFGLHNWLTLAMEGPTPVSSLLHAALVTAGIYLLLRSANILEYTPTVLFIILWIGA
NU5C_ADICA      -----------KSAQFPLHVWLPDAMEGPTPISALIHAAMVAAGIFFIARIYGLISTLPLVMQASSWXXX
MNHA1_STAHJ     AMVLIMLGAFTKSAQVPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLVARVTPLFAISQGWIWTITLVGL
NU5C_MARPO      -----------KSAQFPLHIWLPDAMEGPTPISALIHAAMVAAGIFLVARMFPLFQMLPFVMSIISWXXX
MNHA1_STAES     VMILFMIGAFTKSAQVPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARITPIFAISEGWVWTITLVGL
MNHA1_STAEQ     VMILFMIGAFTKSAQVPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARITPIFAISEGWVWTITLVGL
NU5H_NYCOV      -----------KCAQFLLFVWLPDAMEAPTPASALIHSSTLVVMGFMILRFAPILHLSVYTLYIMSILGS
NU5M_ASTPE      XXXXXXXX---KSAQFGLHPWLPAAMEGPTPVFSIRHSSMVVAGIFLLIRLSPLYACSSNFNTWCLILGS
NDHF_BACSU      ------------AAQWPFQRWLVESIVAPTPVSAIMHAGLVNAGGIILTRFSPLFHXXXXXXXXXXXXXX
NU5M_DEBHA      XXXXXXXXXXXKSAQLGLHGWLLSAMEGPTPVSALTHAAMVCSGVFVLVRSSFMLEYTPSMLLVMLWLAG
NU5M_DROYA      LVMLAAMT---KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRF-NIVXXXXXXXXXXXXXXX
NU5M_PARTE      -----------KSAQFGFHVWLPDSMEAPVPASALIHATLVSAGVFLIMRFYPILELSLYFKXXXXXXXX
NU5C2_PAUCH     -----------KCAQFPMHLWLDEAMEGPNPASILRNSVVVTCGAIVLMKLMPILHHSQITIAVLLAIGT
HYFD_ECOLI      -----------KSAQLPMQAWLPDAMEAPTPISAYLHASMVKVGVYIFARIIDGGNIPHVIGGVGMVMAL
MNHA1_STAAW     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAU     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAT     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAS     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAR     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWIWTVTLVGL
MNHA1_STAAN     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAM     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAE     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAC     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAAB     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWIWTVTLVGL
MNHA1_STAA9     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAA8     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAA3     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAA2     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
MNHA1_STAA1     -----------KSAQFPFYIWLPDAMEAPTPVSAYLHATMVKAGLYLIARMTPIFAASQGWVWTVTLVGL
NU5M_ALBCO      SSILFTIASFTKSAQYPFSAWLPAAMAAPTPVSALVHSSLVTAGIYLMIRCFMVDGAPAEMYSLMGLVGS
MNHA2_STAAR     MIIMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
MNHA2_STAAW     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAAU     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAAT     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAAS     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAAN     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
MNHA2_STAAM     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
MNHA2_STAAE     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAAC     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAA9     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
MNHA2_STAA8     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAA3     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYVYIVTFVGL
MNHA2_STAA2     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
MNHA2_STAA1     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
NU5M_DROME      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRF-NIIXXXXXXXXXXXXXXX
MNHA2_STAAB     MIFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGL
NU5M_LUMTE      -----------KSAQMPFSSWLPAAMAAPTPVSALVHSSLVTAGVFLLIRFYNFLSSVWWFTTFLLFVAV
NU5M_RHISA      XXXXXXXXXXTKSAQIPFSAWLPAAMAAPTPVSALVHSSLVTAGVYLLIRF-DLLFNNNIFSAFLMKISL
NU5M_CAEEL      -----------KSAQFPFSSWLPKAMSAXXXXXXXXXXXXXXXAGLILLMNFNNLVMQKDFISFVLIIGL
NU4C2_TRIEI     -----------KLAVFPLHTWLPDAHEASAPVSMILAGVLLKMGGYGLIRLEMLSDAHVYFAPVLAILGV
NU4C3_ANASP     -----------KLAIFPLHTWLPDAHEASAPVSMILAGVLLKMGGYGLIRLELLPDAHIYFAPVLATLGV
NU4C2_ANAVT     -----------KLAIFPLHTWLPDAHEASAPVSMILAGVLLKMGGYGLIRLELLPDAHIYFAPVLATLGV
NU4C1_SYNJA     ---------------FPLHTWLPDASEASAPISMILAGVLLKMGGYGLIRLGILSEAHVYFAPVLAVLGA
NU5M_ANOGA      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRFND-VLMNWWMAQFLLLVSG
NU5M_ANOAR      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRFND-VLMNWWMAQFLLLVSG
NU5M_TRYBB      -----------KSTQFGLHIWLPDAMEGPIPVSALIHAATLVVCGIILLSFV-YWCFDFWFSYFYNLIGW
NU5M_ANOQU      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGLYLLIRF-NILLTDWWMGQFMLLISG
NU5M_AEDAE      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRF-NILLDNSKLGQFLLLVSG
NU4C3_ANAVT     ---------------FPLHTWLPDAHEASAPGSMILAGVLLKMGGYALIRFEMLPDAHVYFAPVLAILGV
NU4C2_SYNY3     -----------KLAIFPFHTWLPDAHEASAPVSMILAGVLLKMGGYGLIRLGLLEDAHVYFAPILVILGV
NU4C1_ANASP     ---------------FPLHTWLPDAHEASAPGSMILAGVLLKMGGYALIRFEMLPDAHVYFAPVLAILGV
NU5M_LOCMI      XXXXXXXXXXXXSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRF-NPMLMVYDFGWYILFIGC
NU4C_SYNPW      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALMRFNAEMLPDAHAQFAPLLVGV
NU4C1_SYNP6     -----------KLSIFPLHTWLPDAHEANAPGSMLLAGILLKMGGYALIRFNVQLLPEAHIRFAPVLLGI
NU4C1_SYNE7     -----------KLSIFPLHTWLPDAHEANAPGSMLLAGILLKMGGYALIRFNVQLLPEAHIRFAPVLLGI
NU4C_SYNS9      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNCELLPAAHAQFAPLLIGV
NU4C2_MICAN     -----------KLAIFPLHTWLPDAHEASAPVSMILAGVLLKMGGYGLIRLGLLPDAHIYFAPILAILGV
NU4C1_SYNJB     ---------------FPLHTWLPDASEASAPISMILAGVLLKMGGYGLIRMGMLSEAHVYFAPVLAVLGV
NU5M_PEA        MRLNAITLICIKSAQIGSHTWSPDAMEGPTPVSALIHAAMVTAGVFMIAR--------------------
NU4C_SYNPX      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNCELLPAAHAQFAPLLIGV
NU4C3_SYNP2     -----------KLAIFPLHTWLPDAHEASSPVSMLLAGVLLKMGGYGLMRFNMELLPDAHVRFAPLLVGV
NU4C_PROMM      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALMRFNAQLLPEAHAQFAPLLIGV
NU4C_PROM3      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALMRFNAQLLPEAHAQFAPLLIGV
NU4C_SYNSC      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNCELLPAAHSQFAPLLIGV
NU4C2_SYNP2     ---------------FPLHTWLPDAHGEATAPAHMLLAGILKMGGYALLRMGMLPDAHALFGPVLVILGV
NU4C_PROMP      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPIAHAQFSPLLIGV
NU4C_PROMA      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPAAHAQFAPLLIGV
NU4C_PROM5      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPVAHAQFAPLLIGV
NU5M_APILI      -----------KSAQIPFSTWLPAMMAXXXXXXXXXXXXXXXAGIYLLIRYVNLLDFNYKNYIML--IAS
NU4C1_SYNP2     ---------------FPLHTWLPDASEASAPVSMILAGVLLKMGGYGLIRLNMEMLPDAHIRFAPLLIGI
NU4C_SYNS3      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALMRFNAEILPVAHAQFAPLLVGV
NU4C_SYNR3      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALFRFSMFPDAHVQFAPLLVVLGV
NU4C_PROMS      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPVAHAQFAPLLIGV
NU4C_PROM9      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPAAHAQFAPLLIGV
NU4C_PROM4      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPAAHAQFAPLLIGV
NU4C_PROM2      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPVAHAQFAPLLIGV
NU4C_PROM0      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPVAHAQFAPLLIGV
NU5M_ANOQN      -----------KSAQIPFSSWLPAAMAAPTPVSALVHSSLVTAGVYLLIRFND-----------------
NU4C_PROMT      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPDAHAQFAPLLIGV
NU4C_PROM1      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALLRFNAQLLPDAHAQFAPLLIGV
NU4C_CRYJA      ---------------FPLHTWLPDTHGEAHYSTCMLLAGVLKMGGYGLIRINMELLPHAHSLFSPWLIGA
NU4C_ACAM1      ----------------PLHTWLPDAHEATAPVHMLLAGILLKMGGYALIRMNVELLPDAHAYFAPALIGV
NU4C2_SYNJA     ---------------FPLHTWLPDAHEATAPVHMLLAGILLKMGGYALMRMGMLPDAHLYFAPVLIVLGV
NU4C1_TRIEI     ---------------FPLHTWLPDAHGEATAPA