[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38048.1

[Show Plain Result]


## Summary of Sequence Search
    1::456
   90::522     e-146  58%  522 aa  GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic;
   90::522     e-146  59%  522 aa  GSH1_ARATH RecName: Full=Glutamate--cysteine ligase, chloroplastic;
   91::523     e-145  58%  523 aa  GSH1_SOLLC RecName: Full=Glutamate--cysteine ligase, chloroplastic;
   55::496     e-144  56%  496 aa  GSH1B_ORYSI RecName: Full=Glutamate--cysteine ligase B,
   55::496     e-143  56%  496 aa  GSH1B_ORYSJ RecName: Full=Glutamate--cysteine ligase B,
   51::492     e-143  56%  492 aa  GSH1A_ORYSJ RecName: Full=Glutamate--cysteine ligase A,
   51::492     e-143  56%  492 aa  GSH1A_ORYSI RecName: Full=Glutamate--cysteine ligase A,
   82::514     e-142  58%  514 aa  GSH1_BRAJU RecName: Full=Glutamate--cysteine ligase, chloroplastic;
   67::508     e-142  57%  508 aa  GSH1_MEDTR RecName: Full=Glutamate--cysteine ligase, chloroplastic;
   66::214     2e-07  30%  383 aa  CAAL1_ARTS2 RecName: Full=Carboxylate-amine ligase Arth_2891;      
   64::214     6e-07  26%  386 aa  CAAL_AZOC5 RecName: Full=Carboxylate-amine ligase AZC_2303;        
   60::213     7e-07  26%  372 aa  CAAL_GLOVI RecName: Full=Carboxylate-amine ligase gll2294;       
   59::209     7e-07  29%  378 aa  CAAL1_COREF RecName: Full=Carboxylate-amine ligase CE2574;       
   65::210     1e-05  30%  383 aa  CAAL_CLAM3 RecName: Full=Carboxylate-amine ligase CMM_1366;        
   68::182     2e-05  34%  377 aa  CAAL_RALSO RecName: Full=Carboxylate-amine ligase RSc3298;       
   69::212     2e-05  27%  385 aa  CAAL_HERA2 RecName: Full=Carboxylate-amine ligase Haur_4831;       
   69::210     3e-05  34%  375 aa  CAAL_SORC5 RecName: Full=Carboxylate-amine ligase sce3587;       
   80::213     3e-05  28%  378 aa  CAAL_JANSC RecName: Full=Carboxylate-amine ligase Jann_1911;       
   66::214     3e-05  28%  383 aa  CAAL2_ARTAT RecName: Full=Carboxylate-amine ligase AAur_2882;      
   60::208     4e-05  25%  379 aa  CAAL_ROSCS RecName: Full=Carboxylate-amine ligase Rcas_1802;       
   59::209     4e-05  26%  376 aa  CAAL_CORGL RecName: Full=Carboxylate-amine ligase Cgl2736/cg3031;  
   59::209     4e-05  26%  376 aa  CAAL_CORGB RecName: Full=Carboxylate-amine ligase cgR_2639;        
   65::210     4e-05  30%  383 aa  CAAL_CLAMS RecName: Full=Carboxylate-amine ligase CMS0754;       
   18::181     4e-05  30%  369 aa  CAAL2_COREF RecName: Full=Carboxylate-amine ligase CE2886;       
   64::210     5e-05  27%  378 aa  CAAL_LEIXX RecName: Full=Carboxylate-amine ligase Lxx14910;        
   60::208     5e-05  25%  390 aa  CAAL_CHLSY RecName: Full=Carboxylate-amine ligase Chy400_3862;     
   60::208     5e-05  25%  390 aa  CAAL_CHLAA RecName: Full=Carboxylate-amine ligase Caur_3581;       
   69::211     9e-05  25%  382 aa  CAAL_FRASC RecName: Full=Carboxylate-amine ligase Francci3_0693;   
   93::175     9e-05  30%  362 aa  CAAL1_STRAW RecName: Full=Carboxylate-amine ligase SAV_751;        
   60::209     1e-04  25%  379 aa  CAAL_ROSS1 RecName: Full=Carboxylate-amine ligase RoseRS_2615;     
   60::213     1e-04  24%  390 aa  CAAL_CHLAD RecName: Full=Carboxylate-amine ligase Cagg_0203;       
  131::185     2e-04  38%  384 aa  CAAL1_ARTAT RecName: Full=Carboxylate-amine ligase AAur_0300;      
   96::184     2e-04  30%  372 aa  CAAL_RHOBA RecName: Full=Carboxylate-amine ligase RB4485;       
  127::238     2e-04  30%  383 aa  CAAL2_FRAAA RecName: Full=Carboxylate-amine ligase FRAAL3294;      
  108::184     2e-04  26%  382 aa  CAAL1_NOCSJ RecName: Full=Carboxylate-amine ligase Noca_2970;      
  160::208     3e-04  45%  359 aa  CAAL_HALLT RecName: Full=Carboxylate-amine ligase Hlac_0952;       
   65::178     3e-04  28%  793 aa  CAAL4_RHOSR RecName: Full=Carboxylate-amine ligase RHA1_ro04240;   
   68::182     3e-04  31%  377 aa  CAAL_RALPJ RecName: Full=Carboxylate-amine ligase Rpic_3493;       
   68::230     3e-04  25%  408 aa  CAAL_BRASO RecName: Full=Carboxylate-amine ligase BRADO0861;       
   74::200     6e-04  27%  424 aa  CAAL3_ARTAT RecName: Full=Carboxylate-amine ligase AAur_3665;      
   77::206     0.001  33%  362 aa  CAAL_NATPD RecName: Full=Carboxylate-amine ligase NP3372A;       
   63::206     0.001  24%  392 aa  CAAL_CORJK RecName: Full=Carboxylate-amine ligase jk0264;       
    1::456

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxDQIDMTPLNSRDELVGWIEAGVKPPSEFRIGTEHEKTPFTLEGHHPVPYAGARGIGALLEGMQLLLG
GSH1_TOBAC      ------------TKEDLVAYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKY---EQIAELLNGIAERFD
GSH1_ARATH      ------------TREDLIAYLASGCKTKDKYRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNGIAERFE
GSH1_SOLLC      ------------TKEDLVGYLASGCKSKEKWRIGTEHEKFGFEFGTLRPMKYDQ---IADLLNGIAERFD
GSH1B_ORYSI     ---EAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI---LNGLAERFD
GSH1B_ORYSJ     ---EAVQMTEPLTKEDLMAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI---LNGLAERFD
GSH1A_ORYSJ     ---EAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI---LNGLAERFD
GSH1A_ORYSI     ---EAVQMTEPLTKEDLVAYLVSGCKPKENWRIGTEHEKFGFEVDTLRPIKYDQIRDI---LNGLAERFD
GSH1_BRAJU      ------------TREDLIAYLASGCKSKEKWRIGTEHEKFGFEVNTLRPMKYDQ---IAELLNSIAERFE
GSH1_MEDTR      ---DAVVATEPLTKQDLIDYLASGCKTKDKWRIGTEHEKFGFELGSLRPMKY---EQISELLNGIAERFD
CAAL1_ARTS2     ----------------------------------------------------------------------
CAAL_AZOC5      ----------------------------------------------------------------------
CAAL_GLOVI      ----------------------------------------------------------------------
CAAL1_COREF     ----------------------------------------------------------------------
CAAL_CLAM3      ----------------------------------------------------------------------
CAAL_RALSO      ----------------------------------------------------------------------
CAAL_HERA2      ----------------------------------------------------------------------
CAAL_SORC5      ----------------------------------------------------------------------
CAAL_JANSC      ----------------------------------------------------------------------
CAAL2_ARTAT     ----------------------------------------------------------------------
CAAL_ROSCS      ----------------------------------------------------------------------
CAAL_CORGL      ----------------------------------------------------------------------
CAAL_CORGB      ----------------------------------------------------------------------
CAAL_CLAMS      ----------------------------------------------------------------------
CAAL2_COREF     ----------------------------------------------------------------------
CAAL_LEIXX      ----------------------------------------------------------------------
CAAL_CHLSY      ----------------------------------------------------------------------
CAAL_CHLAA      ----------------------------------------------------------------------
CAAL_FRASC      ----------------------------------------------------------------------
CAAL1_STRAW     ----------------------------------------------------------------------
CAAL_ROSS1      ----------------------------------------------------------------------
CAAL_CHLAD      ----------------------------------------------------------------------
CAAL1_ARTAT     ----------------------------------------------------------------------
CAAL_RHOBA      ----------------------------------------------------------------------
CAAL2_FRAAA     ----------------------------------------------------------------------
CAAL1_NOCSJ     ----------------------------------------------------------------------
CAAL_HALLT      ----------------------------------------------------------------------
CAAL4_RHOSR     ----------------------------------------------------------------------
CAAL_RALPJ      ----------------------------------------------------------------------
CAAL_BRASO      ----------------------------------------------------------------------
CAAL3_ARTAT     ----------------------------------------------------------------------
CAAL_NATPD      ----------------------------------------------------------------------
CAAL_CORJK      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WEPIMEGPHIIGLHDVTGGGAISLEPGGQFELSGAPLDNVHQTHAELMAHLAQVREVATPLGIGFLGLGM
GSH1_TOBAC      WEKVMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGTGF
GSH1_ARATH      WEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGF
GSH1_SOLLC      WEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGTGF
GSH1B_ORYSI     WDKIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIGFLGIGF
GSH1B_ORYSJ     WDKIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIGFLGIGF
GSH1A_ORYSJ     WDKIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIGFLGIGF
GSH1A_ORYSI     WDKIVEENNVIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVGEEMGIGFLGIGF
GSH1_BRAJU      WEKVMEGDKIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGMGF
GSH1_MEDTR      WDKVMEGDNIIGLKQ--GKQSISLEPGGQFELSGAPLETLHQTCAEVNSHLYQVKAVAEEMGIGFLGIGF
CAAL1_ARTS2     ------------------------------ELVTGICETVAQAKADLSSSLAAVREVTDPMGVEVFCAGS
CAAL_AZOC5      ----------------------------QLEMATAPTDRIGDALDELLRHIAG--RVAAEHGLGFIAAGT
CAAL_GLOVI      ------------------------------EINTGICKDVAQVERDLTTQLTLLRSVCRERGVSFLSAGT
CAAL1_COREF     ------------------------------ELVTGICDTVPEAVAELDRALAAVQEAATELGLRPWTSGS
CAAL_CLAM3      ------------------------------EVVSAPHSRVGHAVDDLARLIERVVDVADPLGIDLMCAGT
CAAL_RALSO      ------------------------------------------SHDEALWQMREIREAAVPLNIGICGGGT
CAAL_HERA2      ---------------------------------------VEEARAEIIRLRGAIGSLAASKGLRIAAAGT
CAAL_SORC5      --------------------------------------DIRQARGELVELRGSLNALARRGGMRIVAAGT
CAAL_JANSC      -----------------------------------------------------VAECAGRFGLAPIAVSC
CAAL2_ARTAT     ------------------------------ELVTGICETVKDAKEDLSRSLAAVREVTDPMGVEVFCAGS
CAAL_ROSCS      ------------------------------EVGTQPCRTIQEARAEVVRLRGTIAGLARQHGLTIISAGT
CAAL_CORGL      ------------------------------ELVTGVCDTVPEAVAELSHDLDALKEAADSLGLRLWTSGS
CAAL_CORGB      ------------------------------ELVTGVCDTVPEAVAELSHDLDALKEAADSLGLRLWTSGS
CAAL_CLAMS      ------------------------------EVVSAPHSRVGHAVDDLARLIERVVDVADPLGIDLMCAGT
CAAL2_COREF     FSPLPAGDRAVQLH-TEAHEATGTDPGGQFEVAYPPQTTLADQLETIRAGRALADTAASRVGGRVVALPT
CAAL_LEIXX      ------------------------------------VSQVHRTVADLQELIGMVREVTDPRGVELMCAET
CAAL_CHLSY      ------------------------------EVGTRPCRTISEARAEIVRLRSAIAGLAARHNLRIVAAGT
CAAL_CHLAA      ------------------------------EVGTRPCRTISEARAEIVRLRSAIAGLAARHNLRIVAAGT
CAAL_FRASC      -------------------------------------DSVEEATADLSGTVSLLRDLAERRGIGLMCSGT
CAAL1_STRAW     ----------------------------------------------------------------------
CAAL_ROSS1      ------------------------------EVGTHPCRTIQEARAEVVRLRSIIAGLARQHGLTIISAGT
CAAL_CHLAD      ------------------------------EVGTRPCRTISEARAEIVXXXXXXXXXXXXHNLRIVAAGT
CAAL1_ARTAT     ----------------------------------------------------------------------
CAAL_RHOBA      --------------------------------------------------------------------GT
CAAL2_FRAAA     ----------------------------------------------------------------------
CAAL1_NOCSJ     ----------------------------------------------------------------------
CAAL_HALLT      ----------------------------------------------------------------------
CAAL4_RHOSR     --------------------------------------------SDLERHRRLLVDAAEDLGIGVAAAGS
CAAL_RALPJ      ------------------------------------------SHDEALWQLREMREAATALNIGICGGGT
CAAL_BRASO      ----------------TGGQAMREMLQAQLEVATNVHVDVGDAREELKFLRREVASVAGQYGLTILACST
CAAL3_ARTAT     ----------------------------QIETQTRPCHSYGELLQQIRRGRAMANQAARQHGARVAAIAT
CAAL_NATPD      --------------------------------------------------LAEVRKAAETHGFGIAAAGL
CAAL_CORJK      -------------------------------------DTIPEAVEDLHVQAKQLMECADDIGVNLFSAGT


                         +         .         .         .         .         *         .:210
query           TPSWSREDIPVMPKGRYKIMTNYMPKVGSYGLDMMYRTCTVQTNLDFSSEADMVKKLRVSVALQPVATAL
GSH1_TOBAC      QPKWGLKDIPVMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATAL
GSH1_ARATH      QPKWRREDIPIMPKGRYDIMRNYMPKVGTLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATAL
GSH1_SOLLC      QPKWGLKDIPIMPKGRYEIIRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATAL
GSH1B_ORYSI     QPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMIRKFRAGLALQPIATAI
GSH1B_ORYSJ     QPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMIRKFRTGLALQPIATAI
GSH1A_ORYSJ     QPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMIRKFRTGLALQPIATAI
GSH1A_ORYSI     QPKWALSDIPIMPKGRYEIMRNYMPKVGSLGLDMMFRTCTVQVNLDFSSEQDMIRKFHTGLALQPIATAI
GSH1_BRAJU      QPKWRREDIPTMPKGRYDIMRNYMPKVGSLGLDMMLRTCTVQVNLDFSSEADMIRKFRAGLALQPIATAL
GSH1_MEDTR      QPKWERKDIPMMPKGRYEIMKKYMPKVGSLGLDMMFRTCTVQVNLDFSSEADMIRKFRAGLALQPIATAL
CAAL1_ARTS2     HPFSPPQLQPVTDKARY---AKLIDRTQWWGRQMVIYGVHVHVGLD--SRDKVLPVLDGLVNYFPHFQAL
CAAL_AZOC5      HPTASWDNVRATKANRYDGLMQDLQMLGERNM-----VCGLHVHVELPDPDLRVDVMRRITPYLPHFIAL
CAAL_GLOVI      HPRWRERRYTQTPRYRALVDKHVWTRMQIYGLHV---------HVGMPDGDTAIQVINQITQYAPMLLAL
CAAL1_COREF     HPFSDFRENPVSKKGSY---DEIIARTQYWGNQML--IWGIHVHVGISHEDRVWPIINALVTNYPHLLAL
CAAL_CLAM3      HPFSAWPDQDVTPDNRYATL---LDRTRWWGRQMMIWGVHVHVGIDDASKA--LPILNALLVHLPRFQAL
CAAL_RALSO      HPQWSQRTISASP--RYQ----YISELYGY-LAKQFTVFGQHVHLGCPSPDDALYLLHAMSRYVPHFIAL
CAAL_HERA2      HPSWQKQDI--YPHERYYGVIEEMQEAARRLLIF-----GMHVHIGMPDNETCIEIMNVARYFLPHLLAL
CAAL_SORC5      HPDWKKQDIT--DGERYRCIVEDLQDVA-------------RANLIFGLHVHVVKDREVAMALAPHILAL
CAAL_JANSC      HPFADWKDQSHTDKDRYNQLARDLGGVVERML-----ICGAHCHVGLPSENDRVDIMRQMTYFLPHLLAL
CAAL2_ARTAT     HPFSPPLLQPVTDKERY---AKLIERTQWWGRQMVIYGVHVHVGIDHRDK--VLPILDGLVNYFPHFQAL
CAAL_ROSCS      HPSWMSQEIT--PFERYKGVVEEMQQ-----LALQLLIFGMHVHVGMPDDEVAIELMNVARYFLPHILAL
CAAL_CORGL      HPFSDFRENPVSEKGSY---DEIIARTQYWGNQML--IWGIHVHVGISHEDRVWPIINALLTNYPHLLAL
CAAL_CORGB      HPFSDFRENPVSEKGSY---DEIIARTQYWGNQML--IWGIHVHVGISHEDRVWPIINALLTNYPHLLAL
CAAL_CLAMS      HPFSAWPDQDVTPDNRYATL---LDRTRWWGRQMMIWGVHVHVGIEDGSKA--LPILNALLVHLPRFQAL
CAAL2_COREF     SPGPISPHL--VPNPRYQRISE------RFGFTVKEQTCGFHIHVQVESPAEAVAVLRVRVWL-PVVLAL
CAAL_LEIXX      HPFAQWYDQRITPSERY---DRLLDRTQWWGRQMMIWGVHVHIGIDERDKA--LPIVNGLLTYYPHLQAL
CAAL_CHLSY      HPSWMQQEIT--PDERYHMVVGEMQDAA-----LQLLIFGMHCHIGMPNNEVAIELMNVARYICPHLLAL
CAAL_CHLAA      HPSWMQQEIT--PDERYHMVVGEMQDAA-----LQLLIFGMHCHIGMPNNEVAIELMNVARYICPHLLAL
CAAL_FRASC      HPASDYMGQRITEDHRYFRLVSQM-----QWLARRLLIFGVHVHVGVRSADKAMPIVNALMAYVPHFLAL
CAAL1_STRAW     --------LPVSPS--IAMNRRYQWMAEQYGIAMQEQTCGCHVHVAVESDEEGVAVVDRIRPWLPVLVAL
CAAL_ROSS1      HPSWMSQEIT--PFERYKGVVEEMQQ-----LALQLLIFGMHVHVGMPDDEVAIELMNVARYFLPHILAL
CAAL_CHLAD      HPSWMQQEIT--PDERYRMVVGEMQEAA-----LQLLIFGMHCHIGMPNNEVAIELMNVARYICPHLLAL
CAAL1_ARTAT     -------------------------------------TCGFHVHVSIESPEEGVAVLDRMRHWLPVLLAL
CAAL_RHOBA      NPLPIPTDDALTPKDRYQAMTDRYQQIAR---DLFIFGCHVHVAMDRELGIQVMNRCRRWL---PILQAI
CAAL2_FRAAA     ---------------------------GEFGLTAREQTCGCHVHVAVHSRQEAVGALDRLRPWLSVLVAM
CAAL1_NOCSJ     ----------VSPNDRYRDMVDTYGEIARTG-----GTCGMHVHVDIGSDEEGVAVVDRIXXXXXXXXXX
CAAL_HALLT      ----------------------------------------------------------------PVLLAL
CAAL4_RHOSR     VPLALPAEMHVTGTQRYRMLADYQV------LAREQLICGTQVHVDLPDRDEAVQVAHRVAPHMPVLLAL
CAAL_RALPJ      HPQWSQRQISQSPRYQYSDLYGYLAK--------QFTVFGQHVHIGCPNPDDALYLLHAMSRYVPHFIAL
CAAL_BRASO      HPTALWRNSQPTPKPRYAEMMEDLRIVGQRNM-----LCGMHVHVQLPDPDRRFAVMRAMIPYIPVFIAL
CAAL3_ARTAT     SPLASNTH--TTPDPRYAAM---LDRFGIIATEQLTCGFHVHTSVESPEEGVVVDHIRDKLA---VLTAL
CAAL_NATPD      HPAAKWRELDHAEKPRYRAQLDRIQYP-------QHRNTTAGLHIHVGVD-DADKAVWVANELRPVMLAL
CAAL_CORJK      HPFAHWGDQKLSEKGSYQ---EIIERTQYWGRQML--IWGIHVHVGVGSKEKVWPIINALMTHYPHILAM


                         .         .         .         +         .         .         .:280
query           FANSPFTEGKPNGFLSFRSEIWRDTDNARSGMIPWAFEDGMGFERWVDYALDVPMYFVKRGDHYIDVSGS
GSH1_TOBAC      FANSPFTEGKPNGYLSMRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYIDCAGM
GSH1_ARATH      FANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRKNKYIDCTGM
GSH1_SOLLC      FANSPFTEGKPNGYLSKRSHIWTDTDNNRAGMLPFVFDDSFGFEQYVDYALDVPMYFVYRKKKYVDCTGL
GSH1B_ORYSI     FANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGM
GSH1B_ORYSJ     FANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGM
GSH1A_ORYSJ     FANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDIPMYFVYRNKKYIDCTGM
GSH1A_ORYSI     FANSPFKEGKPNGYLSLRSHIWTDTDNNRSGMLPFVFDDSFGFERYVDYALDVPMYFVYRNKKYIDCTGM
GSH1_BRAJU      FANSPFTEGKPNGFLSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDYALDVPMYFAYRNGKYVDCTGM
GSH1_MEDTR      FANSPFTDGKPNGFVSMRSHIWTDTDKDRTGMLPFVFDDSFGFEQYVDFALDVPMYFVYRKKKYIDCTGM
CAAL1_ARTS2     SASSPFWGGEDTGYASQRALMFQQLPTAG---LPFQFSTWAEYESYV-----------------------
CAAL_AZOC5      STSSPFWGSRQTGLMGYRLAAYDEL--PRTG-LPELFEDNAAYEEYV-----------------------
CAAL_GLOVI      SANSPFWEGDDTGLDSCRTKVF---ENLSSAGLPFRFENWEGYENLINVLLE------------------
CAAL1_COREF     SASSPAWDGLDTGYASNRTMLYQQLPTAG---LPYQFQ---SWDEWVSYMAD------------------
CAAL_CLAM3      SASSPFWSGQETGYASNRALMFQQLPTA--GLPP-------DLTTWADY---------------------
CAAL_RALSO      AASSPFVQGVDTGFASAR----------------------------------------------------
CAAL_HERA2      STSSPFWMGRKTGFQSYRSIIF--TNFPRTG-IPDTFQSYAEFEQYINILL-------------------
CAAL_SORC5      STSSPFWLGRPSGLKSTRSEIFKRF--PRTG-IPGLFESHGHFQRFVD----------------------
CAAL_JANSC      STSSPFWQGRDTGLASYRLTVF---DNLPRTGLPPSFASFDEFQRTVDLLVDMEM---------------
CAAL2_ARTAT     SASSPYWAGEETGYASQRALMFQQLPTAG---LPFQFETWEAYESYV-----------------------
CAAL_ROSCS      STSSPFWMGRNTGFKSYRSALF--SNFPRTG-IPPSFHSAAEFQNYV-----------------------
CAAL_CORGL      SASSPAWDGLDTGYASNRTMLYQQLPTAG---LPYQFQ---SWDEWCSYMAD------------------
CAAL_CORGB      SASSPAWDGLDTGYASNRTMLYQQLPTAG---LPYQFQ---SWDEWCSYMAD------------------
CAAL_CLAMS      SASSPFWSGQETGYASNRALMFQQLPTA--GLPP-------DLTTWADY---------------------
CAAL2_COREF     SANSPFWQGFDTDFASYRYQAW------------------------------------------------
CAAL_LEIXX      SASSPFWAGANTGYASNRALMFQQLPTAG---LPWQFGAWANYEEYV-----------------------
CAAL_CHLSY      STSSPFWMGRNTGFKSYRSVIF--STFPRTG-IPPTFHSASEFERYV-----------------------
CAAL_CHLAA      STSSPFWMGRNTGFKSYRSVIF--STFPRTG-IPPTFHSASEFERYV-----------------------
CAAL_FRASC      SASSPYWLGGDTGLASSRSQVFASLPTAG---LPYPLEDWPGFESFME----------------------
CAAL1_STRAW     SANSPFWQGRDSSYESYRSRVW------------------------------------------------
CAAL_ROSS1      STSSPFWMGRNTGFKSYRSALF--ANFPRTG-IPPSFHSAAEFHNYVN----------------------
CAAL_CHLAD      STSSPFWMGRNTGFKSYRSVIF--STFPRTG-IPPTFHSASEFERYVQLLIN------------------
CAAL1_ARTAT     SANSPFWMGADTGFASYRTQIW------------------------------------------------
CAAL_RHOBA      TANSPYWDGVDTGYASYRRELW------------------------------------------------
CAAL2_FRAAA     TANSPFWQGADSGYASYRTQVWQRWPTAGA---TGAFGSPAEYDRVVDLLIDGMIYFDVRLSHH------
CAAL1_NOCSJ     XXNSPYVEGRDSGYASWRAQVW------------------------------------------------
CAAL_HALLT      SANSPFWNGFDTGLASARAKIFENLPNTG---IPSAFDDFDAFQRY------------------------
CAAL4_RHOSR     SASSPFSDGADTGYASARTLLW------------------------------------------------
CAAL_RALPJ      AASSPFVQGVDTGFASAR----------------------------------------------------
CAAL_BRASO      SASSPFWNSRETGLKGYRLAAYDEL--PRTG-LPELFTSKKQYDRYV-----------------------
CAAL3_ARTAT     TANSPYWRGLPTGFDSYRTQAW------------------------------------------------
CAAL_NATPD      SANSPYWNGFDTGLQSARAKIFEALPN--TGM-PTAFEDFESFQ--------------------------
CAAL_CORJK      SASSPAWEGLDTGYSSNRTLLYQQLPTA--GM-PYQFEN---WEQWEEFNRD------------------


                         .         *         .         .         .         .         +:350
query           SFRDFFDGKNEKLPGERPTLSDWANHLSTIFPEVRLKRYLEMRGADGVPWGRLPALPAFWVGLLYDDTSL
GSH1_TOBAC      SFRDFMNGKLSPIPGDYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSL
GSH1_ARATH      TFRQFLAGKLPCLPGELPSYNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDDDSL
GSH1_SOLLC      SFRDFMNGKLPPIPGEYPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEGSL
GSH1B_ORYSI     SFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESL
GSH1B_ORYSJ     SFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESL
GSH1A_ORYSJ     SFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPVFWVGLLYDEESL
GSH1A_ORYSI     SFRDFMVGKLPQAPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGLLYDEESL
GSH1_BRAJU      TFRQFLAGKLPCLPGELPTYNDWENHLTTIFPEVRLKRYMEMRGADGGPWRRLCALPAFWVGLLYDEDVL
GSH1_MEDTR      TFRDFLAGKLPCIPGELPTLNDWENHLTTIFPEVRLKRYLEMRGADGGPWRRLCALPAFWVGILYDEVSL
CAAL1_ARTS2     ----------------------------------------------------------------------
CAAL_AZOC5      ----------------------------------------------------------------------
CAAL_GLOVI      ----------------------------------------------------------------------
CAAL1_COREF     ----------------------------------------------------------------------
CAAL_CLAM3      ----------------------------------------------------------------------
CAAL_RALSO      ----------------------------------------------------------------------
CAAL_HERA2      ----------------------------------------------------------------------
CAAL_SORC5      ----------------------------------------------------------------------
CAAL_JANSC      ----------------------------------------------------------------------
CAAL2_ARTAT     ----------------------------------------------------------------------
CAAL_ROSCS      ----------------------------------------------------------------------
CAAL_CORGL      ----------------------------------------------------------------------
CAAL_CORGB      ----------------------------------------------------------------------
CAAL_CLAMS      ----------------------------------------------------------------------
CAAL2_COREF     ----------------------------------------------------------------------
CAAL_LEIXX      ----------------------------------------------------------------------
CAAL_CHLSY      ----------------------------------------------------------------------
CAAL_CHLAA      ----------------------------------------------------------------------
CAAL_FRASC      ----------------------------------------------------------------------
CAAL1_STRAW     ----------------------------------------------------------------------
CAAL_ROSS1      ----------------------------------------------------------------------
CAAL_CHLAD      ----------------------------------------------------------------------
CAAL1_ARTAT     ----------------------------------------------------------------------
CAAL_RHOBA      ----------------------------------------------------------------------
CAAL2_FRAAA     ----------------------------------------------------------------------
CAAL1_NOCSJ     ----------------------------------------------------------------------
CAAL_HALLT      ----------------------------------------------------------------------
CAAL4_RHOSR     ----------------------------------------------------------------------
CAAL_RALPJ      ----------------------------------------------------------------------
CAAL_BRASO      ----------------------------------------------------------------------
CAAL3_ARTAT     ----------------------------------------------------------------------
CAAL_NATPD      ----------------------------------------------------------------------
CAAL_CORJK      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DAAWEIVKGWDASERQALRDDVPRLGFKARIGNRFLFEIARECLVLAHAGLRRRGRIDGFGHDETRHLAA
GSH1_TOBAC      QTVLDMTSDWTAEEREMLRNKVPTSGLKTPFRDGLLKHVAQDVVKLAKEGLERR------GYKETGFLNE
GSH1_ARATH      QAILDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR------GYKEAGFLNA
GSH1_SOLLC      QSVLDMTFDWTAEERDMLRNKVPKSGLKTPFRDGLLMHVAQDVVKLAKEGLERR------GFKETGFLNE
GSH1B_ORYSI     QSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR------GYKEVSFLRE
GSH1B_ORYSJ     QSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR------GYKEVGFLRE
GSH1A_ORYSJ     QSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR------GYKEVGFLRE
GSH1A_ORYSI     QSISDMTSDWTNEEREMLRRKVPVTGLKTPFRDGYVRDLAEEILQLSKNGLERR------GYKEVGFLRE
GSH1_BRAJU      QSVLDLTADWTPAEREMLRNKVPVTGLKTPFRDGLLKHVAEDVLKLAKDGLERR------GYKEVGFLNA
GSH1_MEDTR      QRVLDMTADWTLEEREMLRNKVTVTGLKTPFRDGLLKHVAEEVLELAKDGLERR------GFKESGFLNA
CAAL1_ARTS2     ----------------------------------------------------------------------
CAAL_AZOC5      ----------------------------------------------------------------------
CAAL_GLOVI      ----------------------------------------------------------------------
CAAL1_COREF     ----------------------------------------------------------------------
CAAL_CLAM3      ----------------------------------------------------------------------
CAAL_RALSO      ----------------------------------------------------------------------
CAAL_HERA2      ----------------------------------------------------------------------
CAAL_SORC5      ----------------------------------------------------------------------
CAAL_JANSC      ----------------------------------------------------------------------
CAAL2_ARTAT     ----------------------------------------------------------------------
CAAL_ROSCS      ----------------------------------------------------------------------
CAAL_CORGL      ----------------------------------------------------------------------
CAAL_CORGB      ----------------------------------------------------------------------
CAAL_CLAMS      ----------------------------------------------------------------------
CAAL2_COREF     ----------------------------------------------------------------------
CAAL_LEIXX      ----------------------------------------------------------------------
CAAL_CHLSY      ----------------------------------------------------------------------
CAAL_CHLAA      ----------------------------------------------------------------------
CAAL_FRASC      ----------------------------------------------------------------------
CAAL1_STRAW     ----------------------------------------------------------------------
CAAL_ROSS1      ----------------------------------------------------------------------
CAAL_CHLAD      ----------------------------------------------------------------------
CAAL1_ARTAT     ----------------------------------------------------------------------
CAAL_RHOBA      ----------------------------------------------------------------------
CAAL2_FRAAA     ----------------------------------------------------------------------
CAAL1_NOCSJ     ----------------------------------------------------------------------
CAAL_HALLT      ----------------------------------------------------------------------
CAAL4_RHOSR     ----------------------------------------------------------------------
CAAL_RALPJ      ----------------------------------------------------------------------
CAAL_BRASO      ----------------------------------------------------------------------
CAAL3_ARTAT     ----------------------------------------------------------------------
CAAL_NATPD      ----------------------------------------------------------------------
CAAL_CORJK      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LDQILDAGRTPAEEMLEKFDGAWRGSVEPAYDEYAF
GSH1_TOBAC      VTEVVRTGVTPAEKLLELYHGKWGRSVDPVFEELLY
GSH1_ARATH      VDEVVRTGVTPAEKLLEMYNGEWGQSVDPVFEELLY
GSH1_SOLLC      VAEVVKTGVTPAEKLLELYHGKWGQSVDPIFEELLY
GSH1B_ORYSI     VDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY
GSH1B_ORYSJ     VDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY
GSH1A_ORYSJ     VDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY
GSH1A_ORYSI     VDAVISSGVTPAERLLNLYETKWQRSVDPVFQELLY
GSH1_BRAJU      VTEVVRTGVTPAENLLEMYNGEWGQSVDPVFQELLY
GSH1_MEDTR      VAEVVRTGVTPAERLLELYHGKWEQSVDHVFDELLY
CAAL1_ARTS2     ------------------------------------
CAAL_AZOC5      ------------------------------------
CAAL_GLOVI      ------------------------------------
CAAL1_COREF     ------------------------------------
CAAL_CLAM3      ------------------------------------
CAAL_RALSO      ------------------------------------
CAAL_HERA2      ------------------------------------
CAAL_SORC5      ------------------------------------
CAAL_JANSC      ------------------------------------
CAAL2_ARTAT     ------------------------------------
CAAL_ROSCS      ------------------------------------
CAAL_CORGL      ------------------------------------
CAAL_CORGB      ------------------------------------
CAAL_CLAMS      ------------------------------------
CAAL2_COREF     ------------------------------------
CAAL_LEIXX      ------------------------------------
CAAL_CHLSY      ------------------------------------
CAAL_CHLAA      ------------------------------------
CAAL_FRASC      ------------------------------------
CAAL1_STRAW     ------------------------------------
CAAL_ROSS1      ------------------------------------
CAAL_CHLAD      ------------------------------------
CAAL1_ARTAT     ------------------------------------
CAAL_RHOBA      ------------------------------------
CAAL2_FRAAA     ------------------------------------
CAAL1_NOCSJ     ------------------------------------
CAAL_HALLT      ------------------------------------
CAAL4_RHOSR     ------------------------------------
CAAL_RALPJ      ------------------------------------
CAAL_BRASO      ------------------------------------
CAAL3_ARTAT     ------------------------------------
CAAL_NATPD      ------------------------------------
CAAL_CORJK      ------------------------------------