[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38106.1

[Show Plain Result]


## Summary of Sequence Search
    1::494
 1103::1233    7e-27  48% 1276 aa  PHY2_SYNY3 RecName: Full=Phytochrome-like protein cph2;AltName:
  256::377     3e-21  47%  410 aa  YDAM_ECOLI RecName: Full=Uncharacterized protein ydaM;
  256::377     3e-21  47%  410 aa  YDAM_ECO57 RecName: Full=Uncharacterized protein ydaM;
  195::331     3e-20  49%  359 aa  YHCK_BACSU RecName: Full=Uncharacterized protein yhcK;
  291::454     1e-19  40%  454 aa  PLED_CAUCR RecName: Full=Response regulator pleD;AltName:
  211::371     4e-19  36%  371 aa  ADRA_ECOLI RecName: Full=Protein adrA;
  211::371     4e-19  36%  371 aa  ADRA_ECOL6 RecName: Full=Protein adrA;
  298::429     3e-18  39%  460 aa  YDDV_SHIBS RecName: Full=Diguanylate cyclase yddV;       
  298::429     3e-18  39%  460 aa  YDDV_ECOLI RecName: Full=Diguanylate cyclase yddV;       
  298::429     3e-18  39%  460 aa  YDDV_ECO57 RecName: Full=Diguanylate cyclase yddV;       
  406::509     8e-18  52%  569 aa  YEDQ_SHISS RecName: Full=Cellulose synthesis regulatory protein;
  401::504     8e-18  52%  564 aa  YEDQ_SHIDS RecName: Full=Cellulose synthesis regulatory protein;
  406::509     8e-18  52%  569 aa  YEDQ_ECOUT RecName: Full=Cellulose synthesis regulatory protein;
  401::504     8e-18  52%  564 aa  YEDQ_ECOLI RecName: Full=Cellulose synthesis regulatory protein;
  401::504     8e-18  52%  564 aa  YEDQ_ECO57 RecName: Full=Cellulose synthesis regulatory protein;
  187::318     8e-18  52%  623 aa  Y1389_MYCBO RecName: Full=Uncharacterized protein Mb1389c;
  187::318     8e-18  52%  623 aa  Y1354_MYCTU RecName: Full=Uncharacterized protein Rv1354c/MT1397;
  406::509     1e-17  51%  569 aa  YEDQ_ECOL6 RecName: Full=Cellulose synthesis regulatory protein;
  298::429     1e-17  38%  460 aa  YDDV_SHISS RecName: Full=Diguanylate cyclase yddV;       
  406::509     2e-17  51%  569 aa  YEDQ_SHIFL RecName: Full=Putative cellulose synthesis regulatory
  401::504     4e-17  42%  570 aa  YEDQ_SALTY RecName: Full=Cellulose synthesis regulatory protein;
  398::501     4e-17  42%  567 aa  YEDQ_SALTI RecName: Full=Cellulose synthesis regulatory protein;
  401::504     4e-17  42%  570 aa  YEDQ_SALPA RecName: Full=Cellulose synthesis regulatory protein;
  401::504     4e-17  42%  570 aa  YEDQ_SALCH RecName: Full=Cellulose synthesis regulatory protein;
  266::396     4e-16  38%  685 aa  Y1727_PSEAE RecName: Full=Uncharacterized signaling protein PA1727;
  285::407     5e-16  44%  452 aa  YCDT_ECOLI RecName: Full=Inner membrane protein ycdT;
  425::543     5e-14  34%  579 aa  YTRP_BACSU RecName: Full=Uncharacterized protein ytrP;
  348::500     1e-13  33%  783 aa  Y3311_PSEAE RecName: Full=Uncharacterized signaling protein PA3311;
  346::468     3e-13  31%  496 aa  YEAJ_ECOLI RecName: Full=Uncharacterized protein yeaJ;
  239::367     7e-13  37%  661 aa  GMR_ECOLI RecName: Full=Protein gmr;
  191::346     1e-12  34%  356 aa  YLLM_STAAU RecName: Full=Uncharacterized membrane protein in llm
  191::346     1e-12  34%  356 aa  Y809_STAAC RecName: Full=Uncharacterized membrane protein
  191::346     1e-12  34%  356 aa  Y800_STAAR RecName: Full=Uncharacterized membrane protein SAR0800;
  191::346     1e-12  34%  356 aa  Y760_STAA8 RecName: Full=Uncharacterized membrane protein
  191::346     1e-12  34%  356 aa  Y746_STAAM RecName: Full=Uncharacterized membrane protein SAV0746;
  191::346     1e-12  34%  356 aa  Y730_STAA3 RecName: Full=Uncharacterized membrane protein
  191::346     1e-12  34%  356 aa  Y711_STAAS RecName: Full=Uncharacterized membrane protein SAS0711;
  191::346     1e-12  34%  356 aa  Y708_STAAW RecName: Full=Uncharacterized membrane protein MW0708;
  191::346     1e-12  34%  356 aa  Y701_STAAN RecName: Full=Uncharacterized membrane protein SA0701;
  191::346     1e-12  34%  356 aa  Y698_STAAB RecName: Full=Uncharacterized membrane protein SAB0698c;
  176::305     2e-12  32%  341 aa  YEAP_ECOLI RecName: Full=Probable diguanylate cyclase yeaP;        
  132::258     2e-12  35%  296 aa  YDEH_ECOLI RecName: Full=Uncharacterized protein ydeH;
  168::271     4e-12  41%  315 aa  YNEF_ECOLI RecName: Full=Uncharacterized protein yneF;
  168::271     4e-12  41%  315 aa  YNEF_ECO57 RecName: Full=Uncharacterized protein yneF;
  375::467     4e-12  42%  809 aa  Y091_CAUCR RecName: Full=Uncharacterized signaling protein CC_0091;
  298::415     8e-12  36%  442 aa  YLIF_ECOLI RecName: Full=Uncharacterized membrane protein yliF;
  191::346     8e-12  33%  356 aa  Y528_STAES RecName: Full=Uncharacterized membrane protein SE_0528;
  191::346     8e-12  33%  356 aa  Y413_STAEQ RecName: Full=Uncharacterized membrane protein SERP0413;
  191::346     1e-11  33%  356 aa  Y2145_STAHJ RecName: Full=Uncharacterized membrane protein SH2145;
  298::409     2e-11  37%  442 aa  YLIF_ECO57 RecName: Full=Uncharacterized membrane protein yliF;
  298::353     4e-11  50%  381 aa  YDDV_SHIFL RecName: Full=Diguanylate cyclase yddV;       
  298::353     4e-11  50%  381 aa  YDDV_SHIF8 RecName: Full=Diguanylate cyclase yddV;       
  191::319     4e-11  35%  356 aa  Y1970_STAS1 RecName: Full=Uncharacterized membrane protein SSP1970;
  342::481     2e-10  38%  791 aa  MBAA_VIBCH RecName: Full=Biofilm architecture maintenance protein
   56::177     3e-10  36%  241 aa  YHUH_STRGR RecName: Full=Uncharacterized protein in hutH
  331::432     8e-10  35%  491 aa  YEAI_ECOLI RecName: Full=Inner membrane protein yeaI;
  252::335     4e-09  42%  408 aa  YFIN_ECOLI RecName: Full=Inner membrane protein yfiN;
  685::788     4e-09  35% 1105 aa  YEGE_ECOLI RecName: Full=Uncharacterized protein yegE;
   32::112     1e-08  38%  183 aa  YREP_STRAM RecName: Full=Uncharacterized 19.3 kDa protein in repSA
  402::492     2e-08  38%  827 aa  Y4LL_RHISN RecName: Full=Uncharacterized protein y4lL;
  375::472     5e-08  34%  800 aa  YKOW_BACSU RecName: Full=Signaling protein ykoW;
  135::246     8e-04  23%  283 aa  YDAK_BACSU RecName: Full=Uncharacterized membrane protein ydaK;
    1::494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YEDQ_SHISS      ----------------------------------------------------------------------
YEDQ_SHIDS      ----------------------------------------------------------------------
YEDQ_ECOUT      ----------------------------------------------------------------------
YEDQ_ECOLI      ----------------------------------------------------------------------
YEDQ_ECO57      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YEDQ_ECOL6      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YEDQ_SHIFL      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
Y3311_PSEAE     ----------------------------------------------------------------------
YEAJ_ECOLI      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YLLM_STAAU      ----------------------------------------------------------------------
Y809_STAAC      ----------------------------------------------------------------------
Y800_STAAR      ----------------------------------------------------------------------
Y760_STAA8      ----------------------------------------------------------------------
Y746_STAAM      ----------------------------------------------------------------------
Y730_STAA3      ----------------------------------------------------------------------
Y711_STAAS      ----------------------------------------------------------------------
Y708_STAAW      ----------------------------------------------------------------------
Y701_STAAN      ----------------------------------------------------------------------
Y698_STAAB      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
YLIF_ECOLI      ----------------------------------------------------------------------
Y528_STAES      ----------------------------------------------------------------------
Y413_STAEQ      ----------------------------------------------------------------------
Y2145_STAHJ     ----------------------------------------------------------------------
YLIF_ECO57      ----------------------------------------------------------------------
YDDV_SHIFL      ----------------------------------------------------------------------
YDDV_SHIF8      ----------------------------------------------------------------------
Y1970_STAS1     ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
YHUH_STRGR      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
YFIN_ECOLI      ----------------------------------------------------------------------
YEGE_ECOLI      ----------------------------------------------------------------------
YREP_STRAM      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YDAK_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YEDQ_SHISS      ----------------------------------------------------------------------
YEDQ_SHIDS      ----------------------------------------------------------------------
YEDQ_ECOUT      ----------------------------------------------------------------------
YEDQ_ECOLI      ----------------------------------------------------------------------
YEDQ_ECO57      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YEDQ_ECOL6      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YEDQ_SHIFL      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
Y3311_PSEAE     ----------------------------------------------------------------------
YEAJ_ECOLI      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YLLM_STAAU      ----------------------------------------------------------------------
Y809_STAAC      ----------------------------------------------------------------------
Y800_STAAR      ----------------------------------------------------------------------
Y760_STAA8      ----------------------------------------------------------------------
Y746_STAAM      ----------------------------------------------------------------------
Y730_STAA3      ----------------------------------------------------------------------
Y711_STAAS      ----------------------------------------------------------------------
Y708_STAAW      ----------------------------------------------------------------------
Y701_STAAN      ----------------------------------------------------------------------
Y698_STAAB      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
YLIF_ECOLI      ----------------------------------------------------------------------
Y528_STAES      ----------------------------------------------------------------------
Y413_STAEQ      ----------------------------------------------------------------------
Y2145_STAHJ     ----------------------------------------------------------------------
YLIF_ECO57      ----------------------------------------------------------------------
YDDV_SHIFL      ----------------------------------------------------------------------
YDDV_SHIF8      ----------------------------------------------------------------------
Y1970_STAS1     ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
YHUH_STRGR      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
YFIN_ECOLI      ----------------------------------------------------------------------
YEGE_ECOLI      ----------------------------------------------------------------------
YREP_STRAM      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YDAK_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YEDQ_SHISS      ----------------------------------------------------------------------
YEDQ_SHIDS      ----------------------------------------------------------------------
YEDQ_ECOUT      ----------------------------------------------------------------------
YEDQ_ECOLI      ----------------------------------------------------------------------
YEDQ_ECO57      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YEDQ_ECOL6      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YEDQ_SHIFL      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
Y3311_PSEAE     ----------------------------------------------------------------------
YEAJ_ECOLI      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YLLM_STAAU      ----------------------------------------------------------------------
Y809_STAAC      ----------------------------------------------------------------------
Y800_STAAR      ----------------------------------------------------------------------
Y760_STAA8      ----------------------------------------------------------------------
Y746_STAAM      ----------------------------------------------------------------------
Y730_STAA3      ----------------------------------------------------------------------
Y711_STAAS      ----------------------------------------------------------------------
Y708_STAAW      ----------------------------------------------------------------------
Y701_STAAN      ----------------------------------------------------------------------
Y698_STAAB      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
YLIF_ECOLI      ----------------------------------------------------------------------
Y528_STAES      ----------------------------------------------------------------------
Y413_STAEQ      ----------------------------------------------------------------------
Y2145_STAHJ     ----------------------------------------------------------------------
YLIF_ECO57      ----------------------------------------------------------------------
YDDV_SHIFL      ----------------------------------------------------------------------
YDDV_SHIF8      ----------------------------------------------------------------------
Y1970_STAS1     ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
YHUH_STRGR      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
YFIN_ECOLI      ----------------------------------------------------------------------
YEGE_ECOLI      ----------------------------------------------------------------------
YREP_STRAM      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YDAK_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHY2_SYNY3      ----------------------------------------------------------------------
YDAM_ECOLI      ----------------------------------------------------------------------
YDAM_ECO57      ----------------------------------------------------------------------
YHCK_BACSU      ----------------------------------------------------------------------
PLED_CAUCR      ----------------------------------------------------------------------
ADRA_ECOLI      ----------------------------------------------------------------------
ADRA_ECOL6      ----------------------------------------------------------------------
YDDV_SHIBS      ----------------------------------------------------------------------
YDDV_ECOLI      ----------------------------------------------------------------------
YDDV_ECO57      ----------------------------------------------------------------------
YEDQ_SHISS      ----------------------------------------------------------------------
YEDQ_SHIDS      ----------------------------------------------------------------------
YEDQ_ECOUT      ----------------------------------------------------------------------
YEDQ_ECOLI      ----------------------------------------------------------------------
YEDQ_ECO57      ----------------------------------------------------------------------
Y1389_MYCBO     ----------------------------------------------------------------------
Y1354_MYCTU     ----------------------------------------------------------------------
YEDQ_ECOL6      ----------------------------------------------------------------------
YDDV_SHISS      ----------------------------------------------------------------------
YEDQ_SHIFL      ----------------------------------------------------------------------
YEDQ_SALTY      ----------------------------------------------------------------------
YEDQ_SALTI      ----------------------------------------------------------------------
YEDQ_SALPA      ----------------------------------------------------------------------
YEDQ_SALCH      ----------------------------------------------------------------------
Y1727_PSEAE     ----------------------------------------------------------------------
YCDT_ECOLI      ----------------------------------------------------------------------
YTRP_BACSU      ----------------------------------------------------------------------
Y3311_PSEAE     ----------------------------------------------------------------------
YEAJ_ECOLI      ----------------------------------------------------------------------
GMR_ECOLI       ----------------------------------------------------------------------
YLLM_STAAU      ----------------------------------------------------------------------
Y809_STAAC      ----------------------------------------------------------------------
Y800_STAAR      ----------------------------------------------------------------------
Y760_STAA8      ----------------------------------------------------------------------
Y746_STAAM      ----------------------------------------------------------------------
Y730_STAA3      ----------------------------------------------------------------------
Y711_STAAS      ----------------------------------------------------------------------
Y708_STAAW      ----------------------------------------------------------------------
Y701_STAAN      ----------------------------------------------------------------------
Y698_STAAB      ----------------------------------------------------------------------
YEAP_ECOLI      ----------------------------------------------------------------------
YDEH_ECOLI      ----------------------------------------------------------------------
YNEF_ECOLI      ----------------------------------------------------------------------
YNEF_ECO57      ----------------------------------------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
YLIF_ECOLI      ----------------------------------------------------------------------
Y528_STAES      ----------------------------------------------------------------------
Y413_STAEQ      ----------------------------------------------------------------------
Y2145_STAHJ     ----------------------------------------------------------------------
YLIF_ECO57      ----------------------------------------------------------------------
YDDV_SHIFL      ----------------------------------------------------------------------
YDDV_SHIF8      ----------------------------------------------------------------------
Y1970_STAS1     ----------------------------------------------------------------------
MBAA_VIBCH      ----------------------------------------------------------------------
YHUH_STRGR      ----------------------------------------------------------------------
YEAI_ECOLI      ----------------------------------------------------------------------
YFIN_ECOLI      ----------------------------------------------------------------------
YEGE_ECOLI      ----------------------------------------------------------------------
YREP_STRAM      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
YKOW_BACSU      ----------------------------------------------------------------------
YDAK_BACSU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTDSLTGLINRRKFDTLIEREWRRA
PHY2_SYNY3      -----------------------------------------------DALTQVGNRYLFDSTLEREWQRL
YDAM_ECOLI      -----------------------------------------------DAMTGLLNRRQFYHITEPGQMQH
YDAM_ECO57      -----------------------------------------------DAMTGLLNRRQFYHITEPGQMQH
YHCK_BACSU      -----------------------------------------------DFLTGVYNRRKFEETTKALYQQA
PLED_CAUCR      ----------------------------------------------TDQLTGLHNRRYMTGQLDSLVKRA
ADRA_ECOLI      ---------------------------------------------TRDGMTGVYNRRHWETMLRNEFDNC
ADRA_ECOL6      ---------------------------------------------TRDGMTGVYNRRHWETMLRNEFDNC
YDDV_SHIBS      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
YDDV_ECOLI      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
YDDV_ECO57      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
YEDQ_SHISS      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
YEDQ_SHIDS      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
YEDQ_ECOUT      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
YEDQ_ECOLI      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
YEDQ_ECO57      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
Y1389_MYCBO     -----------------------------------------------DDLTGLHNRRAL--LQHLDQRLA
Y1354_MYCTU     -----------------------------------------------DDLTGLHNRRAL--LQHLDQRLA
YEDQ_ECOL6      -----------------------------------------------DTLTRLYNR---GALFEKACPLA
YDDV_SHISS      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
YEDQ_SHIFL      -----------------------------------------------DTLTRLYNR---GALFEKARPLA
YEDQ_SALTY      -----------------------------------------------DPLTRLYNRGALFEKASRLAKRY
YEDQ_SALTI      -----------------------------------------------DPLTRLYNRGALFEKASRLAKRY
YEDQ_SALPA      -----------------------------------------------DPLTRLYNRGALFEKASRLAKRY
YEDQ_SALCH      -----------------------------------------------DPLTRLYNRGALFEKASRLAKRY
Y1727_PSEAE     -----------------------------------------------DNLTKLPNRMLLDDRLEQAIQQA
YCDT_ECOLI      -----------------------------------------------DPLTNIFNRNYFFN--ELTVQSA
YTRP_BACSU      ----------------------------------------------TDQLTELYSRAYLDEKIQY----S
Y3311_PSEAE     -----------------------------------------------DSLTGLQNRTAFNEVFVQHLENC
YEAJ_ECOLI      ----------------------------------------------SDAMTGLYNRKILTPELEQRLQKL
GMR_ECOLI       ----------------------------------------------TDSITGLPNRNAMQDLIDHAINHA
YLLM_STAAU      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y809_STAAC      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y800_STAAR      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y760_STAA8      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y746_STAAM      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y730_STAA3      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y711_STAAS      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y708_STAAW      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y701_STAAN      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
Y698_STAAB      -----------------------------------------------DYLTGLGNVKEFDRHLNEISRKA
YEAP_ECOLI      ----------------------------------------------TDSLTGLPNRRAIFENLTTLFSLA
YDEH_ECOLI      -----------------------------------------------DVLTGLPGRRVLDESFDHQLRNA
YNEF_ECOLI      ---------------------------------------------------------------------S
YNEF_ECO57      ---------------------------------------------------------------------S
Y091_CAUCR      -----------------------------------------------DGLTGLLNRNSLQMRLAAAIDRV
YLIF_ECOLI      -----------------------------------------------DDLTKAMGRKSFD-----EDLKA
Y528_STAES      -----------------------------------------------DYLTGLGNVKEFDRHLNEVSSKA
Y413_STAEQ      -----------------------------------------------DYLTGLGNVKEFDRHLNEVSSKA
Y2145_STAHJ     -----------------------------------------------DYLTGLGNVKEFDRHLNHVSQIA
YLIF_ECO57      -----------------------------------------------DDLTKAMGRKSFD-----EDLKA
YDDV_SHIFL      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
YDDV_SHIF8      -----------------------------------------------DVLTKLLNRRFLPTIFKREIAHA
Y1970_STAS1     -----------------------------------------------DYLTGLGNVKEFDRHLNETARLS
MBAA_VIBCH      -----------------------------------------------DHLTKLANRYQFQVQADLLLSRC
YHUH_STRGR      ----------------------------------------------TDPLTGLANRRAVDVRLDEAMERH
YEAI_ECOLI      -----------------------------------------------DVLTNIYNRRYFFNSVESLLSRP
YFIN_ECOLI      -----------------------------------------------DPLTGLANRAAFRSGINTLMNNS
YEGE_ECOLI      -----------------------------------------------DALTHLANRASFEKQLRILLQTV
YREP_STRAM      -----------------------------------------------DPLTGLHTRAGWTARAEH----C
Y4LL_RHISN      -----------------------------------------------DALTGLPNRQ----FLREEFERL
YKOW_BACSU      -----------------------------------------------DSLTDLPNRRHAISHLTKVLNRE
YDAK_BACSU      -----------------------------------------------DRVTGFDNKQRMKLELSEEIKRA


                         .         .         .         .         *         .         .:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
PHY2_SYNY3      QRIREPLALLLCDVDFFKGFNDNYGHPAGDRCLKKIADAMAKVAKRPTDLVARYGGEEFAIILSETSLEG
YDAM_ECOLI      LAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTL-ESCARKGDLVFRWGGEEFVLLLPRTPLDT
YDAM_ECO57      LAIAQDYSLLLIDTDRFKHINDLYGHSKGDEVLCALARTL-ESCARKGDLVFRWGGEEFVLLLPRTPLDT
YHCK_BACSU      A--DTPFALIYMDIDHFKTINDQYGHHEGDQVLKELGLRLKQTI-RNTDPAARIGGEEFAVLLPNCSLDK
PLED_CAUCR      TLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNV-RAIDLPCRYGGEEFVVIMPDTALAD
ADRA_ECOLI      RRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITL-RGSDVIGRFGGDEFAVIMSGTPATA
ADRA_ECOL6      RRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITL-RGSDVIGRFGGDEFAVIMSGTPATA
YDDV_SHIBS      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNV-RSSDYVFRYGGDEFIIVLTEASENE
YDDV_ECOLI      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNV-RSSDYVFRYGGDEFIIVLTEASENE
YDDV_ECO57      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNV-RSSDYVFRYGGDEFIIVLTEASENE
YEDQ_SHISS      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGASLTE
YEDQ_SHIDS      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGASLTE
YEDQ_ECOUT      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGASLTQ
YEDQ_ECOLI      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGASLTE
YEDQ_ECO57      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGASLTE
Y1389_MYCBO     PGQPGPVAALFLDLDRLKAINDYLGHAAGDQFIHVFAQRIGDALV-GESLIARLGGDEF-VLIPASSADA
Y1354_MYCTU     PGQPGPVAALFLDLDRLKAINDYLGHAAGDQFIHVFAQRIGDALV-GESLIARLGGDEF-VLIPASSADA
YEDQ_ECOL6      KLCHTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDIAGRVGGEEFCVILPGANLTQ
YDDV_SHISS      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEILRKVSQAFYDNV-HSSDYVFRYGGDEFIIVLTEASENE
YEDQ_SHIFL      KLCQTPFSVIQVDLDHFKAINDRFGHQAGDRVLSHAAGLISSSL-RAQDVAGRVGGEEFCVILPGANLTQ
YEDQ_SALTY      REARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTI-RAHDIAGRVGGEEFCIVLPGATKAQ
YEDQ_SALTI      REARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTI-RAHDIAGRVGGEEFCIVLPGATKAQ
YEDQ_SALPA      REARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTI-RAHDIAGRVGGEEFCIVLPGATKAQ
YEDQ_SALCH      REARQPFSVIQLDLDYFKSVNDRFGHQAGDRVLSHAAGLIGSTI-RAHDIAGRVGGEEFCIVLPGATKAQ
Y1727_PSEAE     IRDDRRFAVLFMDLDGFKAVNDAYGHHLGDLLLIEVAERIRANV-RAQDTIARLGGDEFVLLIEAREPAD
YCDT_ECOLI      SAQKTPYCVMIMDIDHFKKVNDTWGHPVGDQVIKTVVNIIGKSI-RPDDLLARVGGEEFGVLLTDIDTER
YTRP_BACSU      MKIHQKGVFILVDIDNFKNVNDTYGHQTGDEILIQVASVIKSNI-RKHDVGARWGGEELAIYLPNVPVAV
Y3311_PSEAE     RLRGKGLAVMFLDLDHFKRINDSLGHDSGDQLLKIVSERI-RSVLRDSDVVARFAGDEFCVLADLTQDHE
YEAJ_ECOLI      VQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSI-RKSDYAIRLGGDEFCIILVDSTPQI
GMR_ECOLI       --DNNKVGVVYLDLDNFKKVNDAYGHLFGDQLLRDVSLAILSCLEH-DQVLARPGGDEFLVLASNTSQSA
YLLM_STAAU      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y809_STAAC      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y800_STAAR      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y760_STAA8      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y746_STAAM      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y730_STAA3      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y711_STAAS      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y708_STAAW      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y701_STAAN      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
Y698_STAAB      EKEHQSIALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIHNYSLDQ
YEAP_ECOLI      RHLNHKIMIAFIDLDNFKLINDRFGHNSGDLFLIQVGERL-NTLQQNGEVIGRLGGDEFLVVSLNNENAD
YDEH_ECOLI      EPLN--LYLMLLDIDRFKLVNDTYGHLIGDVVLRTLATYLA-SWTRDYETVYRYGGEEFIIIVKAAACRA
YNEF_ECOLI      LKQTQHLTVMLLDIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKG-LVARMGGEEFAVAVPSVNPVD
YNEF_ECO57      LKQTQHLTVMLLDIDYFKSINDNYGHECGDKVLSVFARHIQKIVGDKG-LVARMGGEEFAVAVPSVNPVD
Y091_CAUCR      EASGESLAVICIDLDHFKEANDQHGHLAGDALLVETARRLQSAVQ-APSFAARLGGDEFIVVIAGGDQPA
YLIF_ECOLI      LPEKGGY-LCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPVDKGKVYRFGGDEFAVIYTGGTLEE
Y528_STAES      EEKKQSLALLLIDIDGFKDVNDHYSHQSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIRDYTLDQ
Y413_STAEQ      EEKKQSLALLLIDIDGFKDVNDHYSHQSGDAVLKQMSQLLKNYVPNQFK-IFRNGGEEFSVVIRDYTLDQ
Y2145_STAHJ     EDKNESLALLLIDIDGFKDVNDTYSHKSGDAVLKQMSQLLKNYVPKQFQ-IFRNGGEEFSVVIRNYSLDQ
YLIF_ECO57      LPEKGGY-LCLFDVDKFKNINDTFGHLLGDEVLMKVVKILKSQIPVDKGKVYRFGGDEFAVIYTGGTLEE
YDDV_SHIFL      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEIL-------------------------------------
YDDV_SHIF8      NRTGTPLSVLIIDVDKFKEINDTWGHNTGDEIL-------------------------------------
Y1970_STAS1     EENNQSLGLLLIDIDGFKDVNDMYSHKSGDAVLRQVAQLLKNYVPQQFS-IYRNGGEEFSIVLYDYTLDQ
MBAA_VIBCH      YDTQH-IWVMYIDLDNFKYVNDKYGHQIGDSLLVSFALCKNEASHNTYSIAARLSGDEFAILLVSPAKIF
YHUH_STRGR      RVDATVVSLVVCDLNGLKAVNDTHGHAVGDRLLERLSLC-GAMLPEA--LAARLGGDEFCLLTXXXXXXX
YEAI_ECOLI      VVKD--FCVMLVDINQFKRINAQWGHRVGDKVLVSIVDIIQQSI-RPDDILARLEGEVFGLLFTELNSAQ
YFIN_ECOLI      DARKTS-ALLFLDGDNFKYINDTWGHATGDRVLIEIAKRLAE-FGGLRHKAYRLGGDEFAMVL-------
YEGE_ECOLI      NSTHQRHALVFIDLDRFKAVNDSAGHAAGD-XXXXXXXXXXXXXXXXXDVLARLGGDEFGLLLPDCNVES
YREP_STRAM      IHRHPRAAVLLVDLDHFKTLNDTHGHAAGDAALIATAHRLSSWCGRHG-TAGRLGGDEFVTAI-------
Y4LL_RHISN      IAPSTRLAILCLDLDGFKAINDAYGRATGDLLLRHVTERLRNFLKQS-DILCRLSGDEFVVLRVGINSNA
YKOW_BACSU      HSLHYNTVVFFLDLNRFKVINDALGHNVGDQLLQFAAKRLSSVVPDNG-FIARLGGDEFIIILT--DANT
YDAK_BACSU      ERYGNSFVFLLLHMHYFKEFKSLYGEKETDRLFQYVGQQIRTSV-RETDKKFRPSDERIGIVLTHTPAEH


                         .         .         +         .         .         .         .:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAASxxxx
PHY2_SYNY3      AINVTEALQVEVANLAIGTGHVTLSIGIAVYTP-------------------------------------
YDAM_ECOLI      ALSLAETIRVSVAKVSIGLPRFTVSIGVA-----------------------------------------
YDAM_ECO57      ALSLAETIRVSVAKVSIGLPRFTVSIGVA-----------------------------------------
YHCK_BACSU      AARIAERIRSTVSDAPITNGDVTISLGAANNTEQPG----------------------------------
PLED_CAUCR      ALRIAERIRMHVSPFTVAHGNVTISIGV-SATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA----
ADRA_ECOLI      MLRVHEGL-NTLRLPNTPQVTLRISVGVAPLNPQM-SHYREWLKSADLALYKAKKAGRNRTEVAA-----
ADRA_ECOL6      MLRVHEGL-NTLRLPNTPQVTLRISVGVAPLNPQM-SHYREWLKSADLALYKAKKAGRNRTEVAA-----
YDDV_SHIBS      TLRTAERIRSRVEKTKLKAANLSLSIGAAMFNGHP-----------------------------------
YDDV_ECOLI      TLRTAERIRSRVEKTKLKAANLSLSIGAAMFNGHP-----------------------------------
YDDV_ECO57      TLRTAERIRSRVEKTKLKAANLSLSIGAAMFNGHP-----------------------------------
YEDQ_SHISS      AAEVAERIRLKL----------------------------------------------------------
YEDQ_SHIDS      AAEVAERIRLKL----------------------------------------------------------
YEDQ_ECOUT      AAEVAERIRLKL----------------------------------------------------------
YEDQ_ECOLI      AAEVAERIRLKL----------------------------------------------------------
YEDQ_ECO57      AAEVAERIRLKL----------------------------------------------------------
Y1389_MYCBO     AQPLAERLRDQLKHVAIG-GEVTVSIGVASGT--PGQHTP------------------------------
Y1354_MYCTU     AQPLAERLRDQLKHVAIG-GEVTVSIGVASGT--PGQHTP------------------------------
YEDQ_ECOL6      AAEVAERIRLKL----------------------------------------------------------
YDDV_SHISS      TLRTAERIRSRVEKTKLKAANLSLSIGAAMFNGHP-----------------------------------
YEDQ_SHIFL      AAEVAERIRLKL----------------------------------------------------------
YEDQ_SALTY      ALQIAERIRQRI----------------------------------------------------------
YEDQ_SALTI      ALQIAERIRQRI----------------------------------------------------------
YEDQ_SALPA      ALQIAERIRQRI----------------------------------------------------------
YEDQ_SALCH      ALQIAERIRQRI----------------------------------------------------------
Y1727_PSEAE     AATLAEKLVKRISQYQISRHEVRISIGIA-LYPGDGQ---------------------------------
YCDT_ECOLI      AKALAERIRENVPEYAIPQ-KVTISIG-------------------------------------------
YTRP_BACSU      GKRITERLVYAVRKNT--KPEVTISCGISCWT--------------------------------------
Y3311_PSEAE     AHILSQRLMQKMKEPIALDGRMTASVGV-SLYPNDGEQCEELLKNAGLALHQSKACGRN-----------
YEAJ_ECOLI      AAQLPERIEKRLQH-IAPQKEIGFSSGIYAM---------------------------------------
GMR_ECOLI       LEAMASRILTRLLPFRIGLIEVSCSVGIA-LSPEHG----------------------------------
YLLM_STAAU      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y809_STAAC      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y800_STAAR      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y760_STAA8      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y746_STAAM      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y730_STAA3      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y711_STAAS      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y708_STAAW      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y701_STAAN      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
Y698_STAAB      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTDDDPKSQRKVFKDADDMVHVAKNQGRN-----------
YEAP_ECOLI      ISSLRERIQQQIGEYHLGDVDLGASLGIVEVDP-------------------------------------
YDEH_ECOLI      GVRICQLVDNHAITHSEGHINITVTAGVSRAFP-------------------------------------
YNEF_ECOLI      GLLMAEKIRKGVETWQQKTLYLTVSIGVGS----------------------------------------
YNEF_ECO57      GLLMAEKIRKGVETWQQKTLYLTVSIGVGS----------------------------------------
Y091_CAUCR      ----------------------------------------------------------------------
YLIF_ECOLI      LL----SILKEIVHFQVGSINLSTSIGVAHSNECP-----------------------------------
Y528_STAES      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRN-----------
Y413_STAEQ      SVKLAENIRSGVEKSSFHLPNLSVSIGVGYLTQEDRKSQRKVFKDADDMVHVAKSEGRN-----------
Y2145_STAHJ     SVKLAENIRTGVEKSSFHLPNLSVSIGVGYLSQDDHKSQRKVFKDADDMVHVAKNEGRN-----------
YLIF_ECO57      LL----SILKEIVHFQVGSINLSTSIGVA-----------------------------------------
YDDV_SHIFL      ----------------------------------------------------------------------
YDDV_SHIF8      ----------------------------------------------------------------------
Y1970_STAS1     CVKLSESIRGGVEQSTFHLPNLSVSIGVGYLT--------------------------------------
MBAA_VIBCH      AQRLLAPIQNK-DNSPLSHFPITASIGIATF-PKDGEH--------------------------------
YHUH_STRGR      XXXXXTELCDRAAVIELGDG---VACGVAS----------------------------------------
YEAI_ECOLI      AKIIAERMRKNV----------------------------------------------------------
YFIN_ECOLI      ----------------------------------------------------------------------
YEGE_ECOLI      ARFIATRIISAV----------------------------------------------------------
YREP_STRAM      ----------------------------------------------------------------------
Y4LL_RHISN      ----------------------------------------------------------------------
YKOW_BACSU      GTGEADVL--------------------------------------------------------------
YDAK_BACSU      MPAVLTKLKKQLDTYQLENG--------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
PHY2_SYNY3      ----
YDAM_ECOLI      ----
YDAM_ECO57      ----
YHCK_BACSU      ----
PLED_CAUCR      ----
ADRA_ECOLI      ----
ADRA_ECOL6      ----
YDDV_SHIBS      ----
YDDV_ECOLI      ----
YDDV_ECO57      ----
YEDQ_SHISS      ----
YEDQ_SHIDS      ----
YEDQ_ECOUT      ----
YEDQ_ECOLI      ----
YEDQ_ECO57      ----
Y1389_MYCBO     ----
Y1354_MYCTU     ----
YEDQ_ECOL6      ----
YDDV_SHISS      ----
YEDQ_SHIFL      ----
YEDQ_SALTY      ----
YEDQ_SALTI      ----
YEDQ_SALPA      ----
YEDQ_SALCH      ----
Y1727_PSEAE     ----
YCDT_ECOLI      ----
YTRP_BACSU      ----
Y3311_PSEAE     ----
YEAJ_ECOLI      ----
GMR_ECOLI       ----
YLLM_STAAU      ----
Y809_STAAC      ----
Y800_STAAR      ----
Y760_STAA8      ----
Y746_STAAM      ----
Y730_STAA3      ----
Y711_STAAS      ----
Y708_STAAW      ----
Y701_STAAN      ----
Y698_STAAB      ----
YEAP_ECOLI      ----
YDEH_ECOLI      ----
YNEF_ECOLI      ----
YNEF_ECO57      ----
Y091_CAUCR      ----
YLIF_ECOLI      ----
Y528_STAES      ----
Y413_STAEQ      ----
Y2145_STAHJ     ----
YLIF_ECO57      ----
YDDV_SHIFL      ----
YDDV_SHIF8      ----
Y1970_STAS1     ----
MBAA_VIBCH      ----
YHUH_STRGR      ----
YEAI_ECOLI      ----
YFIN_ECOLI      ----
YEGE_ECOLI      ----
YREP_STRAM      ----
Y4LL_RHISN      ----
YKOW_BACSU      ----
YDAK_BACSU      ----