[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38119.1

[Show Plain Result]


## Summary of Sequence Search
    1::496
    2::471     e-168  59%  473 aa  BOXB_AZOEV RecName: Full=Benzoyl-CoA oxygenase component B;        
    1::496

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxVDYSTKIPNNVDLASDRQVLKALEGWHPGYIDWWNDMGPEGFQQSLVYLR
BOXB_AZOEV      --------------------INYSERIPNNVNLNENKTLQRALEQWQPSFLNWWDDMGPENSSNYDVYLR


                         .         .         *         .         .         .         .:140
query           TAYSVDPRGWAKFDYVKMPDYRWGVLLAPQEENRTIPFGEHYGEPAWQEVPGEYRAMLRRLIVIQGDTEP
BOXB_AZOEV      TAVSVDPKGWADFGYVKMHDYRWGIFLAPQEGEKKITFGEHKGQDVWQEVPGEYRSTLRRIIVTQGDTEP


                         +         .         .         .         .         *         .:210
query           ASVEQQRHLGKTAPSLYDMRNLFQVNVEEGRHLWAMVYLLQKYFGRDGREEADDLLRRRSGDADSPRMLG
BOXB_AZOEV      ASVEQQRHLGLTAPSLYDLRNLFQVNVEEGRHLWAMVYLLHAHFXXXXXXXXXXXXXXXXXDEDNPRILT


                         .         .         .         +         .         .         .:280
query           AFNEATPDWLSFFMFTYFTDRDGKMQLHSLAQSGFDPLSRTCRFMLTEEAHHMFVGETGISRIVQRTCEA
BOXB_AZOEV      AFNEKTPDWLSFFMFTFITDRDGKFQLASLAESAFDPLARTCKFMLTEEAHHLFVGESGIARVIQRTCEV


                         .         *         .         .         .         .         +:350
query           MRDAGISDPTDIAKVRALGVIDLPTIQKKLNLHYTLSLDLFGSEVSTNAANAFNAGIKGRYHETQIDDDH
BOXB_AZOEV      MKELGTDDP---AKLRAAGVIDLPTLQKYLNFHYSVTSDLYGAEISSNAATYYTNGLKGRFEEEKIGDDH


                         .         .         .         .         *         .         .:420
query           RLANDTYPVLKFVNGEIKRVDEPALTALNMRLRDDYSQDCVKGLLRWNKVITTAGYDFQLALPHVAFHRA
BOXB_AZOEV      KLQNSEYEVMDVAGDKILTRHVPALSALNERLRDDWITDVQAGVDRWNRIPAKFGFDFRFTLPHKGFHRK


                         .         .         +         .         .         .         .:490
query           IGEFKGVHATPEGLLIDGATWARRKDDWLPSTDDGDFIASLMQPVSDPGAYAPWIAAPKVGIDNKPGDFE
BOXB_AZOEV      IGMFADVHVSPDGRLISEAEWTHQHKNWLPTESDRLYVHSLMGRCLEPGKFANWIAAPARGINNQPVNFE


                         *         .         .         .         .         +         .:560
query           YVKxxx
BOXB_AZOEV      YVR---