[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38168.1

[Show Plain Result]


## Summary of Sequence Search
    1::249
    1::249     e-125  92%  249 aa  ETFB_BRAJA RecName: Full=Electron transfer flavoprotein subunit
    1::249     8e-93  70%  249 aa  ETFB_PSEAE RecName: Full=Electron transfer flavoprotein subunit
    1::252     3e-91  71%  252 aa  ETFB_PARDE RecName: Full=Electron transfer flavoprotein subunit
    1::251     3e-87  66%  251 aa  ETFB_ARATH RecName: Full=Electron transfer flavoprotein subunit
    3::248     5e-79  58%  250 aa  ETFB_DICDI RecName: Full=Electron transfer flavoprotein subunit
    1::253     2e-77  60%  253 aa  ETFB_ORYSJ RecName: Full=Electron transfer flavoprotein subunit
    4::250     7e-70  56%  255 aa  ETFB_MOUSE RecName: Full=Electron transfer flavoprotein subunit
    4::250     1e-69  56%  255 aa  ETFB_RAT RecName: Full=Electron transfer flavoprotein subunit beta;
    4::250     5e-69  55%  255 aa  ETFB_BOVIN RecName: Full=Electron transfer flavoprotein subunit
    1::253     4e-68  55%  253 aa  ETFB_ORYSI RecName: Full=Electron transfer flavoprotein subunit
    4::250     2e-61  51%  255 aa  ETFB_PIG RecName: Full=Electron transfer flavoprotein subunit beta;
    4::250     2e-61  51%  255 aa  ETFB_HUMAN RecName: Full=Electron transfer flavoprotein subunit
    7::256     5e-61  49%  261 aa  ETFB_YEAST RecName: Full=Probable electron transfer flavoprotein
    4::250     6e-61  51%  255 aa  ETFB_PONAB RecName: Full=Electron transfer flavoprotein subunit
    4::249     8e-59  47%  254 aa  ETFB_SCHPO RecName: Full=Probable electron transfer flavoprotein
    1::250     3e-30  37%  260 aa  ETFB_CLOTS RecName: Full=Electron transfer flavoprotein subunit
    1::257     1e-28  34%  257 aa  ETFB_BACSU RecName: Full=Electron transfer flavoprotein subunit
    1::212     2e-27  35%  259 aa  ETFB_CLOAB RecName: Full=Electron transfer flavoprotein subunit
    1::247     3e-25  34%  270 aa  ETFB_MEGEL RecName: Full=Electron transfer flavoprotein subunit
    4::251     8e-24  31%  266 aa  ETFB_MYCTU RecName: Full=Electron transfer flavoprotein subunit
    4::251     8e-24  31%  266 aa  ETFB_MYCBO RecName: Full=Electron transfer flavoprotein subunit
    4::248     5e-23  30%  266 aa  ETFB_MYCLE RecName: Full=Electron transfer flavoprotein subunit
    1::218     4e-21  31%  285 aa  FIXA_RHISN RecName: Full=Protein fixA;
    1::217     1e-20  31%  281 aa  FIXA_AZOVI RecName: Full=Protein fixA;
    1::216     3e-20  33%  279 aa  FIXA_RHILP RecName: Full=Protein fixA;
    1::215     9e-20  30%  264 aa  ETFB_METME RecName: Full=Electron transfer flavoprotein subunit
    1::183     5e-18  34%  292 aa  FIXA_RHIME RecName: Full=Protein fixA;
    1::190     9e-18  32%  281 aa  FIXA_AZOC5 RecName: Full=Protein fixA;
    1::183     2e-16  33%  288 aa  FIXA_BRAJA RecName: Full=Protein fixA;
    1::231     5e-13  25%  256 aa  FIXA_ECOL6 RecName: Full=Protein fixA;
    1::231     5e-13  25%  256 aa  FIXA_ECO45 RecName: Full=Protein fixA;
    1::231     5e-13  25%  256 aa  FIXA_ECO27 RecName: Full=Protein fixA;
    1::231     6e-13  25%  256 aa  FIXA_ECOL5 RecName: Full=Protein fixA;
    1::231     6e-13  25%  256 aa  FIXA_ECO81 RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SHIFL RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SHIF8 RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALTY RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALTI RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALPK RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALPB RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALPA RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALNS RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_SALA4 RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_ECOSE RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_ECOLU RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_ECO8A RecName: Full=Protein fixA;
    1::231     7e-10  23%  256 aa  FIXA_ECO55 RecName: Full=Protein fixA;
   28::250     9e-10  27%  254 aa  YDIQ_ECOLI RecName: Full=Putative electron transfer flavoprotein
    1::231     9e-10  23%  256 aa  FIXA_ECOLI RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECOLC RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECOHS RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECODH RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECOBW RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECO57 RecName: Full=Protein fixA;
    1::231     9e-10  23%  256 aa  FIXA_ECO24 RecName: Full=Protein fixA;
    1::231     1e-09  23%  256 aa  FIXA_ECOSM RecName: Full=Protein fixA;
    1::231     1e-09  23%  256 aa  FIXA_ECO7I RecName: Full=Protein fixA;
    1::231     2e-09  23%  256 aa  FIXA_ESCF3 RecName: Full=Protein fixA;
    1::231     6e-09  23%  256 aa  FIXA_SALG2 RecName: Full=Protein fixA;
    1::231     6e-09  23%  256 aa  FIXA_SALDC RecName: Full=Protein fixA;
   55::248     1e-07  24%  259 aa  YGCR_ECOLI RecName: Full=Putative electron transfer flavoprotein
    1::249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
ETFB_BRAJA      MKVLVPVKRVVDYNVKVRVKGDGSGVELANVKMSMNPFDEIAVEEALRLKEGGKATEVVVVSIGPAQASE
ETFB_PSEAE      MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVAVSVGPTAAQE
ETFB_PARDE      MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAE
ETFB_ARATH      MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIAVSIGPSQCVD
ETFB_DICDI      LKILVPIKRVVDYAVKIRVKGDKSGVETANVKMSMNPFDEIAVEEAIRIKEKNLAKEIIAVSMGPKTSQE
ETFB_ORYSJ      MKILVAVKRVVDYAVKVRVRPDRTGVETASVKMSMNPFCEIAVEEALRLRESGXXXXXXXXXXGPSQSAD
ETFB_MOUSE      LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQE
ETFB_RAT        LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPPQCQE
ETFB_BOVIN      LRALVAVKRVIDFAVKIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPAQCQE
ETFB_ORYSI      MKILVAVKRVVDYAVKVRVRPDRTGVETASVKMSMNPFCXXXXXXXXXXXXXXXXXXXXXXXXXPSQSAD
ETFB_PIG        LRALVAVKRVIDFAVKIRVKPDRTGVVMDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
ETFB_HUMAN      LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
ETFB_YEAST      LRILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLSTHAVSIGSAKAQD
ETFB_PONAB      LRALVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
ETFB_SCHPO      IRILVGVKRTLDYMLKPRINATKTAVDLSGQKMSINPFCDIAVEEAIRMKETNRIEDTLVVTAGQTSSEP
ETFB_CLOTS      MNILVLIKQVPDTN-EVRIDPVTKTLIREGVPSIINPDDKNALEEAIRIREGGKVT---VISMGPTQAEV
ETFB_BACSU      MNLFVLMKRTFDTEEKIVIET--GKIQDDGAEWIINPYDEYAIEEAIQLKEKHGGT-ITAVTVGGEEAEK
ETFB_CLOAB      MNIVVCLKQVPD-TAEVRIDPVKGTLIREGVPSIINPDDKNALEEALVLKD-NYGAHVTVISMGPPQAKN
ETFB_MEGEL      MEILVCVKQVPD-TAEVKIDPVKHTVIRAGVPNIFNPFDQNXXXXXXXXXXXXXXXXITLLSMGPDQAKD
ETFB_MYCTU      --IVVLIKQVPDTWSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAADSVTVLTAGPERATE
ETFB_MYCBO      --IVVLIKQVPDTWSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAADSVTVLTAGPERATE
ETFB_MYCLE      --IVVLIKQVPDTWSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKGIKGSVTVLTAGPERATE
FIXA_RHISN      MHIVVCIKQVPD-SAQIRVHPVTNTIMRQGVPTIINPYDLFALEQALQVRDH-HGGEVTVLTMGPPMAEE
FIXA_AZOVI      MHSVVCIKQLPD-SAQIRVHPVTNTIMRQGVPAIINPYDLFALEEALRLKDKFGGT-VTVVTMGPPMAEA
FIXA_RHILP      MHIVICIKQVPD-SAQIRVDPVTNTIMRQGVPTIINPYDLFALEE--RSSCASHGGEVTVLTMGPPMAED
ETFB_METME      MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
FIXA_RHIME      MHLVVCIKQVPD-SAQIRVHPVTNTIMRQGVPTIINPHDLAALEEALKLCDT-YGGEVTVVTMGPKMAED
FIXA_AZOC5      MHIVVCIKQVPD-SAQIRVHPVTNTIMRQGVPTIINPYDLFALEAALALRDQ-HGGEVTVLTMGPPSAED
FIXA_BRAJA      MHNIVCIKQVPD-SAQIRVHPVTNTIMRQGVPTIINPYDLFALEAALGLRDRFGG-EITVLTMGPPSAEE
FIXA_ECOL6      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO45      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO27      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOL5      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAVEAQVTALSVGGKALTN
FIXA_ECO81      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAVEAQVTALSVGGKALTN
FIXA_SHIFL      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_SHIF8      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_SALTY      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALTI      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALPK      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALPB      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALPA      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALNS      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALA4      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_ECOSE      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOLU      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO8A      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO55      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
YDIQ_ECOLI      -----------------------------NADAKISQFDLNAIEAASQL--ATDDDEIAALTVGGSQNSK
FIXA_ECOLI      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOLC      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOHS      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECODH      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOBW      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO57      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECO24      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_ECOSM      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEGQVTALSVGGKALTN
FIXA_ECO7I      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEGQVTALSVGGKALTN
FIXA_ESCF3      MKIITCYKCVPDEQDIAVNNADGS-LDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTALSVGGKALTN
FIXA_SALG2      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
FIXA_SALDC      MKIITCYKCVPDEQDIAINNADGT-LDFSKADSKISQYDLNAIEAACQLKQQLGDAQVVAMSVGGKALTN
YGCR_ECOLI      -------------------------------------------------RKNGTPMSLTALSMGDERALH


                         .         .         *         .         .         .         .:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
ETFB_BRAJA      TIRTGLAMGADRGILVKAEGTVEPLAVAKILKKVAEEEQPGLIILGKQAIDDDSNQTGQMLAALLGWSQA
ETFB_PSEAE      QLRTALALGADRAILVESNDELNSLAVAKLLKAVVDKEQPQLVILGKQAIDSDNNQTGQMLAALTGYAQG
ETFB_PARDE      TLRTALAMGADRAILVVAQQDIEPXXXXXXXXXXXXXEGTELIIAGKQAIDNDMNATGQMLAAILGWAQA
ETFB_ARATH      TLRTGLAMGADRGIHVETNSIFLPLTIAKILKSLADVENPGLIFLGKQAIDDDCNQTGQMVAALLGWPQA
ETFB_DICDI      TIRTAIAMGADKGIHVETTAELQPLSVAKLLKELVDKEKPNLIILGKQAIDDDCNQTAQMLAGLLNWPQA
ETFB_ORYSJ      TLRTALAMGADRAVHVLHDPDPSPLAVAKILRALALQENPGLVILGKQAIDDDCNQTGQMLAGLLNWPQG
ETFB_MOUSE      TIRTALAMGADRGIHVEIPGSLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQG
ETFB_RAT        TIRTALAMGADRGIHVEVPGALGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQG
ETFB_BOVIN      TIRTALAMGADRGIHVEVPAALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
ETFB_ORYSI      TLRTALAMGADRAVHVLHDPDPSPLAVAKILRALALQENPGLVILGKQAIDDDCNQTGQMLAGLLNWPQG
ETFB_PIG        TIRTALAMGADRGIHVEVPAALGPLQVARVLAKLAQKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
ETFB_HUMAN      TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
ETFB_YEAST      ILRNCLAKGIDTCSLIDSVGNIEPLAIAKILKAVVEKKGSNLVLMGKQAIDDDCNNTGQMLAGLLNWPQA
ETFB_PONAB      TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
ETFB_SCHPO      ILRQCLAKGIGRAALINVEKELEPLSVAKLLKATVEKEKSNLVLLGKQAIDDDAHQTGGMLAAMLGWPQF
ETFB_CLOTS      ALREALAMGADEAYLLRAFAGADTYATAKALSKAIEKFQYDIVFCGRQAIDGDTAQVGPQIAEQLDIPQV
ETFB_BACSU      ELRTALAMGCDQAVLINIEDDLDEYSISQVLYHYMKDQEFDLILGGNVAIDGGSGQVAPRLAELLDIPCI
ETFB_CLOAB      ALVEALAMGADEAVLLRAFGGADTLATSHTIAAGIKKLKYDIVFAGRQAIDGDTAQVGPEIAEHLGIPQV
ETFB_MEGEL      VLREGLAMGADDAYLLSSDTLATGYALAQAIKKLAADEQFDIILCGKQAIDGDTAQVGPQIACELGIPQI
ETFB_MYCTU      AIRKALSMGADKAVHLKDDGMHGSDVIQTLARALGTIEGTELVIAGNESTDGVGGAVPAIIAEYLGLPQL
ETFB_MYCBO      AIRKALSMGADKAVHLKDDGMHGSDVIQTLARALGTIEGTELVIAGNESTDGVGGAVPAIIAEYLGLPQL
ETFB_MYCLE      AIRKALSMGADKAVHLKDDGMHGSDVIQTLARALGTIEGTELVIAGNESTDGVGGVVPAIIAEYLGLPQL
FIXA_RHISN      SLRKALTYGADRAILLTSDTLATSFALSQAIAKIGNSGSPDIVFTGKQTIDGDTAQVGPGIAKRLDLVQL
FIXA_AZOVI      ALRKCLSFGADDAILVSSDTLATSYALSAVIRKIMEDMPVDLIFTGKQTIDGDTAQVGPGIAKRLDYQLL
FIXA_RHILP      ALRKALTV-ADRAVLLTATSFALSRAIAKIGEAFGT---PDIVFTAKQTIDGDTAQVGPGIAKRLDLLQL
ETFB_METME      SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
FIXA_RHIME      ALRKALTFGAHRAVLLTSDTLATSFALAQAIAEIGETGTPDVVFTGKQTIDGDTAQVGPGIAKRLDLQQL
FIXA_AZOC5      SLRKALTFGADRAVLLTSDXXXXXXXXXXXVRKIGETGAPDIVFTGKQTIDGDTAQVGPGIAKRLGLLQL
FIXA_BRAJA      SLRKALTYGADRAVLLTSDXXXXXXXXXXXIRKIGKEYGPNLIFTGKQTIDGDTAQVGPGIAKRLGVGQL
FIXA_ECOL6      AKKDVLSRGPDELIVVIDDQFEQPQQTASVLAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO45      AKKDVLSRGPDELIVVIDDQFEQPQQTASVLAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO27      AKKDVLSRGPDELIVVIDDQFEQPQQTASVLAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOL5      AKKDVLSRGPDELIVVIDDQFEQPQQTASVLAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO81      AKKDVLSRGPDELIVVIDDQFEQPQQTASVLAAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_SHIFL      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_SHIF8      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_SALTY      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALTI      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALPK      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALPB      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALPA      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALNS      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALA4      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_ECOSE      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOLU      AKKDVLSRGPDELIVVIDDQFERXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO8A      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO55      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
YDIQ_ECOLI      VRKDVLSRGPHSLYLVQ-DAQLEPLDTAKALAAAIEKIGFDLLIFGEGSGDLYAQQVGLLVGEILQLPVI
FIXA_ECOLI      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOLC      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOHS      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECODH      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOBW      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO57      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO24      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECOSM      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ECO7I      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILNIPAV
FIXA_ESCF3      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXGLILCGDGSSDLYAQQVGLLVGEILDIPVV
FIXA_SALG2      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
FIXA_SALDC      AKKDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSGLLICGDGSSDLYAQQVGLLVGEALNIPAI
YGCR_ECOLI      WLRYLMALGFEEAVLLETAADLRPEFVARHIAEWQHQNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPCF


                         +         .         .         .         .         *         .:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
ETFB_BRAJA      TFASKLEVEGSDFKVTREVDGGLQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTVADYGVD
ETFB_PSEAE      TFASKVEVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRLNEPRYASLPNIMKAKKKPLDVVTPDALGVS
ETFB_PARDE      TFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVD
ETFB_ARATH      TFASKLDKDKNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVD
ETFB_DICDI      TFASKVDIKDDSVHVTREIDGGLETLSMKLPAIISCDLRLNEPRYAKLQNIMKSKKAELKVETPESLNVD
ETFB_ORYSJ      TFASKVILNKEKATVEREVDGGIETISLDLPAVITTDLRLNQPRYATLPNIMKAKSKVIKKVTPEDLDVD
ETFB_MOUSE      TFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMXXXXXXXXXXXXGDLGVD
ETFB_RAT        TFASQVTLEGDKVKVEREIDGGLETIRLKLPAVVTADLRLNEPRYATLPNIMXXXXXXXXXXXXGDLGVD
ETFB_BOVIN      TFASQVTLEGDKIKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMXXXXXXXXXXXXGDLGVD
ETFB_ORYSI      TFASKVILNKEKATVEREVDGGIETISLDLPAVITTDLRLNQPRYATLPNIMKAKSKVIKKVTPEDLDVD
ETFB_PIG        TFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMXXXXXXXXXXXXGDLGVD
ETFB_HUMAN      TFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
ETFB_YEAST      TNAAKVELDNGRVQVTREIDDGEEVIEASLPMVITTDLRLNTPRYVGLPKLMKAKKKPILDIAKDFPEIN
ETFB_PONAB      TFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
ETFB_SCHPO      TSASKVRIEGDKVIVTREIDGGEETLSSTLPAIITTDLRLNVPRFANLAKVMKARKAPLGKMSPEDLGVT
ETFB_CLOTS      TYVRKVEIEGDKLIVERALEDGYEIIEVKTPVLLTAIKELNVPRYPSIKGIFNANKKEVKILTADDLEVD
ETFB_BACSU      TTITKLEINGTDAEAERDVEGDVEKIKTTLPLLVTAQQGLNEPRYPSLPGIMXXXXXXXXXXXXXXXXXX
ETFB_CLOAB      TYVEKVEVDGDTLKIRKAWEDGYEVVEVKTPVLLTAIKELNVPRYMSVEKIFGAFDKEVKMWTADDIDVD
ETFB_MEGEL      TYARDIKVEGDKVTVQQENEEGYIVTEAQFPVLITAVKDLNEPRFPTIRGTMKAKRREIPNXXXXQIGLS
ETFB_MYCTU      THLRKVSIEGGKITGERETDEGVFTLEATLPAVISVNEKINEPRFPSFKGIMAAKKKEVTVLTSDEVGLA
ETFB_MYCBO      THLRKVSIEGGKITGERETDEGVFTLEATLPAVISVNEKINEPRFPSFKGIMAAKKKEVTVLTSDEVGLA
ETFB_MYCLE      THLRTISVEGGKITGERETDEGVFTLEAVLPAVVSVNEKINEPRFPSFKGIMAAKKKEVTVLTLAEIGVE
FIXA_RHISN      TYVAKIDLRTRAITVERRAEGGTHVLKSELPCLITMLEGSNAIRRGSLDDALRAARSEIVKWNAVEAGIE
FIXA_AZOVI      TYVSRIDTAKKEIQVERRAEGGVQLLETSLPCLITMLEGTNEMRFGDLDDLFRAARHELKVWDRVAAGID
FIXA_RHILP      TYVAKIDINGREITVERRSEGGTQTLMSKLPCLITMLEGTNEIRRGSLDDALRAARSQIVKWNAADAGIE
ETFB_METME      AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGL-
FIXA_RHIME      TYVAKIDAASREITVERRAEGGSQILRTGLPCLVT-----------------------------------
FIXA_AZOC5      TYVAKIDLAGRSIQVERRSEGGVQVLQTRLPCLITMLEATNE----------------------------
FIXA_BRAJA      TYVAKVDVANETIEAERRSEGGVQVLHTRLPCLIT-----------------------------------
FIXA_ECOL6      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO45      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO27      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOL5      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO81      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_SHIFL      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_SHIF8      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_SALTY      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALTI      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALPK      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALPB      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALPA      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALNS      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALA4      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_ECOSE      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOLU      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO8A      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO55      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
YDIQ_ECOLI      NAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDINVPRIPSMKAILGAGKKPVNQQASDIDWSQ
FIXA_ECOLI      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOLC      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOHS      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECODH      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOBW      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO57      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO24      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECOSM      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ECO7I      NGVSKISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_ESCF3      NGVSKIISLTTDLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFN
FIXA_SALG2      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
FIXA_SALDC      NGVSKLSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADIGLN
YGCR_ECOLI      TQVERFTLDALFITLEQRTEHGLRCCRVRLPAVIAVEVALPVP---GMRQRMAAGKAEIIRKTV----AA


                         .         .         .         +         .         .         .:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLKNEAGVI
ETFB_BRAJA      VTARLEVLKTTEPAGRKAGVKVKDVAELVSKLKNEAGVL
ETFB_PSEAE      TASTVKTLKVEAPAARSAGIKVKSVAELVEKLKNEAKVI
ETFB_PARDE      VAPRLEVVSVREPEGRKAGIKVGSVDELVGKLK-EAGVI
ETFB_ARATH      IKSDIEILEVTEPPKRKSGVMVSSVDELIDKLKNEAHVV
ETFB_DICDI      TNCNLKIISVEEPPKRSGGVKVESVENVVEALKKHA---
ETFB_ORYSJ      IRSDMEVVEVTEPPKRKAGVILSSVDELVDRLKNEARVL
ETFB_MOUSE      LTSKVSVISVEEPPQRSAGVKVETTEDLVAKLK------
ETFB_RAT        LTSKVSVISVEEPPQRLAGVKVETTEDLVAKLK------
ETFB_BOVIN      LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK------
ETFB_ORYSI      IRSDMEVVEVTEPPKRKAGVILSSVDELIDRLKNEARVL
ETFB_PIG        LTSKLSVVSVEDPPQRVAGVKVETTEDLVAKLR------
ETFB_HUMAN      LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK------
ETFB_YEAST      IEPQLKIVSMEEPKTKSPGVKLNSVDELIEKLK------
ETFB_PONAB      LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK------
ETFB_SCHPO      IDQRLQTVSVSEPVQKRQNIMVKSVDEMVKTLK------
ETFB_CLOTS      KGSPTKVVATSTPNTERAGIFTGNIKEAVQNL-------
ETFB_BACSU      XXXXXXXXXTIEPPKKEAGEPAEQAKELVSLLRSEAKVI
ETFB_CLOAB      KA-------------------------------------
ETFB_MEGEL      GSP-TKVRKIFTPPQRSGGLVLK----------------
ETFB_MYCTU      NAGSTVLASTPKPA-KTAGEKVTDEGE------------
ETFB_MYCBO      NAGSTVLASTPKPA-KTAGEKVTDEGE------------
ETFB_MYCLE      VNAGSKVLVSTPKPAKTAGEKITD---------------
FIXA_RHISN      ---------------------------------------
FIXA_AZOVI      ---------------------------------------
FIXA_RHILP      ---------------------------------------
ETFB_METME      ---------------------------------------
FIXA_RHIME      ---------------------------------------
FIXA_AZOC5      ---------------------------------------
FIXA_BRAJA      ---------------------------------------
FIXA_ECOL6      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO45      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO27      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECOL5      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO81      AEAAWSEQQVAAPKQRE----------------------
FIXA_SHIFL      AVDAWSEQQVAAPKQRE----------------------
FIXA_SHIF8      AVDAWSEQQVAAPKQRE----------------------
FIXA_SALTY      SVPAYSAQQVAAPKQRE----------------------
FIXA_SALTI      SVPAYSTQQVAAPKQRE----------------------
FIXA_SALPK      SVPAYSTQQVAAPKQRE----------------------
FIXA_SALPB      SVPAYSAQQVAAPKQRE----------------------
FIXA_SALPA      SVPAYSTQQVAAPKQRE----------------------
FIXA_SALNS      SVPAYSAQQVAAPKQRE----------------------
FIXA_SALA4      SVPAYSAQQVAAPKQRE----------------------
FIXA_ECOSE      AVDAWSEQQVAAPKQRE----------------------
FIXA_ECOLU      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO8A      AVDAWSEQQVAAPKQRE----------------------
FIXA_ECO55      AVDAWSEQQVAAPKQRE----------------------
YDIQ_ECOLI      SAPLAELVGRVPPQTERKHIIIDNIAELAEHLK------
FIXA_ECOLI      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECOLC      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECOHS      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECODH      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECOBW      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO57      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO24      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECOSM      AEAAWSEQQVAAPKQRE----------------------
FIXA_ECO7I      AEAAWSEQQVAAPKQRE----------------------
FIXA_ESCF3      AVEAWSEQQVAAPKQRE----------------------
FIXA_SALG2      SVSAYSTQQVAAPKQRE----------------------
FIXA_SALDC      SVSAYSTQQVAAPKQRE----------------------
YGCR_ECOLI      EMPAMQCLQLARAEQRRGATLIQTVAEKAQKL-------