[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38253.1

[Show Plain Result]


## Summary of Sequence Search
    1::540
   28::362     2e-32  30%  554 aa  MHPA_ECO8A RecName:
   28::362     5e-32  30%  554 aa  MHPA_ECOSE RecName:
   28::362     5e-32  30%  554 aa  MHPA_ECOHS RecName:
   28::362     5e-32  30%  554 aa  MHPA_ECO24 RecName:
   28::362     1e-31  30%  554 aa  MHPA_ECOLI RecName:
   28::362     1e-31  30%  554 aa  MHPA_ECODH RecName:
   28::362     1e-31  30%  554 aa  MHPA_ECO5E RecName:
   28::362     1e-31  30%  554 aa  MHPA_ECO57 RecName:
   28::362     1e-31  30%  554 aa  MHPA_ECO55 RecName:
   28::362     1e-31  30%  554 aa  MHPA_SHISS RecName:
   28::362     2e-31  30%  554 aa  MHPA_KLEP3 RecName:
   28::362     2e-31  30%  554 aa  MHPA_ECOSM RecName:
   28::362     2e-31  30%  554 aa  MHPA_ECOLU RecName:
   28::362     2e-31  30%  554 aa  MHPA_ECO7I RecName:
   28::362     3e-31  29%  554 aa  MHPA_ECO81 RecName:
   28::362     2e-29  30%  554 aa  MHPA_KLEP7 RecName:
   19::356     4e-27  24%  562 aa  MHPA_MYCS2 RecName:
   26::362     1e-26  29%  589 aa  MHPA_COMTE RecName:
   31::368     5e-25  31%  622 aa  MHPA_BURXL RecName:
   25::372     9e-25  26%  580 aa  MHPA_MYCPA RecName:
   19::354     2e-24  27%  569 aa  MHPA_MYCGI RecName:
   31::368     3e-24  27%  618 aa  MHPA_RALEJ RecName:
   25::372     5e-24  26%  580 aa  MHPA_MYCA1 RecName:
   23::357     1e-23  27%  569 aa  MHPA_MYCVP RecName:
   31::339     1e-23  29%  542 aa  MHPA_BURCH RecName:
   31::339     1e-23  29%  542 aa  MHPA_BURCA RecName:
   27::368     4e-23  26%  538 aa  PCPB_SPHCR RecName: Full=Pentachlorophenol 4-monooxygenase;        
   29::364     4e-23  26%  573 aa  MHPA_MYCSS RecName:
   29::364     4e-23  26%  573 aa  MHPA_MYCSK RecName:
   24::358     5e-23  26%  568 aa  MHPA_MYCSJ RecName:
   38::373     8e-21  29%  615 aa  MHPA1_BURVG RecName:
  180::608     2e-18  36%  627 aa  HYDL_STRCO RecName: Full=Putative polyketide hydroxylase;       
  176::534     6e-18  38%  555 aa  HYDL_STRHA RecName: Full=Putative polyketide hydroxylase;       
   31::335     4e-17  27%  546 aa  MHPA2_BURVG RecName:
  195::405     1e-16  33%  665 aa  PH2M_TRICU RecName: Full=Phenol 2-monooxygenase;       
  327::538     2e-15  39%  572 aa  TCMG_STRGA RecName: Full=Tetracenomycin polyketide synthesis
  167::378     7e-14  29%  598 aa  TFDB_RALEJ RecName: Full=2,4-dichlorophenol 6-monooxygenase;       
  140::381     5e-12  26%  586 aa  TFDB_DELAC RecName: Full=2,4-dichlorophenol 6-monooxygenase;       
  196::396     1e-11  31%  607 aa  PHEA_PSEUE RecName: Full=Phenol 2-monooxygenase;       
   20::342     5e-10  27%  397 aa  3HBH_KLEOX RecName: Full=3-hydroxybenzoate 6-hydroxylase;       
  125::323     5e-07  26%  414 aa  Y1300_SYNY3 RecName: Full=Uncharacterized protein slr1300;
  119::310     6e-06  26%  392 aa  UBIH_ECOLI RecName: Full=2-octaprenyl-6-methoxyphenol hydroxylase; 
  118::347     2e-05  24%  391 aa  UBIF_ECOLI RecName:
  299::352     3e-05  41%  671 aa  TBUD_BURPI RecName: Full=Phenol 2-monooxygenase;       
  294::351     4e-05  38%  447 aa  KMO_GRAFK RecName: Full=Kynurenine 3-monooxygenase;       
  870::1082    1e-04  25% 1204 aa  KTU_DROWI RecName: Full=Protein kintoun;AltName: Full=PP1-interacting
  304::359     3e-04  41%  434 aa  NHG1_PSEPU RecName: Full=Salicylate hydroxylase;       
  137::334     5e-04  25%  385 aa  GGR2_METTH RecName: Full=Digeranylgeranylglycerophospholipid
    1::540

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
MHPA_ECO8A      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECOSE      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECOHS      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO24      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECOLI      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECODH      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO5E      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO57      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO55      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_SHISS      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_KLEP3      --------------------------------------LMMANYLGQMGISVLLVEKLDTLIDYPRAIGI
MHPA_ECOSM      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECOLU      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO7I      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_ECO81      --------------------------------------LMMANYLGQMGIDVLVVEKLDKLIDYPRAIGI
MHPA_KLEP7      --------------------------------------LMMANYLGQMGISVLVVEKLATLIDYPRAIGI
MHPA_MYCS2      --------------------------------------LTLANILGGQGVRTLIIEERETLIDYPRGVGL
MHPA_COMTE      --------------------------------------LTLANTLGMAGVRVIVAEKLPRIIDYPRAIGI
MHPA_BURXL      --------------------------------------LMIANYLGLQGVRVVVLEKLEQIIDYPRAIGL
MHPA_MYCPA      --------------------------------------LTLANILGLQGIRTVVVEERDTLIDYPRGVGL
MHPA_MYCGI      --------------------------------------LTLANILGLEGVRVLVVDERDKLIDYPRGVGL
MHPA_RALEJ      --------------------------------------LMIANILGLQGVRVTVVEKLDQLIDYPRAIGL
MHPA_MYCA1      --------------------------------------LTLANILGLQGIRTVVVEERDTLIDYPRGVGL
MHPA_MYCVP      --------------------------------------LTLANILGLQGVATLVVDERDTLIDYPRGVGL
MHPA_BURCH      ------------------------------------------------GVDTIVVERAPQIVEFPRAVGI
MHPA_BURCA      ------------------------------------------------GVDTIVVERAPQIVEFPRAVGI
PCPB_SPHCR      --------------------------------------LIAANELLRRGVSCRMIDRLPVAHQTSKSCTI
MHPA_MYCSS      --------------------------------------LTLANILGLQGVRTMIVEERATLIDYPRGVGL
MHPA_MYCSK      --------------------------------------LTLANILGLQGVRTMIVEERATLIDYPRGVGL
MHPA_MYCSJ      --------------------------------------LTLANILGLQGVRTMIVEERATLIDYPRGVGL
MHPA1_BURVG     --------------------------------------LMIANILGLQGVRVVVVEKLTQIIDYPRAIGL
HYDL_STRCO      ----------------------------------------------------------------------
HYDL_STRHA      ----------------------------------------------------------------------
MHPA2_BURVG     ------------------------------------------------GVDTVVVERAPQIVDFPRAVGI
PH2M_TRICU      ----------------------------------------------------------------------
TCMG_STRGA      ----------------------------------------------------------------------
TFDB_RALEJ      ----------------------------------------------------------------------
TFDB_DELAC      ----------------------------------------------------------------------
PHEA_PSEUE      ----------------------------------------------------------------------
3HBH_KLEOX      -----------------------------------------ALSLARQGIKVMLLEKAHEIGEIGAGIQL
Y1300_SYNY3     ----------------------------------------------------------------------
UBIH_ECOLI      ----------------------------------------------------------------------
UBIF_ECOLI      ----------------------------------------------------------------------
TBUD_BURPI      ----------------------------------------------------------------------
KMO_GRAFK       ----------------------------------------------------------------------
KTU_DROWI       ----------------------------------------------------------------------
NHG1_PSEPU      ----------------------------------------------------------------------
GGR2_METTH      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
MHPA_ECO8A      DDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECOSE      DDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECOHS      DDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECO24      DDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECOLI      DDEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGVSR
MHPA_ECODH      DDEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGVSR
MHPA_ECO5E      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGVSR
MHPA_ECO57      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGVSR
MHPA_ECO55      DDEALRTMQSVGLVDDVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGVSR
MHPA_SHISS      DDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_KLEP3      DDESLRAMQAVGLVNDVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMYHGLQR
MHPA_ECOSM      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECOLU      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECO7I      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_ECO81      DDEALRTMQSVGLVDNVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMLEGLSR
MHPA_KLEP7      DDESLRAMQAVGLVNDVLPHTTPWHAMRFLTPKGRCFA-DIQPMTDERRNAFIQPQ---VDAVMYHGLQR
MHPA_MYCS2      DDESLRTFQSIGLVDAILPHTVPNQILRFYDANRRLLAEMAPPDARFGWPKRNGFVQPMVDAELLAGLDR
MHPA_COMTE      DDESLRTLQAAGLSDQVQAHITPHHWMRFYTASGQCFA-SIEPRTDERRNAFIQPQ---VDDILYRGLQR
MHPA_BURXL      DDEALRVFQSVGLADVLLPHTTVTHTGHCFRTDEFGWS---------RRNAFI---QPLADRVLYEGLRR
MHPA_MYCPA      DDEALRTFQSIGLVERVLPHTVPNQILRFMDAKRRVLAEMAPPDARFGWPKRNGFVQPLVDAELLAGLDR
MHPA_MYCGI      DDESLRTFQAIGLVDRVLPHTVPNQILRFFDAKRNLLAEMAPPDARFGWPKRNGFVQPMVDAELFGGLQR
MHPA_RALEJ      DDEALRVFQAIGLADTLLPHTTPDHWMRFVTKDGHCFA-SIEPRTDERRNAFI---QPLADRVLFEGLQR
MHPA_MYCA1      DDEALRTFQSIGLVERVLPHTVPNQILRFMDAKRRVLAEMAPPDARFGWPKRNGFVQPLVDAELLAGLDR
MHPA_MYCVP      DDESLRTFQAIGLVERVLPHTVPNQILRFFDADRRLLAEMAPPDARFGWPKRNGFVQPLVDAELFGGLER
MHPA_BURCH      DDEALRLFQTAGL-ADELSRDIIQNVPRMFKANGECFA-DIRPSIREFGWWRRNIMQHLAERTLRDALAR
MHPA_BURCA      DDEALRLFQTAGL-ADELSRDIIQNVPRMFKANGECFA-DIRPSIREFGWWRRNIMQHLAERTLRDALAR
PCPB_SPHCR      HARSMEMMEHIGIAARYIETGVRSN-GFTFNFENTLLDFSVLPG---RYPFITIYNQNETERVLRHDLEA
MHPA_MYCSS      DDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPKRNGFVQPMVDAELHAGLAR
MHPA_MYCSK      DDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPKRNGFVQPMVDAELHAGLAR
MHPA_MYCSJ      DDEALRTFQAIGLVDKVLPHTVPNQILRFFDGNRRLLAEMAPPDARFGWPKRNGFVQPMVDAELHAGLAR
MHPA1_BURVG     DDEALRVFQSVGLAEALLPHTTPWMRGKCFASIE--------PRTDERRNAFI---QPLADQILYRGLER
HYDL_STRCO      ----------------------------------------------------------------------
HYDL_STRHA      ----------------------------------------------------------------------
MHPA2_BURVG     DDEALRLFQTAGV-ADELSRDIIQNVPRMFNARGECFA-DVRPSVREFGWWRRNIMQHLAERTLRDALAR
PH2M_TRICU      ----------------------------------------------------------------------
TCMG_STRGA      ----------------------------------------------------------------------
TFDB_RALEJ      ----------------------------------------------------------------------
TFDB_DELAC      ----------------------------------------------------------------------
PHEA_PSEUE      ----------------------------------------------------------------------
3HBH_KLEOX      GPNAFSALDSLGVGEVARQRAVF--TDHITMMDAVNGEEVVHIETGHFGGPYAVIHRVDIHATVWEAALT
Y1300_SYNY3     -------------------------------------------------------------------VEQ
UBIH_ECOLI      -------------------------------------------------------------------LRK
UBIF_ECOLI      ---------------------------------------------------------------LWQALEA
TBUD_BURPI      ----------------------------------------------------------------------
KMO_GRAFK       ----------------------------------------------------------------------
KTU_DROWI       --------------------------------------------------------------------KQ
NHG1_PSEPU      ----------------------------------------------------------------------
GGR2_METTH      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
MHPA_ECO8A      FPNVRCLFARELEAFSQQNDEVTLHLKTAEGQREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECOSE      FPNVRCLFARELEAFSQQNDEVTLHLKTAEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECOHS      FPNVRCLFARELEAFSQQNDEVTLHLKTAEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO24      FPNVRCLFARELEAFSQQNDEVTLHLKTAEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECOLI      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECODH      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO5E      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGLREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO57      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGLREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO55      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_SHISS      FPNVRCLFSRELEAFSQQDDEVTLHLKTAEGQREIKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_KLEP3      FPQVRCLFSREVEAFSQNGDGVTLNLKGPDGEREVRADWLVACDGGASFIRRTLNVPFEGKTAPNQWIVI
MHPA_ECOSM      FPNVRCLFSRELEAFSQQDDEVTLHLKTEEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECOLU      FPNVRCLFSRELEAFSQQDDEVTLHLKTEEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO7I      FPNVRCLFSRELEAFSQQDDEVTLHLKTEEGQREVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_ECO81      FPNVRCLFSRELEAFSQQDDEVTVHLKTAEGQREIVAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVV
MHPA_KLEP7      FPQVRCLFSREVGAFSQTGDSVTLNLKGPDGEREVRADWLVACDGGASFIRRTLNIPFEGKTAPNQWIVI
MHPA_MYCS2      FDHVEVMWGRRMQTIAEDADGVTVEVSGPDGPASVHAQYVVGCDGGRSATRHLMGVSFDGTTSSTRWVVI
MHPA_COMTE      FDQVQVLLGHELHSFSQDDAGITATLKDADGVERLRAKYLVASDGGNSLVRRMLNVAFEGRTKPNQWIVV
MHPA_BURXL      FPHVQVLFGTSVSGFTQ--DPAGVTIEADDGRRTVRASYMVGADGGNSFVRRLLDVPFEGRTKPNQWIVV
MHPA_MYCPA      FAHVQVRWGSPMTGCREDADGVNVELXXXXXXXRLRARYVVGCDGGRSMTRRVMGVSFDGTTSSTRWLVV
MHPA_MYCGI      FDNVEVRFGHRMHQCTQTTDR--VEVEFDGGQASVSARYVVGCDGGRSVTRRLMGVSFDGTTSSTRWLVV
MHPA_RALEJ      FEHVQVLFGHGVEAFTQDGHGVSVEVTTSAGRRRIRAAYMVGADGGNSIVRRALQVPFEGRTKPNQWIVV
MHPA_MYCA1      FAHVQVRWGSPMTGCREDADGVNVELXXXXXXXXLRARYVVGCDGGRSMTRRVMGVSFDGTTSSTRWLVV
MHPA_MYCVP      FDHVEVRFDHRMQSCSETAGGVTVTFDGDRDPVR--ARYVVGCDGGRSTTRRQMGVSFDGTTSSTRWLVV
MHPA_BURCH      YPHVSLRTGEEVVGLEQDDECVTLQVRAADGQYELDADYVVAADGGRSPVREMLGIRLAGTTHPMKWVVV
MHPA_BURCA      YPHVSLRTGEEVVGLEQDDECVTLQVRAADGQYELDADYVVAADGGRSPVREMLGIRLAGTTHPMKWVVV
PCPB_SPHCR      TYSFQPEWGTQLLALNQDENGIRADLRLKDGTKQISPRWVIGADGVRSRVRECLGIAYEGEDYEENVLMM
MHPA_MYCSS      FPHVEVRWGHRMAECEETADGVTVRLDGDPTPVR--ARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVV
MHPA_MYCSK      FPHVEVRWGHRMAECEETADGVTVRLDGDPTPVR--ARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVV
MHPA_MYCSJ      FPHVEVRWGHRMAECEETADGVTVRLDGDPTPVR--ARYLVGCDGGRSATRRLMGVSFDGTTSPTRWLVV
MHPA1_BURVG     FDHVSTLLGHNVDRFAQ--DESGVTIDATDAHTTIRAAYMVGADGGNSFVRRTLDVPFEGRTKPNQWIVI
HYDL_STRCO      ----------------------------------IRADYLVAADGPRSPVREQIGQSGPGDLFHNVSITF
HYDL_STRHA      ------------------------------------ADYLVAADGPRSPVREQIGQSGPGDLFHNVSVTF
MHPA2_BURVG     YPHVSLRTGEEVVGLEQDDAHVTLRVQGADGQHXXXXXXXXXXXGGRSPLREMLGIPLAGTTHPMKWVVV
PH2M_TRICU      ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
TCMG_STRGA      ----------------------------------------------------------------------
TFDB_RALEJ      --------------------------------FTVRSKYLIGADGANSRVVSDLDLPLEGTMGKNLLFEA
TFDB_DELAC      ----DVRFHTEFVSLKQDETGVTATVRDHDRQYDIRAKYLIGADGANSQVVDQVGLPMEGKVFEADL---
PHEA_PSEUE      --------------------------------YTIRAKYLIGADGARSKVAADIGGSFKADLSHDPVLGL
3HBH_KLEOX      HPAVEYRTSTQVVDIRQTADDVTV---FDDKGNSWTADILIGCDGGKSVVRRVTGHVVYRAVVDAADMPD
Y1300_SYNY3     CPRIAWFRPAELISFTAGENHKQVTLQQEGREITLQTKLLVAADGARSHTRSLAGIQTKGWKYWQSCVAF
UBIH_ECOLI      APGVTLHCPDRVANVARTQSHVEVTLESGE---TLTGRVLVAADGTHSALATACGVDWQQEPYEQLAVIA
UBIF_ECOLI      HPKVTLRVPGSLIALHRHDDLQELELK---GGEVIRAKLVIGADGANSQVRQMAGIGVHAWQYAQSCMLI
TBUD_BURPI      ----------------------------------------------------------------------
KMO_GRAFK       ----------------------------------------------------------------------
KTU_DROWI       LNELLLNACDKFPNIKCHFDHKLTKANVKEGQLKAKADLIVGCDGAFSALRQLPGFNYTQEYIETGYLLC
NHG1_PSEPU      ----------------------------------------------------------------------
GGR2_METTH      ----------------------------PDGVQEVECGMVIAADGVQSSIARKAGLETGFRPADVQYEVA


                         .         .         .         +         .         .         .:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
MHPA_ECO8A      DIA-NDPLSTPHIYLCGDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECOSE      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECOHS      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO24      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECOLI      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECODH      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO5E      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO57      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO55      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_SHISS      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_KLEP3      DIA-NDPLATPHVYLCCDPVRPYVSAAL---PHGVRRFEFMVMPGETEAQLSEPHNMRRLLSKVLPDPD-
MHPA_ECOSM      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECOLU      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO7I      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_ECO81      DIA-NDPLSTPHIYLCCDPVRPYVSAAL---PHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPD-
MHPA_KLEP7      DIA-NDPLATPHVYLCCDPVRPYVSAAL---PHGVRRFEFMVMPGETEAQLSEPHNMRRLLSKVLPDPD-
MHPA_MYCS2      DLANDPLGHPNSEVGADPQRPYASISIAH----GIRRFEFMIHADETDEQAEDPEFVAELLRPFVPHPDV
MHPA_COMTE      DVR-NDPLGTPHIDMHCDPQRPYVSAAL---PHGIRRFEFMVMPGETEEQLSRPENLAQLMRKVVADPD-
MHPA_BURXL      DVRNDPIGSPHIYMHCDPQRPYVSAAL----PHGIRRFEFMVMPGETEEELSKPENMAALIRKVVADPQ-
MHPA_MYCPA      DIANDPLGHPNSEVGADPERPYASISIAH----GIRRFEFMIHADESDEQAEDPEFLTRMLARMVPHPDV
MHPA_MYCGI      DIANDPLGHPNSEVGADPRRPYVSIAIAH----GIRRFEFMIHXXXXXXXXXXXXFVR----RMLGQLIP
MHPA_RALEJ      DVRNDPVGSPHIYMHCDHERPYVSAAL----PHGIRRFEFMVMPGETEEELSKPENMAALIRKVVADPD-
MHPA_MYCA1      DIANDPLGHPNSEVGADPERPYASISIAH----GIRRFEFMIHADESDEQAEDPEFLTRMLARMVPHPDV
MHPA_MYCVP      DVANDPLGHPNSEVGADPARPYVSISIAH----GIRRFEFMIHPDETDEQADDPAFVR----RMLGQRVP
MHPA_BURCH      DVK-NARLDQPCTALNCDPRRPNVCIYL---PFNYRRWEFLVFPHEDEEAIAQPESIRALIAPYVDDVDI
MHPA_BURCA      DVK-NARLDQPCTALNCDPRRPNVCIYL---PFNYRRWEFLVFPHEDEEAIAQPESIRALIAPYVDDVDI
PCPB_SPHCR      DVGIQDFEAGDDWIHYF--IGQDKFVFVTKLPGSNYRV---IISDLGGANKSNLEETREAFQGYLSSFDD
MHPA_MYCSS      DIANDPLGHPNSEVGADPARPYASISIAH----GIRRFEFMIHADETDEQAEDPAF----IHRMLGLLVP
MHPA_MYCSK      DIANDPLGHPNSEVGADPARPYASISIAH----GIRRFEFMIHADETDEQAEDPAF----IHRMLGLLVP
MHPA_MYCSJ      DIANDPLGHPNSEVGADPARPYASISIAH----GIRRFEFMIHADETDEQAEDPAF----IHRMLGLLVP
MHPA1_BURVG     DVRNDPIGSPHVYLHCDARRPYVSAAL----PHGIRRFEFMVMPGETEEELSKPENMAALVRGVVDDPD-
HYDL_STRCO      RSRRLADVVGDRRFIVCYTDENADGALLPVDNRENWVFHAPWHPEQGETVEDFTERCAAHIRRAIGDPDL
HYDL_STRHA      RSRRLAEFVGDRHFYLTNPEADG--ALLPVDNRENWVFHAPWYPRAARPLEDFTERCADHIRRAVGVPDL
MHPA2_BURVG     DVK-NAGLDQPCTALNCDPRRPNVCIYL---PFNYRRWEFLVFPHEDEQAIAQPESIRALIAPYVEDVEL
PH2M_TRICU      DAVPASNFPDIRSPCAIHSAESGSIMIIPRENNLVFYVQLQARAEKGGRVDRTPEVVIANAKKIFHPYTF
TCMG_STRGA      ----------------------------------------------------------------------
TFDB_RALEJ      DLRYVAHRPSVLYWVIQPGSDIGGLGIGVVRMVRPWNKWLAIGYDVEQGPPEISESFARRIVHNLIGDDL
TFDB_DELAC      -TKYVGHRPSVLYWVIQPXXXXXXXXXXXXRMVRPWNKWLCIGYDIAGGPPDLNEHARQIVHSLLGDSTI
PHEA_PSEUE      PPRIEYRWPRR---WFDRMV----------RPWNEWLVVW--GFDINQEPPKLNDDEAIQIVRLVGIEDL
3HBH_KLEOX      DLRINAPV-----LWAGPPLRGGKQVTFHSRQQEEWGV-------RDGSKEEVLKGIHPRPRQMLDKPTS
Y1300_SYNY3     TIQHQAPDNTTAFERFCDTGPMGILPLPGDRAQIVWTMPHHKAH----TLVNLPEELRQRIGDRLGE---
UBIH_ECOLI      NVATSVAHAFERFTQHGPPMSDGRCSLVWCHP-----------------LERREEVLSWSDEKFCRELQS
UBIF_ECOLI      SVQCENDPGDSTWQQFTPDGPRAFLPLFDNWASLVWY-------DSPARIRQLQNMNMAQLQAEIAKHFP
TBUD_BURPI      ----------------------------------------------------------------------
KMO_GRAFK       ----------------------------------------------------------------------
KTU_DROWI       IPAKKNEFQMPPNYLHIWPRDNFMMIALPNQ-DKSFTVTLSMPFDIFASIKNPEELIQPDALPLIGKEQL
NHG1_PSEPU      ----------------------------------------------------------------------
GGR2_METTH      GVDVD---PETMEFYFGSRF--APSGYLWVFPKGEGRANVGLGIRRKSCSERGPLSYLNRFERGFKRIEF


                         .         *         .         .         .         .         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
MHPA_ECO8A      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECOSE      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECOHS      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO24      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECOLI      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECODH      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO5E      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO57      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO55      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_SHISS      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_KLEP3      RVELIRVYTHNARLAERFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVVNGKAGEALLDS
MHPA_ECOSM      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECOLU      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO7I      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_ECO81      NVELIRVYTHNARLAQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDALLDT
MHPA_KLEP7      RVELIRVYTHNARLAERFRINRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVVNGKAGEALLDS
MHPA_MYCS2      DVIRRRVYTHHSRIAGSFRKGRMLLAGDAAHLMPVWQGQGYNSGIRDAFNLGWKLAAVVRGQAGDALLDT
MHPA_COMTE      KVDYIRVYTHNARLAAQFRVDRILLAGDAAHIMPVWQGQGYNSGMRDASNLAWKLAMVVKGEARSDLLDS
MHPA_BURXL      KVDYIRVYTHNARLASTFRVDRVLLAGDAAHIMPVWQGQGYNSGIRDASNLGWKLAMVVKQLAGDALLDT
MHPA_MYCPA      DVIRRRVYTHHSRIAGEFRRGRLLLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVSGRAGDKLLDT
MHPA_MYCGI      YPERVDVYTHHSRIAGSFREGRLMLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVTGRAGEELLDT
MHPA_RALEJ      KVDYIRVYTHNARLASTFRVDRVLLAGDAAHIMPVWQGQGYNSGIRDANNLGWKLAMVAKGLADGRLLDT
MHPA_MYCA1      DVIRRRVYTHHSRIAGEFRRGRLLLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVSGRAGDKLLDT
MHPA_MYCVP      YPERVDIYTHHSRIAGSFRKGRLMLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVNGQADDALLDT
MHPA_BURCH      EIVRARTYTHHSRVAERFVAGRVALIGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGVVNGTLHRRVIST
MHPA_BURCA      EIVRARTYTHHSRVAERFVAGRVALIGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGVVNGTLHRRVIST
PCPB_SPHCR      HARWATKWRVWKRMATAYRKGNVFLAGDAAHCHSPSGGSGMNVGMQDAFNLGWKIAMVERGEAKPDLLDT
MHPA_MYCSS      HPERVEVYTHHSRIAGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDT
MHPA_MYCSK      HPERVEVYTHHSRIAGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDT
MHPA_MYCSJ      HPERVEVYTHHSRIAGAFRKGRMFLAGDAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVDGRAGDALLDT
MHPA1_BURVG     KVDYIRVYTHNARLASVFRVKRILLAGDAAHIMPVWQGQGYNSGIRDASNLGWKLAMVVKGTARDALLDT
HYDL_STRCO      DVEITGKAPWHARVARSYRSGRVLLAGDSAHEMSPTGAFGSNTGIQDAHNLAWKLAAVLEGWAGEALLDT
HYDL_STRHA      DVEITGKAPWHARVARQYRAGRVFLAGDSAHEMSPTGAFGSNTGIQDAHNLAWKLAAVLGGWAGDGLLDT
MHPA2_BURVG     EIVRARTYTHHSRVAERFVAGRIALVGDAAHLSPPWIGQGLNAGLRDVGNLAWKLAGIVHGRLNPGVLAT
PH2M_TRICU      DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
TCMG_STRGA      ---------------------RVFLAGDAAHVHPPAGAFGANGGIQDAHNLAWKLAAVLKGTAGDALLDT
TFDB_RALEJ      KIEGISTWTVNDMYATRLQQGRVFCAGDAVHRHPPTNGLGSNTSIQDSFNLAWKIAMVLNGTADESLLDT
TFDB_DELAC      KIESTSTWTVNDMYATRLFDNRVFCMGDAVHRHPPTNGLGSNTSIQDAFNLCWKLSHVLQGKAGPELLAT
PHEA_PSEUE      DVEILG-YSLWGNNDQYATHGRVCCAGDAIHKHPPSHGLGSNTSIQDSYNLCWKLACVLKGQAGPELLET
3HBH_KLEOX      WRRWSTADR---EPVEKWGNDRITLVGDAAHPVAQYMAQGACMALEDAVTLGKALAQ-CDGDAARALYES
Y1300_SYNY3     -FHLINLFPVQLMQSDCYVQPRLALVGDAAHCCHPVGGQGLNLGIRDGAALAQVIA--------------
UBIH_ECOLI      AFGWRSAYPLALTHAARSITHRTVLVGNAAQTLHPIAGQGFNLGMRDVMSLA------------------
UBIF_ECOLI      SLGYVTAFPLTRRHALQYVQPGLALVGDAAHTIHPLAGQGVNLGYRDVDALIDVLVNARSGEAWASVLKR
TBUD_BURPI      ---------------------RVFLAGDARHRHPPLTGIGKNTSIADCYNLTWKLLGVLLGVARADPART
KMO_GRAFK       --------------------DKITLVGDSAHAIVPFYGQGMNAGFEDISVLNEK--MNLYGDDWEKVFED
KTU_DROWI       IKDFFKLLSIKCRPYH--YENKALLLGDAAHAMVPYYGQGMNAGMED-----------------------
NHG1_PSEPU      -----------------YVHGRVVLIGDAAHAMLPHQGAGAGQGLEDAYFLA-RLLGDTQADAGAELLEA
GGR2_METTH      NAGAVPV----CGPIERTFTDGLLVVGDAAGQVDPLTGGGIHLAAECAK-IAGEVAAIESGRVDGRFLSR


                         .         .         .         .         *         .         .:420
query           YEIERSQAADDNIRHSTRSTDFIAPHSKQEXXXXXXXXXXXXXXEFAKRMVNAGRLSTPTAYDTPLSTPD
MHPA_ECO8A      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECOSE      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECOHS      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO24      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECOLI      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECODH      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO5E      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO57      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO55      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_SHISS      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_KLEP3      YQQERRDHAKAMIDLSVTAGHVLAP---------------------------------------------
MHPA_ECOSM      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECOLU      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO7I      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_ECO81      YQQERRDHAKAMIDLSVTAGNVLAP---------------------------------------------
MHPA_KLEP7      YQQERRDHAKAMIDLSVTAGHVLAP---------------------------------------------
MHPA_MYCS2      YDAERRKHARAMIDLSTMVGRVISPTNRK-----------------------------------------
MHPA_COMTE      YEQERRDHARSMIHLSEVAGDIFAPES-------------------------------------------
MHPA_BURXL      YTAERRAHARSMIHLSEVAGDIFAPTSR------------------------------------------
MHPA_MYCPA      YDMERRKHARAMIDLSTMVGRVISPTNRR-----------------------------------------
MHPA_MYCGI      YDVERRKHARAMIDLSTMVGRVISPTNRK-----------------------------------------
MHPA_RALEJ      YTAERRAHARSMIHLSEVAGDIFAPNTR------------------------------------------
MHPA_MYCA1      YDMERRKHARAMIDLSTMVGRVISPTNRR-----------------------------------------
MHPA_MYCVP      YDLERRKHARAMIDLSTMVGKVISPTNR------------------------------------------
MHPA_BURCH      YESERRDHA-------------------------------------------------------------
MHPA_BURCA      YESERRDHA-------------------------------------------------------------
PCPB_SPHCR      YHTERTPVAQQLLEGTHAMHEIIMGHGK------------------------------------------
MHPA_MYCSS      YDVERRKHARAMIDLSTMVGRVISPTNRR-----------------------------------------
MHPA_MYCSK      YDVERRKHARAMIDLSTMVGRVISPTNRR-----------------------------------------
MHPA_MYCSJ      YDVERRKHARAMIDLSTMVGRVISPTNR------------------------------------------
MHPA1_BURVG     YTMERRAHARSMIHLSEVAGDIFAPTS-------------------------------------------
HYDL_STRCO      YDTERRPVAE------------------------------------------------------------
HYDL_STRHA      YDAER-----------------------------------------------------------------
MHPA2_BURVG     YESER-----------------------------------------------------------------
PH2M_TRICU      YEEER-----------------------------------------------------------------
TCMG_STRGA      YEQERAAVADQAIRHTWRLND---------------------SEELRRALRESTLVATGYRY-----TSD
TFDB_RALEJ      YTIERAPIAKQVVCRANKSLEDFPP---------------------------------------------
TFDB_DELAC      YNEERAPVARQVVQRANKSLGDFPP---------------------------------------------
PHEA_PSEUE      YSTERAPIAKQIVTRANGSSSEYKP---------------------------------------------
3HBH_KLEOX      VRIPRT----------------------------------------------------------------
Y1300_SYNY3     ----------------------------------------------------------------------
UBIH_ECOLI      ----------------------------------------------------------------------
UBIF_ECOLI      YQMRR--MADNFIMQS------------------------------------------------------
TBUD_BURPI      YVAER-----------------------------------------------------------------
KMO_GRAFK       YQTERKPNAD------------------------------------------------------------
KTU_DROWI       ----------------------------------------------------------------------
NHG1_PSEPU      YD--------------------------------------------------------------------
GGR2_METTH      YEMRWRKKIGKNLERSLK----------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADAWSAGPKXXXXXXXXXXXXXXXXPVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSLRIGKDAPLRD
MHPA_ECO8A      ----------------------------------------------------------------------
MHPA_ECOSE      ----------------------------------------------------------------------
MHPA_ECOHS      ----------------------------------------------------------------------
MHPA_ECO24      ----------------------------------------------------------------------
MHPA_ECOLI      ----------------------------------------------------------------------
MHPA_ECODH      ----------------------------------------------------------------------
MHPA_ECO5E      ----------------------------------------------------------------------
MHPA_ECO57      ----------------------------------------------------------------------
MHPA_ECO55      ----------------------------------------------------------------------
MHPA_SHISS      ----------------------------------------------------------------------
MHPA_KLEP3      ----------------------------------------------------------------------
MHPA_ECOSM      ----------------------------------------------------------------------
MHPA_ECOLU      ----------------------------------------------------------------------
MHPA_ECO7I      ----------------------------------------------------------------------
MHPA_ECO81      ----------------------------------------------------------------------
MHPA_KLEP7      ----------------------------------------------------------------------
MHPA_MYCS2      ----------------------------------------------------------------------
MHPA_COMTE      ----------------------------------------------------------------------
MHPA_BURXL      ----------------------------------------------------------------------
MHPA_MYCPA      ----------------------------------------------------------------------
MHPA_MYCGI      ----------------------------------------------------------------------
MHPA_RALEJ      ----------------------------------------------------------------------
MHPA_MYCA1      ----------------------------------------------------------------------
MHPA_MYCVP      ----------------------------------------------------------------------
MHPA_BURCH      ----------------------------------------------------------------------
MHPA_BURCA      ----------------------------------------------------------------------
PCPB_SPHCR      ----------------------------------------------------------------------
MHPA_MYCSS      ----------------------------------------------------------------------
MHPA_MYCSK      ----------------------------------------------------------------------
MHPA_MYCSJ      ----------------------------------------------------------------------
MHPA1_BURVG     ----------------------------------------------------------------------
HYDL_STRCO      --------------------------VLLSDAAQPTGWH----EAAAGVAAGMRVPLKSYRVGADLNPDD
HYDL_STRHA      -------------------------PVLLSDA--DAGAPDAWHESAVRLAEELSVPLTSYRVGRSADLTP
MHPA2_BURVG     ----------------------------------------------------------------------
PH2M_TRICU      ----------------------------------------------------------------------
TCMG_STRGA      AVLGAAYPEPIPAAHDLTGRPGYRVPVWLVSTVDLGGDAFVVLAGPDGAADKVAQDVHCHPVGGDGQLTD
TFDB_RALEJ      ----------------------------------------------------------------------
TFDB_DELAC      ----------------------------------------------------------------------
PHEA_PSEUE      ----------------------------------------------------------------------
3HBH_KLEOX      ----------------------------------------------------------------------
Y1300_SYNY3     ----------------------------------------------------------------------
UBIH_ECOLI      ----------------------------------------------------------------------
UBIF_ECOLI      ----------------------------------------------------------------------
TBUD_BURPI      ----------------------------------------------------------------------
KMO_GRAFK       ----------------------------------------------------------------------
KTU_DROWI       ----------------------------------------------------------------------
NHG1_PSEPU      ----------------------------------------------------------------------
GGR2_METTH      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARFRHPxxxxxxxxxxxxxxxxxx
MHPA_ECO8A      --------------------------------------------------
MHPA_ECOSE      --------------------------------------------------
MHPA_ECOHS      --------------------------------------------------
MHPA_ECO24      --------------------------------------------------
MHPA_ECOLI      --------------------------------------------------
MHPA_ECODH      --------------------------------------------------
MHPA_ECO5E      --------------------------------------------------
MHPA_ECO57      --------------------------------------------------
MHPA_ECO55      --------------------------------------------------
MHPA_SHISS      --------------------------------------------------
MHPA_KLEP3      --------------------------------------------------
MHPA_ECOSM      --------------------------------------------------
MHPA_ECOLU      --------------------------------------------------
MHPA_ECO7I      --------------------------------------------------
MHPA_ECO81      --------------------------------------------------
MHPA_KLEP7      --------------------------------------------------
MHPA_MYCS2      --------------------------------------------------
MHPA_COMTE      --------------------------------------------------
MHPA_BURXL      --------------------------------------------------
MHPA_MYCPA      --------------------------------------------------
MHPA_MYCGI      --------------------------------------------------
MHPA_RALEJ      --------------------------------------------------
MHPA_MYCA1      --------------------------------------------------
MHPA_MYCVP      --------------------------------------------------
MHPA_BURCH      --------------------------------------------------
MHPA_BURCA      --------------------------------------------------
PCPB_SPHCR      --------------------------------------------------
MHPA_MYCSS      --------------------------------------------------
MHPA_MYCSK      --------------------------------------------------
MHPA_MYCSJ      --------------------------------------------------
MHPA1_BURVG     --------------------------------------------------
HYDL_STRCO      EETDWARAHGVTRGGAVLVRPDGFVAWRSPGP------------------
HYDL_STRHA      EDDVWTARHGTPPGGAVLVRPDGFVAWRSQEP------------------
MHPA2_BURVG     --------------------------------------------------
PH2M_TRICU      --------------------------------------------------
TCMG_STRGA      PDGAFLGTTGLTRNGALLIRPDGFVAWR----------------------
TFDB_RALEJ      --------------------------------------------------
TFDB_DELAC      --------------------------------------------------
PHEA_PSEUE      --------------------------------------------------
3HBH_KLEOX      --------------------------------------------------
Y1300_SYNY3     --------------------------------------------------
UBIH_ECOLI      --------------------------------------------------
UBIF_ECOLI      --------------------------------------------------
TBUD_BURPI      --------------------------------------------------
KMO_GRAFK       --------------------------------------------------
KTU_DROWI       --------------------------------------------------
NHG1_PSEPU      --------------------------------------------------
GGR2_METTH      --------------------------------------------------