[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38261.1

[Show Plain Result]


## Summary of Sequence Search
    1::781
   18::799     e-128  40%  809 aa  DCML_OLICO RecName: Full=Carbon monoxide dehydrogenase large chain;
   13::796     e-126  39%  803 aa  DCML_HYDPS RecName: Full=Carbon monoxide dehydrogenase large chain;
   24::758     1e-56  30%  769 aa  HCRA_THAAR RecName: Full=4-hydroxybenzoyl-CoA reductase subunit
    9::747     2e-52  27%  752 aa  XDHA_ECOLI RecName: Full=Xanthine dehydrogenase molybdenum-binding
    9::747     1e-51  27%  752 aa  XDHA_ECO57 RecName: Full=Xanthine dehydrogenase molybdenum-binding
    7::736     3e-44  29%  745 aa  XDHD_BACSU RecName: Full=Probable xanthine dehydrogenase subunit D;
  580::1311    1e-36  27% 1338 aa  ADO_HUMAN RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;
  580::1307    1e-35  27% 1334 aa  ADO_RABIT RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;AltName:
  169::234     8e-35  27%  956 aa  XDHD_ECO57 RecName: Full=Probable hypoxanthine oxidase xdhD;       
  169::234     1e-34  27%  956 aa  XDHD_ECOLI RecName: Full=Probable hypoxanthine oxidase xdhD;       
  580::1312    1e-34  26% 1339 aa  ADO_BOVIN RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;
  580::1311    1e-33  26% 1338 aa  ADO_MACFA RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;
  579::1306    3e-33  26% 1333 aa  ADO_RAT RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;
  587::1308    2e-29  26% 1332 aa  XDH_BOVIN RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  579::1306    5e-29  26% 1333 aa  ADO_MOUSE RecName: Full=Aldehyde oxidase;         EC=1.2.3.1;AltName:
  586::1307    1e-27  26% 1331 aa  XDH_FELCA RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  593::1326    2e-27  28% 1353 aa  XDH_CALVI RecName: Full=Xanthine dehydrogenase;         Short=XD;    
  602::1334    2e-26  25% 1358 aa  XDH_CHICK RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  590::1311    7e-26  25% 1335 aa  XDH_MOUSE RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  588::1309    9e-26  26% 1333 aa  XDH_HUMAN RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  626::1343    2e-25  26% 1358 aa  XDH_DICDI RecName: Full=Xanthine dehydrogenase;         Short=XD;    
   50::720     1e-24  25%  732 aa  YAGR_ECO57 RecName: Full=Putative xanthine dehydrogenase yagR
  615::1336    1e-24  24% 1363 aa  XDH_EMENI RecName: Full=Xanthine dehydrogenase;       
  602::1261    1e-24  26% 1358 aa  ALDO1_ORYSJ RecName: Full=Probable aldehyde oxidase 1;       
   32::720     4e-24  25%  732 aa  YAGR_ECOLI RecName: Full=Putative xanthine dehydrogenase yagR
  587::1307    9e-24  25% 1331 aa  XDH_RAT RecName: Full=Xanthine dehydrogenase/oxidase;Includes:
  584::1257    1e-23  26% 1344 aa  XDH_DROSU RecName: Full=Xanthine dehydrogenase;         Short=XD;    
  575::1248    1e-22  26% 1335 aa  XDH_DROME RecName: Full=Xanthine dehydrogenase;         Short=XD;    
  583::1256    3e-22  27% 1343 aa  XDH_DROPS RecName: Full=Xanthine dehydrogenase;         Short=XD;    
  565::1288    3e-16  29% 1332 aa  ALDO3_ARATH RecName: Full=Abscisic-aldehyde oxidase;       
  610::1266    4e-16  29% 1356 aa  ALDO3_ORYSJ RecName: Full=Probable aldehyde oxidase 3;       
  189::905     5e-16  28%  907 aa  MOP_DESGI RecName: Full=Aldehyde oxidoreductase;       
  609::1265    2e-15  29% 1355 aa  ALDO2_ORYSJ RecName: Full=Probable aldehyde oxidase 2;       
  567::1240    1e-13  27% 1337 aa  ALDO4_ARATH RecName: Full=Aldehyde oxidase 4;         Short=AO-4;  
  355::769     9e-13  30%  781 aa  IORB_BREDI RecName: Full=Isoquinoline 1-oxidoreductase subunit
  611::1271    9e-13  26% 1368 aa  ALDO1_ARATH RecName: Full=Aldehyde oxidase 1;         Short=AO-1;  
  584::1277    2e-12  29% 1342 aa  ALDOL_ORYSJ RecName: Full=Putative aldehyde oxidase-like protein;
 1144::1224    5e-11  38% 1321 aa  ALDO2_ARATH RecName: Full=Aldehyde oxidase 2;         Short=AO-2;    
  640::763     4e-06  27%  773 aa  DHAQ_ACEPO RecName: Full=Membrane-bound aldehyde dehydrogenase
  272::350     6e-04  29%  735 aa  DHB4_RAT RecName: Full=Peroxisomal multifunctional enzyme type 2;  
    1::781

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGIEGIGASVVRKEDRRFITGKGRYVDDIKILGMTYAHFVRSPHAHAKIKNIDVEAAKAMPGVVDVLTGQ
DCML_OLICO      --LQGMGCKRKRVEDIRFTQGKGNYVDDVKLPGMLFGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTA-
DCML_HYDPS      LALAGMRPRACAKEDARFIQGKGNYVDDIKMPGMLHMDIVRAPIAHGRIKKIHKDAALAMPGVHAVLTAE
HCRA_THAAR      ------------------VTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVIAVCTGA
XDHA_ECOLI      ------------------VTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
XDHA_ECO57      ------------------VTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
XDHD_BACSU      --------SRVRPDGRGKVTGELKYMTDLSFPGMLYGKVLRSAYPHAEIVSVCTIKAEKMEGVQAVVTHK
ADO_HUMAN       -----IGHPIMHLSGVKHATGEAIYCDDMPLVDQEFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAE
ADO_RABIT       -----IGHPVMHLSGVKHATGEAIYLDDMPAVDQEFMAFVTSPRAHAKIVSTDLLEALSLPGVVDIVTAE
XDHD_ECO57      --LEVIGKHYPKTDAAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVIT--
XDHD_ECOLI      --LEVIGKHYPKTDAAKMVQAKPCYVEDRVTADACVIKMLRSPHAHALITHLDVSKAEALPGVVHVIT--
ADO_BOVIN       -----IGHPIMHLSGIKHATGEAIYCDDMPVVDREFLTFVTSSRAHAKIVSIDVSAALSLPGVVDILTGE
ADO_MACFA       -----IGHPIMHLSGVKHATGEAIYCDDMPPVDQEFLTFVTSSRAHAKIVSIDLSEALSMPGVVDVITAE
ADO_RAT         -----IGRPIMHLSGIKHATGEAIYCDDMPAVDREFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITAD
XDH_BOVIN       -------------------SGEAVYCDDIRYENELFLRLVTSTRAHAKIKSIDVSEAQKVPGFVCFLSAD
ADO_MOUSE       -----IGRPIMHLSGIKHATGEAIYCDDMPAVDREFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITAD
XDH_FELCA       -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAQKVPGFVCFISA-
XDH_CALVI       -----IGRPKIHASALKQATGEAIYCDDMRMENELYLALVLSTKAHAKILSIDASEALAMPGVHAFFSSK
XDH_CHICK       -----VGRPLVHLSAAKQACGEAVYCDDIPHYNELYLTLVTSTQAHAKILSIDASEAQSVPGFVCFVSAK
XDH_MOUSE       -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTSE
XDH_HUMAN       -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISAD
XDH_DICDI       ------------------VTGEALYVDDVKMKSL-YAVMVPSLKAHANIKSVDASKALKAPGVKAFFSAK
YAGR_ECO57      -----------------------------------YGYIVGSAIAKGRLTALDTDAAQKAPGVLPVITAS
XDH_EMENI       -------------------TGEAQYTDDIPAQNELYGCMVLSTKAHAKLLSVNTEAALEIPGVIDYVDHK
ALDO1_ORYSJ     -------------------SGEAVYVDDIPAKDCLYGAFIYSTHPHAHIKGVNFRSSLASQKVITVITAK
YAGR_ECOLI      -------------------TGTARYAYEWEAPNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITAS
XDH_RAT         -------------------SGEAVYCDDIRYENELSLRLVTSTRAHAKITSIDTSEAKKVPGFVCFLTAE
XDH_DROSU       -----IGRPEVHAAALKQATGEAIYTDDIRMDGELYLGFVLSTKPRAKITKLDASAALALEGVHAFFSHK
XDH_DROME       -----IGRPKVHAAALKQATGEAIYTDDIRMDGEVYLAFVLSTKPRAKITKLDASEALALDGVHQFFCYK
XDH_DROPS       -----IGRPEVHAAALKQATGEAIYTDDIRMDGELYLGLVLSTKPRAKITKLDASEALALEGVHAFFSHK
ALDO3_ARATH     -----IGEAVIKVGAALQASGEAVFVDDIPTLDCLHGAFIYSTEPLAKIKSLSFRENVTPTGVFAVLTFK
ALDO3_ORYSJ     -------------------SGEAVYVDDISAKDCLYGAFIYSTHPHAHIKGVNFRSSLASQKVITVITLK
MOP_DESGI       ------------------VTGTLDYGADLGLAGTLHLAMVQAKVSHANIKGIDTSEALTMPGVHSVITHK
ALDO2_ORYSJ     -------------------SGEAVYVDDIPAKDCLYGAFIYSTHPHAHIKDINFRSSLASQKVITVITAK
ALDO4_ARATH     -----VGEAIIKFGAEMQASGEAVYVDDIPSLPCLHGAFIYSTKPLAWIKSVGFSGNVTPIGVLAVITFK
IORB_BREDI      ----------------------------------------------------------------------
ALDO1_ARATH     -------------------SGEAVYVDDIPAPNCLYGAFIYSTMPLARIKGIRFKQNRVPEGVLGIITYK
ALDOL_ORYSJ     -------------------SGEAIYVDDIPAKNCLYGEFIYSTQPLANVKSIKFKPSLASKKILTVVSAK
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QIVDDKVGNLICGWAIHSKDGSAMKMGAWPAMAPETVRFVGQAVAVVIAESKNLARDXXXXXXXXXXXXX
DCML_OLICO      --ADLKPLNL------HYMPTLAGDVQA--VLADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP
DCML_HYDPS      DLKPLK---------LHWMPTLAGDVAA--VLADEKVHFQMQEVAIVIADDRYIAADAVEAVKVEYDELP
HCRA_THAAR      E--------------------TPVPFGVLPPLARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLP
XDHA_ECOLI      DVPDIPFATAGHAWTLDENKRDT----ADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSIEWQELP
XDHA_ECO57      DVPDIPFATAGHAWTLDENKRDT----ADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSIEWEELP
XDHD_BACSU      ----DVPGLNRFGIVIPDQ----------PVLCEDRVRYVGDXXXXXXXXXXXXXXXXXXXXXXXYKELE
ADO_HUMAN       HLSDV---NSFCFFTEAEK-----------FLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLE
ADO_RABIT       ----------------HLQDGNTFYTEK--LLAADEVLCVGQLVCAVIAESEVQAKQAAKQVKIVYEDLE
XDHD_ECO57      ----------------------------------------------------------------------
XDHD_ECOLI      ----------------------------------------------------------------------
ADO_BOVIN       HLP-----------GINTTFG--FLTDADQLLSTDEVSCVGQLVCAVIADSEVQARRAAQQVKIVYQDLE
ADO_MACFA       HLSDV---NSFCFFT-----------EAEEFLATDKVFCVGQLVCAVLADSEVQAKRAAKQVKIVYQDLE
ADO_RAT         HLQD------------------ATTFGTETLLATDKVHCVGQLVCAVIADSETRAKQAAKHVKVVYRDLE
XDH_BOVIN       DIPGSNETGLFNDETVFAKD---------------TVTCVGHIIGAVVADTPEHAE-----------RAA
ADO_MOUSE       HLQE------------------ANTFGTETFLATDEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQDLA
XDH_FELCA       ---DDVPGSNITGIGNDEM-----------VFAKDKVTCIGHIIGAVVTDTREHAQ-----------RAA
XDH_CALVI       DITENEVGPVF-----HDEE----------VFASDMVYCQGQVIGAIAADNPNFS-SKTARKVTIEYEDI
XDH_CHICK       DVPGSNITGIANDETVFAED---------------VVTCVGHIIGAVIADTQEHSR-------RAAKAVK
XDH_MOUSE       DVPGSNITGIFNDETVFAKD---------------EVTCVGHIIGAVVADTPEHAH-----------RAA
XDH_HUMAN       DVPGSNITGICNDETVFAKDKVTCVIGAVVADTPEHTQRAAQGVKITYEELPAIIT--------------
XDH_DICDI       DIP----GINDCGPVIHDEE----------VFVTKTALFHGAPIGCIVAETQALEASKLVAIEYEELPAI
YAGR_ECO57      N-----------AGALSKGDKNTARLLGGP-----TIEHYHQAIALVVAETFEQARAAASLVQAHYRRNK
XDH_EMENI       DLPSPRAN----WWGAPNCDEVFF--------AVDKVTTAGQPIGMILANTAKAAEEGARAVKVEYEELP
ALDO1_ORYSJ     DIPTENVGSCF------------PMLGDEALFADPVAEFAGQNIGVVIAETQKYAYMAARQAVIEYNTEN
YAGR_ECOLI      N-----------AGALGKGDKNTARLLGGP-----TIEHYHQAIALVVAETFEQARAAASLVQAHYRRNK
XDH_RAT         DVPNSNATGLFNDETVFAKD---------------EVTCVGHIIGAVVADTPEHAQ-----------RAA
XDH_DROSU       DLTENEVGPVF-----HDEH----------VFAAGEVHCYGQIVGAVAADNKALAQ-RASRLVRVEYEDL
XDH_DROME       DLTEHE--NEV-GPVFHDEH----------VFAAGEVHCYGQIVGAIAADNKALAQ-RAARLVKVEYEEL
XDH_DROPS       DLTEHE--NEV-GPVFHDEH----------VFAAAEVHCYGQIVGAVAADNKXXXXXXXXXXXXEYEELA
ALDO3_ARATH     DIPQQ--GQNI---------GSKTLFGPGPLFADELTRCAGQRIALVVADTQKAAKLAVVEYDTKNLEQP
ALDO3_ORYSJ     DIPTN--GKNI---------GSCSPMLGDEALFVDPVEFAGQNIGVVIAETQKYAYMAAKQSVIEYSTEN
MOP_DESGI       DV---KGKNRITGLITFPTN----KGDGWPILCDEKVFQYGDCIALVCXXXXXXXXXXXEKVKVDLEELP
ALDO2_ORYSJ     DIPTG--GENI---------GSCFPMLGDEALFVHPVEFAGQNIGVVIAETQKYAYMAAKQAVIEYSTEN
ALDO4_ARATH     DIPE--VGQNI---------GYITMFGTGLLFADEVTISAGQIIALVVADTQKHADEYDSRNIGTPVLSV
IORB_BREDI      ----------------------------------------------------------------------
ALDO1_ARATH     DI--PKGGQNIGTNGFFTSD---------LLFAEEVTHCAGQIIAFLVADSQKHADIAANLVVIDYDTKD
ALDOL_ORYSJ     DIPTG--GRNI---------GSTFLFGEEPLFGDPIAEFAGQALGVVIAETQRYAKQAVVEYTTDGLKAP
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXQLHPEAPGNIVYDWEIGDQKAVDEAFGKAANVVSFELTNNRLVPNAMEPRAAIADY
DCML_OLICO      VLVDPFKA-------MEPDAPHNHIFRWEIGDKEGTDATFAKAEVVSKDMFTYHRVHPSPLETCQCVASM
DCML_HYDPS      VVIDPIDALKPDAPVLREDLAGNHIFTWGAGDKAATDAVFANAPVTVSQHMYYPRVHPCPLETCGCVASF
HCRA_THAAR      AYMTPKAAMKAGAIALHDDKPNNILREAEFGD---VAAAFAEADLIREKTYTFAEVNHVHMELNATLAEY
XDHA_ECOLI      VITTPEAALAEDAAPIHNG--GNLLKQSTMSTGN-VQQTIDAADYQVQGHYQTPVIQHCHMESVTSLA-W
XDHA_ECO57      VITTPEAALAEDAAPIHNG--GNLLKQSTMSTGN-VQQTIDAADYQVQGHYQTPVIQHCHMESVTSLA-W
XDHD_BACSU      VMDSPEKALRPNAQRLHED--GNILHRFSNGD---VEEGFQASDTVFEETYELPRQMHTYMETEGGVA-V
ADO_HUMAN       PLILTIEESIQHNSSFKPERK------LEYGN---VDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVP
ADO_RABIT       PVILSIEEAIEQKSFFEPERK------LEYGN---VDEAFKVVDQILEGEIHMGGQEHFYMETQSVLVVP
XDHD_ECO57      -----------------------------IGD---MDKGFADADVII--ERTYNSTQAQQCPTETHICFT
XDHD_ECOLI      -----------------------------IGD---MDKGFADADVII--ERTYNSTQAQQCPTETHICFT
ADO_BOVIN       PVILTIEEAIQNKSFFEPERK------LEYGN---VDEAFKMVDQILEGEIHMGGQEHFYMETQSMLVVP
ADO_MACFA       PLILTIKEAIQHNSFFEPERK------LEYGN---VDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVP
ADO_RAT         PLILTIEEAIQHKSFFESERK------LECGN---VDEAFKIADQILEGEIHIGGQEHFYMETQSMLVVP
XDH_BOVIN       HVVKVTYEDLPAIITIEDAIKNNSFYGSELKIEKGLKKGFSEADNVVSGELYIGGQDHFYLETHCTIAIP
ADO_MOUSE       PLILTIEEAIQHKSFFKSERK------LECGN---VDEAFKIVDQILEGEIHIGGQEHFYMETQSMLVVP
XDH_FELCA       QAVRITYEDLPAIITIEDAIAKDSFYEPELKIEKGLTKGFSEADNIVSGELYIGGQEHFYLETHCTIAVP
XDH_CALVI       KPVIITIEQAIEHKSYFPDYPRFT----EIGD---VEKAFSEADHVYEGSCRMGGQEHFYLETHASLAVP
XDH_CHICK       IKYEELKPIVTIQEAIEQQSFIKPIKRIKKGD---VNKGFEESDHILEGEMHIGGQEHFYLETHCTLAVP
XDH_MOUSE       RGVKITYEDLPAIITIQDAIKNNSFYGPEVKIEKGLKKGFSEADNVVSGELYIGGQEHFYLETHCTIAVP
XDH_HUMAN       ---------------IEDAIKNNSFYGPELKIEKGLKKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVP
XDH_DICDI       TSIEDAISKQSFFPFTHLLKDGDMEKGWSESDH-IIDGEFKVGAQEHFY-----------LEPNGTLVIP
YAGR_ECO57      GAYSLADEKQAV------SQPPEDTPDKNVGD---FDGAFSSAAVKIDATYTTPDQSHMAMEPHASMAVW
XDH_EMENI       VILSIEEAIEAQSFFERFRYIKNGDPESAFRDADHVFEGVSRMGGQEHFYL----------ETQACVAIP
ALDO1_ORYSJ     LQPPILTVEDAVQHNSYFQVPP-FLQPKPIGDNQAMSEADHK---IIDGEVKLGSQYYFYMETQTALA-F
YAGR_ECOLI      GAYSLADEKQAV------NQPPEDTPDKNVGD---FDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVW
XDH_RAT         RGVKITYEDLPAIITIQDAINNNSFYGSEIKIEKGLKKGFSEADNVVSGELYIGGQEHFYLETNCTIAVP
XDH_DROSU       SPVIVTIEQAIEHGSYFPDYPRYVT-------KGNMAEAFAQAEHTYEGSCRMGGQEHFYLETHAAVAVP
XDH_DROME       SPVIVTIEQAIEHKSYFPDYPRFVT-------KGNVEEALAQADHTFEGTCRMGGQEHFYLETHAALAVP
XDH_DROPS       PVIVTIEQAIEHGSYF-PDYPRYV-------NKGNVEEAFAAAEHTYEGSCRMGGQEHFYLETHAAVAVP
ALDO3_ARATH     ILTVEDAVKRSSFFEVHP-----MFYPEPVGDVKGMEEAERK---IISSELRLGSQYFFYMEPQTALA-L
ALDO3_ORYSJ     LQPPILTVEDAVQHNSYFQVPPFLA-PTPIGENQAMSEADHK---IIDGEVKLESQYYFYMETQTALA-I
MOP_DESGI       AYMSGPAAAAEDAIEIHPGTP-NVYFEQPIVKGEDTGPIFASADVTVEGDFYVGRQPHMPIEPDVAFA-Y
ALDO2_ORYSJ     LQPPILTIEDAVQHNSYFPVPPFLA-PTPIGDNQAMSEADHK---IIDGEVKLESQYYFYMETQTALA-I
ALDO4_ARATH     EDAVKRSSLFEVPPEYQPEPVGDISKGMAEADRK-----------IRSVELRLGSQYFFYMETQTALA-L
IORB_BREDI      ----------------------NAVQAWKQGELSSIDAVFARPVRIESFEMQSDLVYQAPMEPQSAVIQP
ALDO1_ARATH     LKPPILSLEEAVENFSLFEVPPPL-RGYPVGDTKGMDEAEHK---ILGSKISFGSQYFFYMETQTALA-V
ALDOL_ORYSJ     ILTVEQAVQNNSYFQVPPERAPKQVGDFSKGDHKIMSEEVKLASQYYFYMETQTAL---------AIPDE
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NSAEEHFTLYTTSQNPHVARLVLSAFYNIAPEHKLRVVAPDVGGGFGSKIFIYPEEMVALWASKKVGRAV
DCML_OLICO      DKIKGELTLWGTFQAPHVIRTVVSLISGL-PEHKIHVIAPDIGGGFGNKVGAYSGYVCAVVASIVLGVPV
DCML_HYDPS      DPIKGDLTTYITSQAPHVVRTVVSMLSGI-PESKVRIVSPDIGGGFGNKVGIYPGYVCAIVASIVLGRPV
HCRA_THAAR      DPVRDMLTLNTTTQVPYYVHLKVAACLQM-DSARIRVIKPFLGGGFGARTEGLHFEIIAGLLARKAKGTV
XDHA_ECOLI      MEDDSRITIVSSTQIPHIVRRVVGQALDI-PWSCVRVIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPV
XDHA_ECO57      MEDDSRITIVSSTQIPHIVRRVVGQALDI-PWSCVRVIKTFVGGGFGNKQDVLEEPMAAFLTSKLGGIPV
XDHD_BACSU      PEDDGGFTMYAGTQHGYKDRFQLARIFDI-PEEKIRIVSSPMGGSFGGKDELNIQPYAALLALKS-GRPV
ADO_HUMAN       KGEDQEMDVYVSTQFPKYIQDIVASTLKL-PANKVMCHVRRVGGAFGGKVLKTGIAAVTAFAANKHGRAV
ADO_RABIT       KGEDQEMDVYASTQFPKYIQDMVAAVLKL-PVNKVMCHVKRVGGAFGGKVFXXXXXXXXXXXXNKHGRAV
XDHD_ECO57      RMDGDRLVIHASTQVPWHLRRQVARLVDMK-QHKVHVIKERVGGGFGSKQDILLEEVCA-WATCVTGRPV
XDHD_ECOLI      RMDGDRLVIHASTQVPWHLRRQVARLVGMK-QHKVHVIKERVGGGFGSKQDILLEEVCA-WATCVTGRPV
ADO_BOVIN       KGEDREIDVYVSAQFPKYIQDITASVLKVSA-NKVMCHVKRVGGAFGGKVTKTGVAAITAFAANKHGRPV
ADO_MACFA       KGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHVKRXXXXXXXXXXXXXXIAAVTAFAANKHGRAV
ADO_RAT         KGEDGEIDIYVSTQFPKHIQDIVAATLKLSV-NKVMCHVRRVGGAFGGKVGKTSMAAITAFAASKHGRAV
XDH_BOVIN       KGEEGEMELFVSTQNAMKTQSFVAKMLGV-PVNRILVRVKRMGGGFGGKTRSTXXXXXXXXXXYKTGHPV
ADO_MOUSE       KGEDGEIDIYVSTQFPKYIQDIVAATLKLSA-NKVMCHVRRVGGAFGGKVGKTSIAAITAFAASKHGRAV
XDH_FELCA       KGEAGEMELFVSTQNTTKTQSFVANMLGV-PANRILVRVKRMGGGFGGKETRSTVVSTAVLAAYKTGRPV
XDH_CALVI       RDSDEIEIFCSTQHPSEVQKLVAHVLSTSA--HRVVCRAKRLGGGFGGKESIAVALPVAL-ACHRLRRPI
XDH_CHICK       KGEDGEMELFVSTQNLMKTQEFTASALGV-PSNRIVVRVKRMGGGFGGKETTILTTVVAV-AAFKTGRPV
XDH_MOUSE       KGEAGEMELFVSTQNTMKTQSFIAKMLGV-PDNRIVVRVKRMGGGFGGKETTLISTAVAL-AAYKTGRPV
XDH_HUMAN       KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PANRIVVRVKRMGGGFGGKTRXXXXXXXXXXXXYKTGRPV
XDH_DICDI       GEGKE-LTVISSTQNPTKTQAIVASVLGIGQNQKLKRLXXXXXXKETRSIF---SSCVAAIASYHMKEPV
YAGR_ECO57      DGNK--LTLWTSNQMIDWCRTDLAKTLKV-PVENVRIISPYIGGGFGGKLFLRSDXXXXXXXXXXVKRPV
XDH_EMENI       KAEDGEMEIWSSTQNPTETQSYVAQVTGVAA-NKIVSRVKRLGGGFGGKETRSVQLAICATAAAKVRRPV
ALDO1_ORYSJ     PDEDNCITVYCSAQMPEVTQDIVARCLGV-PFHNVRIITRRVGGGFGGKAMKXXXXXXXXXXXXKLRRPV
YAGR_ECOLI      DGNK--LTLWTSNQMIDWCRTDLAKTLKV-PVENVRIISPYIGGGFGGKLFLRSDXXXXXXXXXXVKRPV
XDH_RAT         KGEAGEMELFVSTQNTMKTQSFVAKMLGV-PDNRIVVRVKRMGGGFGGKETRSTVVSTALLAAHKTGRPV
XDH_DROSU       RDSDE-LELFCSTQHPEVQKLV--AHVTSLPAHRVVCRAKRLGGGFGGKESISVALPVAL-AAYRLRRPV
XDH_DROME       RDSDE-LELFCSTQHPEVQKLV--AHVTALPAHRVVCRAKRLGGGFGGKESISVALPVAL-AAYRMGRPV
XDH_DROPS       RDSDE-LELFCSTQHPEVQKLV--AHVTTLPAHRVVCRAKRLGGGFGGKESISVALPVAL-AAYRLRRPV
ALDO3_ARATH     PDEDNCVKVFSSSQAPEYVHSVIATCLGIQ-EHNVRVITRRVGGGFGGKVKSMPVATACALGAYKLQRPV
ALDO3_ORYSJ     PDEDNCITLYVSAQLPEITQNTVARCLGI-PYHNVRIITRRVGGGFGGKAMKXXXXXXXXXXXXKLRRPV
MOP_DESGI       MGDDGKCYIHSKSIGVHLHLYMIAPGVGLEPD-QLVLVANPMGGTFGYKFSPTSEALVAV-AAMATGRPV
ALDO2_ORYSJ     PDEDNCITLYVSAQLPEITQNTVARCLGI-PYHNVRIITRRVGGGFGGKXXXXXXXXXXXXXXXKLRRPV
ALDO4_ARATH     PDEDNCLVVYSSTQAPEFTQTVIATCLGI-PEHNVRVITRRVGGGFGGKIKSMPVATACALAAKKMQRPV
IORB_BREDI      H-ADGSAEAWVGTQWPTVEQGFAAGILGIAPD-KLTMHLPLVGGGFGRRL--EPGALVAAHIVRAIGKTV
ALDO1_ARATH     PDEDNCMVVYSSTQTPEFVHQTIAGCLGV-PENNVRVITRRVGGGFGGKVKSMPVAAACALAASKMQRPV
ALDOL_ORYSJ     DNT---MTVYSSSQFPELAQNVISKCLGI-PFNNVRVITRRAGGGFGGKAVLHIATAAALCAHT-LRRPV
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KWTGDRSEAFLTDAHGRDHVSKAELAFDADNRMLALRVKTHANFGAYMSLFSSSVPTYLYATLLSGQYNI
DCML_OLICO      KWVEDRMENLSTTSFARDYHMTTELAATKDGKILAMRCHVLADHGAFDACADPSKWPAGFMNICTGSYDM
DCML_HYDPS      KWVEDRVENISTTAFARDYHMDGELAATPDGKILGLRVNVVADHGAFDACADTKFPAGLFH-ICSGSYDI
HCRA_THAAR      RLLQTREETFIAH-RGRPWTEKMKIGLKKDGKIAALALE--XXXXXXXXXXXXXXXXXXXXXLMHGLYHI
XDHA_ECOLI      KVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLDVLSNTGAYAS--------HGHSIASAGGNKV
XDHA_ECO57      KVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLDVLSNTGAYVS--------HGHSIASAGGNKV
XDHD_BACSU      KIHQTRKESVRSGI--KRHPMKITIKTGADHNLLAHDVKIVADTGAYATLGPAVLDFSVEHA--AGPYRI
ADO_HUMAN       RCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGA--SLDESLFVIEMGLLKMDNAYKF
ADO_RABIT       RCILERGEDMLITGGRHPYLGKYKAGFMNDGRIVALDVEHYSNGGC--SLDESLLVIEMGLLKMENAYKF
XDHD_ECO57      LFRYTREEEFI--ANTSRHVAKVTVKLGADGRLTAVKMDFRANTGPYGN-HSLTVPCNGPALSLP-LYPC
XDHD_ECOLI      LFRYTREEEFI--ANTSRHVAKVTVKLGADGRLTAVKMDFRANTGPYGN-HSLTVPCNGPALSLP-LYPC
ADO_BOVIN       RCILERGEDILITGGRHPYLGKYKAGFMNDGRILALDMEHYNNAGAFLD--ESLFVIEMGLLKLENAYKF
ADO_MACFA       RCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAG--NSLDESLLVIEMGLLKMDNAYKF
ADO_RAT         RCTLERGEDMLITGGRHPYLGKYKVGFMRDGRIVALDVEHYCNGGS--SLDESLWVIEMGLLKMDNAYKF
XDH_BOVIN       RCMLDRNEDMLITGGRHPFLARYKVGFMKTGTIVALEVDHYSNAGNSRDLSHSIMERALFH--MDNCYKI
ADO_MOUSE       RCILERGEDMLITGGRHPYLGKYKAGFMNEGRILALDVEHYCNGGC--SLDESLWVIEMGLLKLDNAYKF
XDH_FELCA       RCMLDRDEDMLITGGRHPFLARYKVGFMKTGRVVALKVEHYSNAGNTLDLSQSIMERALFH--MDNCYNI
XDH_CALVI       RCMLDRDEDMMITGTRHPFLFKYKIAFTSEGRLTGCYIECYNNAGWSMDLSFSVLERAMFH--FENCYKI
XDH_CHICK       RCMLDRDEDMLISGGRHPFLGRYKVGFMKNGKIKSLEVSYYSNGGNSADLSHGVMDRALLH--LDNSYNI
XDH_MOUSE       RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTIVALEVAHFSNGGNSEDLSRSIMERAVFH--MDNAYKI
XDH_HUMAN       RCMLDRDEDMLITGGRHPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFH--MDNCYKI
XDH_DICDI       RIILDRDTDMSTTGTRHPFIARYRVGFTKEGLIKALDLELYADAGFSYDISVGVLDRAIFHS--ENSYKI
YAGR_ECO57      KVMLPRPSIPNNTTHRPATLQHLRIGADQSGKITAI---SHESWSGNLPGGTPETAVQQSELLYAGANRH
XDH_EMENI       RCMLNRDEDIATSGQRHPFYCKWKVGVTREGKLLALDADVYANGGHTQDLSGAVVERSL--SHIDNVYRF
ALDO1_ORYSJ     RMYLDRKTDMIMAGGRHPMKAKYSVGFKSDGKITALHLDLKINAGISPE-FSPAIPYAIVGALK--KYSW
YAGR_ECOLI      KVMLPRPSIPNNTTHRPATLQHLRIGADQSGKITAI---SHESWSGNLPGGTPETAVQQSELLYAGANRH
XDH_RAT         RCMLDRDEDMLITGGRHPFLAKYKVGFMKTGTVVALEVAHFSNGGNTEDLSRSIMERALFH--MDNAYKI
XDH_DROSU       RCMLDRDEDMLITGTRHPFLFKYKVAFSSDGLITACDIECYNNAGWSMDLSFSVLERAMYH--FENCYHI
XDH_DROME       RCMLDRDEDMLITGTRHPFLFKYKVGFTKEGLITACDIECYNNAGWSMDLSFSVLERAMFH--FENCYRI
XDH_DROPS       RCMLDRDEDMLITGTRHPFLFKYKVAFASDGLITACDIECYNNAGWSMDLSFSVLERAMYH--FENCYRI
ALDO3_ARATH     KMFLNRKTDMIMAGGRHPMKINYNVGFRSDGKLTALELTMLIDAGLEPDV-SPIMPRNIMGPL--RKYDW
ALDO3_ORYSJ     RMYLDRKTDMIMAGGRHPMKVKYSVGFKSDGKITGLHVDLRINCGISPDC-SPALPVAIVGALK--KYNW
MOP_DESGI       HLRYNYQQQQQYTGKRSPWEMNVKFAAKKDGTLLAMESDWLVDHGPYSEF--GDLLTLRGAQFIGAGYNI
ALDO2_ORYSJ     RMYLDRKTDMIMAGGRHPMKVKYSVGFKSDGKITGLHFDLGMNGGISPDC-SPVLPVAIVGALK--KYNW
ALDO4_ARATH     RIYVNRKTDMIM-AGGRHPLKTYSVGFRSDGKLTALDLNLFIDAGSDVDV-SLVMPQNIMNSL--RKYDW
IORB_BREDI      KVIWSREDDLKRNPFRQALACRVEAALEKDQRILALRHTVAADFPQYFNAYQQTDPGNWIGGMVA--YDV
ALDO1_ARATH     RTYVNRKTDMITTGGRHPMKVTYSVGFKSNGKITALDVEVLLDAGLTEDI-SPLMPKGIQGALM--KYDW
ALDOL_ORYSJ     RMYLNRNTDMIMVGGRHPMKARYSVGFKSDGKITALHLDLLINAG-----ISADASPVIPGTIISGKYNW
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           PAIYAEVIGVYTNTTPVDAYRGAGRPEACYLVERLVETAARQLKVDPAELRRKNFITQFPHQTPVIMAYD
DCML_OLICO      PVAHLAVDGVYTNKASGGAYRCSFRTEAVYAIERAIETLAQRLEMDSADLRIKNFIQQFPYMAPLGWEYD
DCML_HYDPS      PRAHCSVKGVYTNKAPGGAYRCSFRTEAVYLIERMVDVLAQKLNMDKAEIRAKNFIRQFPYTTQFGFEYD
HCRA_THAAR      PAIKHDAWRVYTNTPPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLPQIPYVT--MYAQR
XDHA_ECOLI      AYLYPRCAYAYTNLPSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIY
XDHA_ECO57      AYLYPRCAYAYTNLPSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNASREGDANPLTGKRIY
XDHD_BACSU      PNIRTEGISVFTNNGVAGEFRGFGGNQITFALETHLDRLSGMLGIDPLELRRKNI--RKPH--------D
ADO_HUMAN       PNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEI-DQTPYKQEIN
ADO_RABIT       PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITECCITEVAAKCGLSPEKVRAINFYKEI-DQTPYKQEIN
XDHD_ECO57      DNVDFQVTTYYSNICPNGAYQGYGAPKGNFAITMALAELAEQLQIDQLEIIERNRVHE-GQELKILGAIG
XDHD_ECOLI      DNVDFQVTTYYSNICPNGAYQGYGAPKGNFAITMALAELAEQLQIDQLEIIERNRVHE-GQELKILGAIG
ADO_BOVIN       PNLRCRGWACRTNLPSNTALRGFGFPQAGLITEACITEVAAKCGLPPEKVRMINMYKEI-DQTPYKQEIN
ADO_MACFA       PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIMEVAAKCGLSPEKVRMINMYKEI-DQTPYKQEIN
ADO_RAT         PNLRCRGWACRTNLPSHTALRGFGFPQAGLVTEACVTEVAIRCGLSPEQVRTINMYKQIDN-THYKQEFS
XDH_BOVIN       PNIRGTGRLCKTNLSSNTAFRGFGGPQALFIAENWMSEVAVTCGLPAEEVRWKNMYKELTHFNQRLEGFS
ADO_MOUSE       PNLRCRGWACRTNLPSNTALRGFGFPQAGLVTEACITEVAIKCGLSPEQVRT---INMYKH---VDTTHY
XDH_FELCA       PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEHWMSEVAVTCGLPAEEVRRKNMYKE----------GD
XDH_CALVI       PNIKVGGWVCKTNLPSNTAFRGFGGPQGMFAGEHIIRDVARILGKDYLEIMKQNFYKEG----------D
XDH_CHICK       PNVSIMGFICKTNLSSNTAFRGFGGPQGMMIAECWMSDLARKCGLPPEEVRKINLYHELTHFNQKLEGFT
XDH_MOUSE       PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAVTCGLPAEEVRRKNMYKELTHFNQKLEGFT
XDH_HUMAN       PNIRGTGRLCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEG----------D
XDH_DICDI       PNV--NILGCKTNLPSNTAFRGYGGPQAMIICENWVEKISKTLGMDSYKIRELNF-----YKEAEVTAYR
YAGR_ECO57      TGLRLATLDLPEG----NAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILN-------DTQIDPADP
XDH_EMENI       PNIYVRGRICKTNTVSNTAFRGFGGPQGLFFAESIISEVADHLDLQVEQLR---ILNMYEPGDMTHFNQE
ALDO1_ORYSJ     GALAFDIKVCKTNVSSKSAMRAPGDAQGSFIAEAIVEHVASTLSVATNTIRRKNL-----HDLESLKVF-
YAGR_ECOLI      TGLRLATLDLPEG----NAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILN-------DTQVDPADP
XDH_RAT         PNIRGTGRICKTNLPSNTAFRGFGGPQGMLIAEYWMSEVAITCGL-PAEEVRRKNMYKEGDLTHFNQKLE
XDH_DROSU       PNVRVGGWVCKTNLPSNTAFRGFGGPQGMFAGEHIIRDVARIVGRDVLDVMRLNFYRDTTHYNQQLEHFP
XDH_DROME       PNVRVGGWVCKTNLPSNTAFRGFGGPQGMYAGEHIIRDVARIVGRDVVDVMRLNFYKDYTHYHQQLEHFP
XDH_DROPS       PNVRVGGWVCKTNLPSNTAFRGFGGPQGMFAGEHIIRDVARIVGRDVLDVMRLNFYKDITHYNQKLEHFP
ALDO3_ARATH     GALSFDVKVCKTNCLSRTAMRAPGEVQGSYIAESIIENVASSLQMDVDAVRKINLHT-------------
ALDO3_ORYSJ     GALSFDIKLCKTNVSSKSAMRAPGDAQGSFIAEAIVEHIASTLSVDTNAIRRKN----------------
MOP_DESGI       PNIRGLGRTVATNHVWGSAFRGYGAPQSMFASECLMDMLAEKLGMDPLELRYKN----------------
ALDO2_ORYSJ     GALSFDIKVCKTNVSSKSAMRAPGDAQGSFIAEAIVEHIASTLSVDTNAIRRKN----------------
ALDO4_ARATH     GALSFDIKVCKTNLPSRTSLRAPGEVQGSYIAESIIENVASSLKMDVDVVRRINLHT-------------
IORB_BREDI      PL---QRIDALTPRRSVDVMRGIGVAQVKFAQESLVDQIARRLNADPVDFR-------------------
ALDO1_ARATH     GALSFNVKVCKTNTVSRTALRAPGDVQGSYIGEAIIEKVASYLSVDVDEIRKVNLHT-------------
ALDOL_ORYSJ     GALSFDVKLCKTNNTSKSVMRAPGDTQGSFXXXXXXXXXXXXLSLDANTVRQKNFHT-------------
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           IGDFGASLDAALKAADYSXXXXXXXXXXXXXXXXXXXFSCYIEACGIAPSKAVGSLGAGVGLWESAEVRV
DCML_OLICO      SGNYPLAMKKAMDTVGYQKAKQEAFKRGETREIMGIGISFFTEIVGAGPSKNCDILG--VSMFDSAEIRI
DCML_HYDPS      SGDYHTALKKVLDAVDYPAWRAEQAARRADPNSPTLMLVTFTEVVGAGPSKMCDILG--VGMFDSCEIRI
HCRA_THAAR      VMSYG--VPECLEKVKAASGWEEXXXXXXXXXXXXIALSHFVSGTS-TPKHWTGEPHATVNL------KL
XDHA_ECOLI      SAGLPECLEKGRKIFEWEKRRAECQNQQGNLRRGVGV-ACFSYTSNTWP---VGVEIAG------ARLLM
XDHA_ECO57      SAGLPECLEKGRKIFEWEKRRAECQNQQGNLRRGVGV-ACFSYTSNTWP---VGVEIAG------ARLLM
XDHD_BACSU      LG----PLEHRIAPTDGAAQVLNAISKSPILKKTSRNCGYLQRGTGAAITMHGGGLGFGRMDAAGGRLSL
ADO_HUMAN       AKNLIQCWRECMAMSSYSLRKVAVEKFNAEN---------YWKKKGLAPLKFPVGLGSRAAGQAAALVHI
ADO_RABIT       AKNLTQCWNECLAKSSYFQRKVAVEKFNAENYWKQ-------RGLAIIPFKYPRGLGSVAYGQAAALVHV
XDHD_ECO57      EGKAPTSVPSAASCALEEILRQGRE---------------MIQWSSPKPQNGDWHIGRGVAIQANCMIKL
XDHD_ECOLI      EGKAPTSVPSAASCALEEILRQGRE---------------MIQWSSPKPQNGDWHIGRGVAIQANCMIKL
ADO_BOVIN       TKNLTQCWKECMATSSYTLRKAAVEKFNSEN---------YWKKKGLAPLKYPIGLGSVAAGQAAALVHI
ADO_MACFA       AKNLIQCWRECMAVSSYSLRKAAVEKFNAEN---------YWKKKGLAPLKYPVGLGSRAAGQAAALVHI
ADO_RAT         AKTLFECWRECMAKCSYSERKTAVGKFNAEN-------SWKKRGMAVIPLKGVGSVAMGQA---AALVHI
XDH_BOVIN       VP---RCWDECLKSSQYYARKSEVDKFNKE--------NCWKKGLCIIPTKFGISFTVPFLNQAGALIHV
ADO_MOUSE       KQEFSA------KALSECWRECMAKCSYFERKAAIGKFSWKKRGMAVIPLKFPVGIGSVAMGQAAALVHI
XDH_FELCA       LTHFNQKLEGTLPRCWEECLASSQYHARKREADKFNEENCWKKGLSIIPTKFGISFTVPFLNQAGALVHV
XDH_CALVI       ITHYQQKLDNCLQQSNYYQKRKEIEEFNRNHRWRKRGISLVPTKYGIAFGVSLNQAGALINIYADGSVLL
XDH_CHICK       LR---RCWDECLSSSNYHARKKLIEEFNKQNRWKKRGMC-------IIPTKFGISFTVPFLNQAGALVHV
XDH_MOUSE       L---PRCWDECIASSQYQARKMEVEKFNRENCWKKRGLCIIPTKFGI--SFTLSFLNQG-----GALVHV
XDH_HUMAN       LTHFNQKLEGTLPRCWEECLASSQYHARKSEVDKFNKENCWKKGLCIIPTKFGISFTVPFLNQAGALLHV
XDH_DICDI       QSVVNNMMDELMVKSNYHQRLIAVEKFNKENRYKKRGIS-------IIPTKFGMSFTVKTLNQAGALVHV
YAGR_ECO57      TRRFSRRIECLRTGADKFGWKQRNATPGQVRDGE------WLVGHGVAANNLLEKSGARVHLEPNGTVTV
XDH_EMENI       LKDWHVPLDQVLQESEYFERRKAVEEYNRTHKWSK-------RGMAIIPTKFGISFTALFLNQAGALVHI
ALDO1_ORYSJ     ---FGDSAAGEASTSSYSLVIIFDRLASTPEYQRRAAMVEQFNGSSRWKKRGISC----VPITYSVTLRP
YAGR_ECOLI      TRCFSRRIECLRTGADKFGWKQRNATPGQVRDGE------WLVGHGVAANNLLEKSGARVHLEQNGTVTV
XDH_RAT         GFTLPRCWDECIASSQYLARKREVEKFNRENCWKKRGLCIIPTKFGI--SFTLPFLNQGGAL-----VHV
XDH_DROSU       I---ERCLDDCLTQSRYHERRAEIAKFNRENRWRK-------RGVAVIPTKYGIAFGVMHLNQAGALLNV
XDH_DROME       I---ERCLEDCLKQSRYDEKRQEIARFNRENRWRKRGMAVYGIAFGVMHLNQAGSL-----------INI
XDH_DROPS       I---ERCLDDCLAQSRYHEKRTEIAKFNRENRWRK-------RGMAVIPTKYGIAFGVMHLNQAGALINV
ALDO3_ARATH     ----------------------------------------------------------------------
ALDO3_ORYSJ     ----------------------------------------------------------------------
MOP_DESGI       ----------------------------------------------------------------------
ALDO2_ORYSJ     ----------------------------------------------------------------------
ALDO4_ARATH     ----------------------------------------------------------------------
IORB_BREDI      ----------------------------------------------------------------------
ALDO1_ARATH     ----------------------------------------------------------------------
ALDOL_ORYSJ     ----------------------------------------------------------------------
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           NPVGTIEILTGSHSHGQGHETTFAQLVADRLGIPINQVSIVHGDTDKVQFGMGTYGSRSAAVGMSAIFXX
DCML_OLICO      HPTGSVIARMGTKSQGQGHETTYAQIIATELGIPADDIMIEEGNTDTAPYGLGTYGSRSXXXXXXXXXXX
DCML_HYDPS      HPTGSAIARMXXXXXXXXXXXXYAQIIATELGIPSEVIQVEEGDTSTAPYGLGTYGSRSTPVXXXXXXXX
HCRA_THAAR      DFDGGITLLTGAADIGQGSNTMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGNASISA
XDHA_ECOLI      NQDGTINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTDTDVTPFDPGAFASRQSYVXXXXXXXX
XDHA_ECO57      NQDGTINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTDTDVTPFDPGAFASRQSYVXXXXXXXX
XDHD_BACSU      SSEGKITASFGFEECGQGILAAIEQIVMEELGCAAEDISIVIGDTAKVPKSGSSTASRGTSMVWHAIQRL
ADO_HUMAN       YLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDA
ADO_RABIT       YLDGSVLVTHGGIEMGQGVHTKMIQVVSRELKMPMSNVHLRGTSTETV--------PNTNASGGSVVADL
XDHD_ECO57      ESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHALFDKGAYASSGTCFSGNAARLA
XDHD_ECOLI      ESDGTFIVHSGGADIGTGLDTVVTKLAAEVLHCPPQDVHVISGDTDHALFDKGAYASSGTCFSGNAARLA
ADO_BOVIN       YLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPLSSIHLRGTSTETIPNTNPSGGSVVADLNGLAVKDA
ADO_MACFA       YLDGSVLVTHGGIEMGQGVHTKMIQVVSRELGMPISNVHLRGTSTETVPNANVSGGSVVADLNGLAVKDA
ADO_RAT         YLDGSALVSHGGIEMGQGVHTKMIQVVSRELKMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDA
XDH_BOVIN       YTDGSVLVSHGGTEMGQGLHTKMVQVASKALKIPISKIYIXXXXXXXXXXXXXXAASVSTDIYGQAVYEA
ADO_MOUSE       YLDGSALVSHGGIEMGQGVHTKMIQVVSRELRMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDA
XDH_FELCA       YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSTDINGQAVY--
XDH_CALVI       SH-GGVEI-------GQGLHTKMIQCCARALQIPIEFIHISETATDKVPNTSPTAASSGSDLNGMAVLDA
XDH_CHICK       YTDGSVLLTHGGTEMGQGLHTKMIQVASRSLGIPTSKIYISEXXXXXXXXXXXXXXSVSADINGMAVHNA
XDH_MOUSE       YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHIXXXXXXXXXXXXXXXXXXXXDLNGQAIYEA
XDH_HUMAN       YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISEXXXXXXXXXXXXXXSVSADLNGQAVYAA
XDH_DICDI       YTDGTILVTHGGTEMGQGLNTKMIQIAARAFNVPVSDVFISETSTDKVPNTAPTAASVSSDLNGMAVLDA
YAGR_ECO57      ETDMT-DIGTGSY-------TILAQTAAEMLGVPLEQVAVHLGDSSPVSAGSGQWGANTSTSGVYAACVK
XDH_EMENI       YHDGSVLVAHGGVEMGQGLHTKMTMIAAEALGVPLSDVFISEXXXXXXXXXXXXXXXXXXDLNGYAIYNA
ALDO1_ORYSJ     SPDGSIAVEVGGVEIGQGLWTKVKQMTAFALGQLLDNVRVIQADTLSMIQGGWTAGSTTSETSCEAV---
YAGR_ECOLI      E--------TDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSPVSAGSGQWGANTSTSGVYAACMK
XDH_RAT         YTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIHISEXXXXXXXXXXXXXXXXXXDLNGQGVYEA
XDH_DROSU       YGDGSVLLSHGGVEIGQGLNTKMIQCAARALGIPSELIHISETATDKVPNTSPTAASVGSDINGMAVLDA
XDH_DROME       YGDGSVLLSHGGVEIGQGLNTKMIQCAARALGIPSELIHISETATDKVPNTSPTAASVGSDLNGMAVLDA
XDH_DROPS       YGDGSVLLSHGGVEIGQGLNTKMIQCAARALGIPIELIHISETATDKVPNTSPTAASVGSDLNGMAVLDA
ALDO3_ARATH     ----------------------------------------------------------------------
ALDO3_ORYSJ     ----------------------------------------------------------------------
MOP_DESGI       ----------------------------------------------------------------------
ALDO2_ORYSJ     ----------------------------------------------------------------------
ALDO4_ARATH     ----------------------------------------------------------------------
IORB_BREDI      ----------------------------------------------------------------------
ALDO1_ARATH     ----------------------------------------------------------------------
ALDOL_ORYSJ     ----------------------------------------------------------------------
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXHQLEASEGDIVIENGEFKVTGTDKSIALPMVALAAYTAHNLPDGMEPGLKESAFYDP
DCML_OLICO      XXXXXXXXQMIAAHMLEVHEGDLEWDVDRFRVKGLEKFKTMKELAWASYNSP--PPNLEPGLEAVNYYDP
DCML_HYDPS      XXXXXXXXXXXXXXMLEVNENDLDWEVDRFKVKGDDSKFKT-MADIAWQAYHQPPAGLEPGLEAVHYYDP
HCRA_THAAR      AEEXXXXXXXXXXXXXXXREEDIEVIDEMFMVSGSDPGLSFQEVVKAAMVTYTCPTEFQGDKKIRGSAIG
XDHA_ECOLI      XXXXKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSI---K
XDHA_ECO57      XXXXKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSI---K
XDHD_BACSU      KKPFLAQLKKRAAEWSGCSAENLIPGAAGLRDKNT-KALVVTYKELAE---------KGPLAEETAFDFP
ADO_HUMAN       CQTLLKRLEPIISKNPKGTWKD-------WAQTAFDESINLS--AVGYFRGYESDMNWEKGEGQPFEY--
ADO_RABIT       NGLAVKDACQTLLKRLE----PIINKNKEWAQAAFDKSISLS--ATGYFRGYDSNIDWDKGEGHPFEY--
XDHD_ECO57      AENLREKILFHGAQMLGEPVADVQLATPGV-VRGKKGEVSFGDIAHKGETGTGF-----GSLVGTGSYIT
XDHD_ECOLI      AENLREKILFHGAQMLGEPVADVQLATPGV-VRGKKGEVSFGDIAHKGETGTGF-----GSLVGTGSYIT
ADO_BOVIN       CQTLLKRLKPIISKNPKGTWKD-------WAQAAFNESISLS--ATGYFRGYESNINWETGEGHPFEY--
ADO_MACFA       CQILLKRLEPIISKNPKGTWKD-------WAQTAFDESISLS--AIGYFRGYESDINWEKGEGHPFEY--
ADO_RAT         CQTLLKRLEPIISKNPQGTWKD-------WAQTAFDQSVSLS--AVGYFRGYESNINWEKGEGHPFEY--
XDH_BOVIN       CQTILKRLEPFKKKNPDGSWEDWVMAAYQDRVS---------LSTTGFYRTPNLGYSFETNSGNAFHY--
ADO_MOUSE       CQTLLKRLEPIISKNPQGTWKD-------WAQTAFDQSISLSAVGYFRGYESNID--WEKGEGHPFEY--
XDH_FELCA       ------EACQTILKRLEPFKKKNPSGSWEDWVTAAYLD-AVSLSATGFYKTPNIGYSFETNSGNPFHY--
XDH_CALVI       C------------EKLNKRLAPIKEANPNGSWTEWINKAYFERVSLSATGFYRMPDGYDPVQNPNALMY-
XDH_CHICK       CQTILKRLEPIKQSNLKGSWEDWI------------KTAYENCISLSATGFYRIPDNFETNKGKPFHY--
XDH_MOUSE       CQTILKRLEPFKKKNPSGSWESWVMD---------AYTSAVSLSATGFYKTPNLGYSFETNSGNPFHY--
XDH_HUMAN       CQTILKRLEPYKKKNPSGSWEDWVT------------AAYMDTVSLSAYRTPNLGYSFETNSGNPFHY--
XDH_DICDI       C------------QQILLRMEPIREKNPNVPFKQLCTLCFVERVNLSANGFYATPN-VGYMFKDSGVGEG
YAGR_ECO57      LREMIASAVGFDPEQSQFADGKI--------TNGTRSAILHEATAGGRLTAE---ESIEFGTLSKEYQQS
XDH_EMENI       CTQLNERLKPYREKMPNATLKDLA------------HAAYFDRVNLSAQGYYRTPDGYTWGENKGQMF--
ALDO1_ORYSJ     ----------------RKSCAALVERLKPIK----EKAGTLPWKSFIAQASM-----ASVKLTEHAYWDP
YAGR_ECOLI      LREMIASAVGFDPEQSQFADGKI--------TNGTRSATLHEATAGGRLTAE---ESIEFGTLSKEYQQS
XDH_RAT         CQTILKRLEPFKKKK----------PTGPWEAWVMDATSAVSLSATGFYKTPNLGYSFETNSGNPFHY--
XDH_DROSU       CEKLNKRLAPIKEALPQATWQEWI------------NKAYFDRVSLSATGFYAMPGGYHPETNPNA---R
XDH_DROME       CEKLNKRLAPIK----EALPG------GTWK-EWINKAY-FDRVSLSATGFYAMPGGYHPETNPNA---R
XDH_DROPS       CEKLNKRLAPIKEALPQGTWQEWI------------NKAYFDRVSLSATGFYAMPGGYHPETNPNA---R
ALDO3_ARATH     ----------------------------------------------------------------------
ALDO3_ORYSJ     -------------------------------------------------------------LTEHAYWDP
MOP_DESGI       ----------------------------------------------------------------------
ALDO2_ORYSJ     -------------------------------------------------------------LTEHAYWDP
ALDO4_ARATH     -------------------------------------------------------------LSARTFYKP
IORB_BREDI      ----------------------------------------------------------------------
ALDO1_ARATH     --------------------------------------------------------------------DS
ALDOL_ORYSJ     -------------------------------------------------------------LSASAYWVP
ALDO2_ARATH     ----------------------------------------------------------------------
DHAQ_ACEPO      ----------------------------------------------------------------------
DHB4_RAT        ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           TNFTFPAGAYICELEVDPGTGKTSFVNFVAVDDFGRLINPMIVEGQVHGGLVQGIGQALLENAIYDETGQ
DCML_OLICO      PNMTYPFGAYFCIMDIDVDTGVAKTRRFYALDDCGTRINPMIIEGQVHGGLTEAFAVAMGQEIRYDEQGN
DCML_HYDPS      PNFTYPFGIYLCVVDIDRATGETKVRRFYALDDCGTRINPMIIEGQIHGGLTEGYAVAMGQQMPFDAQGN
HCRA_THAAR      ATMGFCYAAQVVEASVDEITGKVTAHKVWVAVDVGKALNPLAVEGQTQGGVWMGMGQALSEETVYD-NGR
XDHA_ECOLI      TTTNPPAGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHXXXXXXXXWALFEEMIIDKSGV
XDHA_ECO57      TTTNPPAGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHXXXXXXXXWALFEEMIIDKSGV
XDHD_BACSU      THFLYSFGAAAVEVEVDLLTGDVKLIDCEHAIAAGPVVSPQGYRGQIEGGAAMALGYTLMEEAKMTD-GR
ADO_HUMAN       ----FVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAIDIGQIEGAFIQGMGLYTIEELNYSPQGI
ADO_RABIT       ----FVYGAACSEVEIDCLTGDHKTIRTDIVMDVGYSINPALDIGQVEGAFIQGMGLYTIEELHYSPQGI
XDHD_ECO57      PDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCGTPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGH
XDHD_ECOLI      PDFAFPYGANFAEVAVNTRTGEIRLDKFYALLDCGTPVNPELALGQIYGATLRAIGHSMSEEIIYDAEGH
ADO_BOVIN       ----FVYGAACSEVEIDCLTGAHKNIRTDIVMDVGYSINPALDVGQIEGAFIQGMGLYTIEELNYSPQGV
ADO_MACFA       ----FVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAIDIGQIEGAFIQGMGLYTIEELNYSPQGV
ADO_RAT         ----FVYGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQVEGAFIQGMGLYTIEELSYSPQGI
XDH_BOVIN       ----FTYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
ADO_MOUSE       ----FVFGAACSEVEINCLTGDHKNIRTNIVMDVGHSINPALDIGQVEGAFIQGMGLYTIEELSYSPQGT
XDH_FELCA       ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
XDH_CALVI       NYFTNGVGSSI--VEIDCLTGDHQVLSTDIVMDIGSSLNPAIDIGQIEGAFMQGYGLFTLEEMIYSPQGV
XDH_CHICK       ----FSYGVACSEVEIDCLTGDHKNIRTDIVMDVGTSLNPAIDIGQIEGAFVQGIGLFTMEELRYSPEGN
XDH_MOUSE       ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
XDH_HUMAN       ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTLEELHYSPEGS
XDH_DICDI       TPFNFNFGAACSEVEIDTLTGDHTTLRSDVILDVGDSLNPTIDIGQVEGAFVQGMGWSTLEEVVTFPSGY
YAGR_ECO57      TF----AGHFV-EVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIXXXXXXXXXXLMEEAVDDRLGY
XDH_EMENI       --FYFTQGVTAAEVEIDTLTGDWTPLRADIKMDVGRTINPSIDYGQIEGAYIQGQGLFTTEESLWHRTGQ
ALDO1_ORYSJ     TFTSYNYGAATSEVEVDVLTGATTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGVGFFTNEEYATNADGL
YAGR_ECOLI      TF----AGHFV-EVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIXXXXXXXXXXLMEEAVDDRLGY
XDH_RAT         ----FSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAFVQGLGLFTMEELHYSPEGS
XDH_DROSU       TYSYYTNGVGISVVEIDCLTGDHQVLSTDIVMDIGSSINPAIDIGQIEGAFMQGYGLFTLEELMYSPQGM
XDH_DROME       TYSYYTNGVGVTVVEIDCLTGDHQVLSTDIVMDIGSSLNPAIDIGQIEGAFMQGYGLFTLEELMYSPQGM
XDH_DROPS       TYSYYTNGVGISVVEIDCLTGDHQVLSTDIVMDIGSSINPAIDIGQIEGAFMQGYGLFTLEELMYSPQGM
ALDO3_ARATH     -------GVGVSEVEVDLVTGKTEILRSDIIYDCGKSLNPAVDLGQTEGAFVQGIGFFMMEEYTTDEKGL
ALDO3_ORYSJ     TFTSYNYGAAISEVEVDVLTGETTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGIGFFTNEEYTTNSDGL
MOP_DESGI       -------GVFMAEVTVDVATGQTTVDGMTLMADLGSLCNQLATDGQIYGGLAQGIGLALSEDFEDIKKHA
ALDO2_ORYSJ     TFTSYNYGAAISEVEVDVLTGETTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGIGFFTNEEYTTNSDGL
ALDO4_ARATH     ESSSLNYGVGASEVEVDLVTGRTEIIRSDIIYDCGKSLNPAVDLGQIEGAFVQGIGFFMYEEYTTNENGL
IORB_BREDI      --------------------------------DVGMVAQPDIVKAQMEGGIIQGLSVALMER-VQVAKGV
ALDO1_ARATH     TGEYLNYGIAASEVEVNVLTGETTILRTDIIYDCGKSLNPAVDLGQIEGAFVQGLGFFMLEEFLMNSDGL
ALDOL_ORYSJ     SNFYLNYGAGTSEVEVDLLTGAITIIRSDLIYDCGKSLNPAVDLGQIEGSFIQGIGFFIYEEHQTNSDGL
ALDO2_ARATH     -------GTAVSEVEVDLVTGQTTVLQTDILYDCGKSLNPAVDLGQIEGSFVQGLGFFMLEEYIEDPEGL
DHAQ_ACEPO      ----------VAQVHVDRSTGVVTCQKLTILVDAGTVVDPDGAKAQTEGAALWGLSMVLFENTEI-VNGM
DHB4_RAT        --------------------------NWVKICDFSNASKPKSIQEST-GGIIEVLHKIDSEGISQNHTGQ


                         .         .         .         .         +         .         .:770
query           LVTASFMDYAMPRADDVPSFKVSHTETLCPGNPLGVKGCGEAGAIGASAAVINAITDAIGHNRLEMPATP
DCML_OLICO      VLGASFMDFFLPTAVETPKWETDYTVTPSPHHPIGAKGVGESPHVGGVPCFSNAVNDALNAGHIQMPHDA
DCML_HYDPS      LLGNTLMDYFLPTAVETPHWETDHTVTPSPHHPIGAKGVAESPHVGSIPTFTAAVVDAFAHTHLDMPHTS
HCRA_THAAR      MVHGNILDYRVPTIVESPDIEVIIVESMDPNGPFGAKEASEGMLAGFLPAIHEAVYEAVGVRATDFPLSP
XDHA_ECOLI      VRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAIRNAVKMATGVAINTLPLTP
XDHA_ECO57      VRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAIRNAVKMATGVAINTLPLTP
XDHD_BACSU      YAAENLDHYLIPGIKDVPDMKLIAIEDLMKGDVYGPRGVGEIGTIAITPAIVKAVHDAVGCWINKLPISR
ADO_HUMAN       LHTRGPDQYKIPAICDMPT--ELHIALLPPSNTLSSKGLGESG-VFLGCSVFFAIHDAVSAARLNSPLTP
ADO_RABIT       LYSRGPNQYKIPAICDIPALNVTFLPPSEKSNTLSSKGLGESG-VFMGCSVFFAIREAVCAARLSSPLTP
XDHD_ECO57      PLTRDLRSYGAPKIGDIPDFRAVLVPSDDKVGPFGAKSISEIGVNGXXXXXXXXXXXXCGIWLREWHFTP
XDHD_ECOLI      PLTRDLRSYGAPKIGDIPDFRAVLVPSDDKVGPFGAKSISEIGVNGXXXXXXXXXXXXCGIWLREWHFTP
ADO_BOVIN       LYTRGPNQYKIPAICDIPELHISFLPPSENSNTLSSKGLGESG-IFLGCSVFFAIHDAIGPLRLNSPLTP
ADO_MACFA       LHTRGPDQYKIPAICDTPTFHISLLPPSENSNTLSSKGLGESG-VFLGCSVFFAIHDAVSAARLNSPLTP
ADO_RAT         LYSRGPNQYKIPAICDIPT--EMHISFLPPSNTLSSKGLGESG-VFLGCSVFFAIHDAVGPWKLTSPLTP
XDH_BOVIN       LHTRGPSTYKIPAFGSIPTFRVSLLRD-CPNKKYASKAVGEP-PLFLGASVFFAIKDAINNNRLDSPATP
ADO_MOUSE       LYSRGPNQYKIPAICDIPT--EMHISFLPPSNTLSSKGLGESG-VFLGCSVFFAIHDAVGPWKLNSPLTP
XDH_FELCA       LHTRGPSTYKIPAFGSIPSFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAICAARLNSPATP
XDH_CALVI       LYSRGPGMYKLPGFADIPG-EFNVTILTGAANPRAVKAVGEPPLIGCSVAIKEAITSARLMNKLESPATS
XDH_CHICK       LYTRGPGMYKIPAFGDIPTFYVSLLRD-CPNSKYSSKAVGEP-PLFLSASVFYAIKDAIYSARLDSPATP
XDH_MOUSE       LHTRGPSTYKIPAFGSIPEFRVSLVRD-CPNKRYASKAVGEPPLFLAS-SIFFAIKDAIRAARLDSPATP
XDH_HUMAN       LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKKYASKAVGEP-PLFLAASIFFAIKDAIGNNRLDSPATP
XDH_DICDI       MFTRGPSTYKIPGFNDVPEFNVSLLGD--APNPKAIKGVGEPPLLGSSVAIRQAITAARLENNLQSPATC
YAGR_ECO57      FVNHDMAGYEVPVHADIPKQEVIFLDDTDPSSPMKAKGVGELGLCGVSAAIANAVYNATGIRVRDYPIT-
XDH_EMENI       IFTKGPGNYKIPGFRDIPQFNVSLLKDVEWENLRTIRGVGEPPLFMGSAAFF-AIRDALKAARKESPATP
ALDO1_ORYSJ     VIHDGTWTYKIPTVDTIP----------------------------------------------------
YAGR_ECOLI      FVNHDMAGYEVPVHADIPKQEVIFLDDTDPSSPMKAKGVGELGLCGVSAAIANAVYNATGIRVRDYPIT-
XDH_RAT         LHTRGPSTYKIPAFGSIPEFRVSLLRD-CPNKRYASKAVGEPPLFLAS-SIFFAIKDAIGDNQLDSPATP
XDH_DROSU       LYSRGPGMYKLPGFADIPEFNVS-----------------------------------------------
XDH_DROME       LYSRGPGMYKLPGFADIPEFNVS-----------------------------------------------
XDH_DROPS       LYSRGPGMYKLPGFADIPEFNVS-----------------------------------------------
ALDO3_ARATH     VVQQGTWDYKIPTVDTIPKFNVEIVNTGHHKNVLSSKASGEPPLLLAASATRSAIREARKHS--------
ALDO3_ORYSJ     VINDGTWTYKIPTVDTIP----------------------------------------------------
MOP_DESGI       TLVGAGFPFIKQIPDKLDIVYVNHPR---PDGPFGASGVGELPLTSPHAAIINAIKSATGVRIYRLPAYP
ALDO2_ORYSJ     VINDGTWTYKIPTVDTIP----------------------------------------------------
ALDO4_ARATH     VNEEGTWDYKIPTIDTIP----------------------------------------------------
IORB_BREDI      LQHSNFHDYPMLRMSQVPQIHVRLVET-----DQAMAGVAELGLLQIGPAINNAFARITGQHLRSLPMRP
ALDO1_ARATH     VVTDSTWTYKIPTVDTIP----------------------------------------------------
ALDOL_ORYSJ     VISNSTWDYKIPSVDTIP--KQFNAEVLNTGRVLSSKASGEAVVLGAS----------------------
ALDO2_ARATH     LLTDSTWTYKIPTVDTIP----------------------------------------------------
DHAQ_ACEPO      PVDRNLNTYTPLRIADTPEMDIEFLPS--TEKPMGL---GEPGTTVVGPAIGNAIFNAVGVRLRHMPVRP
DHB4_RAT        VASADASGFAGVVGHKLPSFSSSYTELQCIMYALGV----------------------------------


                         .         .         *         .         .         .         .:840
query           DRVWHAIHxxx
DCML_OLICO      WRLW-------
DCML_HYDPS      YRVWKSL----
HCRA_THAAR      DRI--------
XDHA_ECOLI      KRLYEEFH---
XDHA_ECO57      KRLYEEFH---
XDHD_BACSU      EELLEAI----
ADO_HUMAN       EKI--------
ADO_RABIT       EKI--------
XDHD_ECO57      EKILTAL----
XDHD_ECOLI      EKILTAL----
ADO_BOVIN       EKI--------
ADO_MACFA       EKI--------
ADO_RAT         EKI--------
XDH_BOVIN       EKIRNA-----
ADO_MOUSE       EKI--------
XDH_FELCA       EKIRNA-----
XDH_CALVI       ARI--------
XDH_CHICK       ERIRNA-----
XDH_MOUSE       EKIRNA-----
XDH_HUMAN       EKIRNA-----
XDH_DICDI       ERI--------
YAGR_ECO57      -----------
XDH_EMENI       ERI--------
ALDO1_ORYSJ     -----------
YAGR_ECOLI      -----------
XDH_RAT         EKIRNA-----
XDH_DROSU       -----------
XDH_DROME       -----------
XDH_DROPS       -----------
ALDO3_ARATH     -----------
ALDO3_ORYSJ     -----------
MOP_DESGI       EKVLEAL----
ALDO2_ORYSJ     -----------
ALDO4_ARATH     -----------
IORB_BREDI      -----------
ALDO1_ARATH     -----------
ALDOL_ORYSJ     -----------
ALDO2_ARATH     -----------
DHAQ_ACEPO      -----------
DHB4_RAT        -----------