[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38351.1

[Show Plain Result]


## Summary of Sequence Search
    1::440
   46::377     1e-40  35%  562 aa  GUN1_ACIC1 RecName: Full=Endoglucanase E1;       
   37::340     8e-32  32%  397 aa  GUN_PAEPO RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
  629::955     4e-24  31% 1039 aa  GUNB_CALSA RecName: Full=Endoglucanase/exoglucanase B;Includes:
   44::424     2e-20  29%  566 aa  GUNG_CLOTH RecName: Full=Endoglucanase G;       
   45::393     1e-19  27%  747 aa  GUND_CELFI RecName: Full=Endoglucanase D;       
   41::365     3e-14  32%  563 aa  GUNB_CLOTH RecName: Full=Endoglucanase B;       
   26::222     3e-09  29%  484 aa  GUNA_XANCP RecName: Full=Major extracellular endoglucanase;        
   26::201     5e-05  37%  499 aa  GUN3_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
  473::558     7e-04  45%  748 aa  GUNC_PSEFL RecName: Full=Endoglucanase C;       
   57::174     7e-04  33%  400 aa  GUNA_PAEBA RecName: Full=Endoglucanase A;       
  130::201     7e-04  39%  499 aa  GUN2_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
  130::201     7e-04  39%  499 aa  GUN1_BACSU RecName: Full=Endoglucanase;         EC=3.2.1.4;AltName:
    1::440

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxPAGRGGYLLPNGYLSTSGSQIVDASGRPVRIASIGWNGTEGPLGAAP
GUN1_ACIC1      -----------------------------------YWHTSGREILDANNVPVRIAGINWFGFE-TCNYVV
GUN_PAEPO       ----------------------------------GYYHTQGNKIVDESGKEAAFNGLNWFGLETP-NYTL
GUNB_CALSA      -----------------------------------WLYVSGNKIVDKDGRPVWLTGINWFGYNTGTNVF-
GUNG_CLOTH      -----------------------------------WLHCKGNKIYDMYGNEVWLTGANWFGFNCSENCF-
GUND_CELFI      -----------------------------------WLHVEGNTIVDSTGKEAILSGVNWFGFNASERVF-
GUNB_CLOTH      -----------------------------------WLHVEGTNIVDKYGNKVWITGANWFG---------
GUNA_XANCP      -----------------------------------YSINNSRQIVDDSGKVVQLKGVNVFGFETG-NHVM
GUN3_BACSU      -----------------------PASAAGTKTPNGQLSIKGTQLVNRDGKAVQLKGISSHGLQ-------
GUNC_PSEFL      ----------------------------------------------------------------------
GUNA_PAEBA      ----------------------------------------------------------------------
GUN2_BACSU      ----------------------------------------------------------------------
GUN1_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SGIWRVSYKTVLDSIVAAGFNAVRIPWTDIGLNAPLNGYSDRLGWINITLNPELLASSTPNSQGRYQYVT
GUN1_ACIC1      HGLWSRDYRSMLDQIKSLGYNTIRLPYSD-----------------------DILKPGTPNSINFYQMLT
GUN_PAEPO       HGLWSRSMDDMLDQVKKEGYNLIRLPYSN-----QLFDSSSRPDSIDYHKNPDLVG------------LN
GUNB_CALSA      DGVWSCNLKDTLAEIANRGFNLLRVPISELILNWSQGIYPKPN--INYYVNPEL--------EGK----N
GUNG_CLOTH      HGAW-YDVKTILTSIADRGINLLRIPISTELLYSWMIGKPNPVSSVTASNNPPYHVVNPDFYDPETDDVN
GUND_CELFI      HGLWSGNITQITQQMAQRGINVVRVPVSTQLL----------LEWKAGTLKPNVNTYANPELEGK----N
GUNB_CLOTH      ---FNCRERMLLDSVADKGINVVRMPIATDLLYA----------WSQGIYPPSTDTSNNPALAGLNSYEL
GUNA_XANCP      HGLWARNWKDMIVQMQGLGFNAVRLPFCPATLRSDTMPAS-----IDYSRNADL------------QGLT
GUN3_BACSU      ---WYGEYVNK-DSL-----KWLRDDWGITVFRAAM--YTADGGIID---NP-----SVKNKM-------
GUNC_PSEFL      ----------------------------------------------------------------------
GUNA_PAEBA      -------------------------------LEATVNGTPNETSWGNPTITPELIKKSAPNYTVNASWLN
GUN2_BACSU      ----------------------------------------------------------------------
GUN1_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TLVAFQRIVDYAQEIGLKVIFNHHTNQGTAGQQRNGLWFDLGPGTDNTDGIVPGRVTAETFKQNWLLVAR
GUN1_ACIC1      SLQVMDKIVAYAGQIGLRIILDRH-RPDCSGQ--SALWYT-------------SSVSEATWISDLQALAQ
GUN_PAEPO       PIQIMDKLIEKAGQRGIQIILDRH-RPGSGGQSE--LWYT-------------SQYPESRWISDWKMLAD
GUNB_CALSA      SLEVFDIVVQTCKEVGLKIMLDIHSIKTDAMGHIYPVWYD-------------EKFTPEDFYKACEWITN
GUNG_CLOTH      SMEIFDIIMGYCKELGIKVMIDIHSPDANNSGHNYELWY--GKET-STCGVVTTKMWIDTLV--WL--AD
GUND_CELFI      SLQIFEYWLTLCQKYGIKVFLDVHSAEADNSGHVYNMWWK-------------GDITTEDVYEGWEWAAT
GUNB_CLOTH      ----FNFMLENFKRVGIKVILDVHSPETDNQGHNYPLWYNT-------------TITEEIFKKAWVWVAE
GUNA_XANCP      SLQILDKVIAEFNARGMYVLLDHHTPDCAGISE---LWY-------------TGSYTEAQWLADLRFVAN
GUN3_BACSU      -----KEAVEAAKELGIYVIIDWHINDGNPNQNKEK--------------------AKEFFKE----MSS
GUNC_PSEFL      -------------------------------------------------------------KQKWLANLR
GUNA_PAEBA      RI---QQVVDYAYNEGLYVVINMH---GDGFHSIPGSWLHVNSSNQN--------VIRDKYQKVWQQVAT
GUN2_BACSU      -------------------------------------WHILNDGNPNQN--------KEKAKEFFKEMSS
GUN1_BACSU      -------------------------------------WHILNDGNPNQN--------KEKAKEFFKEMSS


                         .         .         .         +         .         .         .:280
query           TFANNPTVIGYDLHNEPNGDRGHITWGGGGPTDIKAMCEDVGSAIQDVSPGVLIICEGPETYKPPPASSG
GUN1_ACIC1      RYKGNPTVVGFDLHNEPHDPA---CWGCGDPSDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWG
GUN_PAEPO       RYKNNPTVIGADLHNEPH---GQASWGGNASTDWRLAAQRAGNAILSVNPNWLILVEGVD-----HNVQG
GUNB_CALSA      RYKNDDTIIAFDLKNEPHGDTTFAKWDNS--TDIKYAAETCAKRXXXXXXXXXXVIEGIEAYPKDDVTSS
GUNG_CLOTH      KYKNDDTIIAFDLKNEPHGKRGYTAWDNSDENNWKYAAETCAKAILEVNPKVLIVIEGVETYDTPDATGD
GUND_CELFI      RWKDDDTIVGADIKNEPHGTQGRAKWDGTTDKDFKHFAETASKKILAINPNWLVFVEGVEIYKPPWTSTG
GUNB_CLOTH      RYKNDDTIIGFDLKNEPHTNTGTMKWDDSNPNNWKRVAEETALAILEVHPNVLIFVEGDETFDTSPWTXX
GUNA_XANCP      RYKNVPYVLGLDLKNEPH--XXXXXXXXXXXXDWNKAAERGSAAVLAVAPKWLIAVEG------------
GUN3_BACSU      LYGNTPNVI-YEIANEPNGD---VNW----KRDIKPYAEEVISVIRKNDPDNIII---------------
GUNC_PSEFL      EIAGLSALIGIDVFNEPYD----YTWA-----EWKGMVEEAYQAINEVNPNMLIIVEGPDTSVPVPHGS-
GUNA_PAEBA      RFS-------------------------------------------------------------------
GUN2_BACSU      LYGNTPNVI-YEIANEPNGD---VNW----KRDIKPYAEEVISVIRKNDPDNIII---------------
GUN1_BACSU      LYGNTPNVI-YEIANEPNGD---VNW----KRDIKPYAEEVISVIRKNDPDNIII---------------


                         .         *         .         .         .         .         +:350
query           MDPRHXXXXXXXXXXXXXXVKLKIANKLVYSIHEYPDEISDTKRWGLPEVGKGFIDRMNFTWGYLVRDNI
GUN1_ACIC1      GNLQ---------GAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTFPNNMPGIWNKNWGYLFNQNI
GUN_PAEPO       NNSQYWWGGNLTGVANYPVV-LDVPNRVVYSPHDYGPGVSSQPWFNDPAFPSNLPAIWDQTWGYISKQNI
GUNB_CALSA      SDYYSTWWGGNLRGVRKYPINLKYQNKVVYSPHDYGPSVYQ-QPWFYPGFTKESLDCWRPNWAYIMEENI
GUNG_CLOTH      ASPWYAWWGGNLRGVKDYPIDLPLNSQIVYSPHDYGPSV-----YAQPWFEKDFTDYWYDTWAYIHDQGI
GUND_CELFI      LDYYGTWWGGNLRGVRDHPIDLGAQDQLVYSPHDYGPLVFDQK-WFQKDFDKASLDVWGPNWLFIHDEDI
GUNB_CLOTH      XXXXXXXXXXXLRGVKDYPINLKYQSQLVYSPHDYGPIVYE-QDWANDEQAKRILYEQCWNWAYIMEEGI
GUNA_XANCP      ----------------------------------------------------------------------
GUN3_BACSU      ----------------------------------------------------------------------
GUNC_PSEFL      ----------------------------------------------------------------------
GUNA_PAEBA      ----------------------------------------------------------------------
GUN2_BACSU      ----------------------------------------------------------------------
GUN1_BACSU      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           APVWIGEMGASLRTPETREWARNLIDYMNGKYGQEGGPTFSGDQQPVSGSWWLIGPSNDPPFGLQTEWxx
GUN1_ACIC1      APVWLGEFGTTLQSTTDQTWLKTLVQYLR--------PTAQYGADSFQWTFWSWNPDSGDTGGLKDDW--
GUN_PAEPO       APVLVGEFGVDLSCPEGK-WQNALVHYI------------------------------------------
GUNB_CALSA      APLLIGEWGGHLDGADNEKWMKYLRDYI------------------------------------------
GUNG_CLOTH      APILIGEWGGHMDGGKNQKWMTLLRDYI--------------VQNRIHHTFWCINPNSGDTGGL------
GUND_CELFI      APLLIGEWGGRLQDPRQDKWMAALRDLV--------------AERRLSQTFWVLNPNSGDTGGL------
GUNB_CLOTH      SPLLLGEWG-------------------------------------------------------------
GUNA_XANCP      ----------------------------------------------------------------------
GUN3_BACSU      ----------------------------------------------------------------------
GUNC_PSEFL      ----------------------------------------------------------------------
GUNA_PAEBA      ----------------------------------------------------------------------
GUN2_BACSU      ----------------------------------------------------------------------
GUN1_BACSU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxx
GUN1_ACIC1      --------------------
GUN_PAEPO       --------------------
GUNB_CALSA      --------------------
GUNG_CLOTH      --------------------
GUND_CELFI      --------------------
GUNB_CLOTH      --------------------
GUNA_XANCP      --------------------
GUN3_BACSU      --------------------
GUNC_PSEFL      --------------------
GUNA_PAEBA      --------------------
GUN2_BACSU      --------------------
GUN1_BACSU      --------------------