[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38352.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
   34::220     2e-23  32%  257 aa  TARA_BACSU RecName: Full=Putative N-acetylmannosaminyltransferase; 
   34::235     5e-23  31%  256 aa  TAGA_BACSU RecName: Full=Putative N-acetylmannosaminyltransferase; 
   43::241     1e-19  30%  248 aa  WECG_KLEP7 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-19  29%  246 aa  WECG_KLEP3 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   40::231     1e-18  29%  245 aa  WECG_PHOLL RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     5e-18  30%  246 aa  WECG_YERPY RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     5e-18  30%  246 aa  WECG_YERPS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     5e-18  30%  246 aa  WECG_YERPB RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     5e-18  30%  246 aa  WECG_YERP3 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   22::240     5e-18  30%  246 aa  WECG_SERP5 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     2e-17  29%  246 aa  WECG_YERPP RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     2e-17  29%  246 aa  WECG_YERPN RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     2e-17  29%  246 aa  WECG_YERPG RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     2e-17  29%  246 aa  WECG_YERPE RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::240     2e-17  29%  246 aa  WECG_YERPA RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALTY RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALPB RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALNS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALG2 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALEP RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  32%  246 aa  WECG_SALDC RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-17  29%  246 aa  WECG_CITK8 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   44::241     3e-17  26%  254 aa  TAGA_STAAR RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::243     4e-17  28%  249 aa  WECG_PECCP RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   44::241     4e-17  26%  254 aa  TAGA_STAAW RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::241     4e-17  26%  254 aa  TAGA_STAAU RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::241     4e-17  26%  254 aa  TAGA_STAAS RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::241     4e-17  26%  254 aa  TAGA_STAAN RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::241     4e-17  26%  254 aa  TAGA_STAAM RecName: Full=Putative N-acetylmannosaminyltransferase; 
   44::241     4e-17  26%  254 aa  TAGA_STAAC RecName: Full=Putative N-acetylmannosaminyltransferase; 
   41::239     7e-17  31%  246 aa  WECG_SALSV RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     7e-17  32%  246 aa  WECG_SALPC RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     7e-17  32%  246 aa  WECG_SALHS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     7e-17  32%  246 aa  WECG_SALCH RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     7e-17  32%  246 aa  WECG_SALA4 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   40::231     7e-17  27%  245 aa  WECG_PROMH RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-16  32%  246 aa  WECG_SALTI RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     2e-16  32%  246 aa  WECG_SALPK RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     2e-16  32%  246 aa  WECG_SALPA RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     2e-16  29%  246 aa  WECG_ECO5E RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     2e-16  29%  246 aa  WECG_ECO57 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-16  29%  246 aa  WECG_ESCF3 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     3e-16  30%  246 aa  WECG_SALAR RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     6e-16  28%  246 aa  WECG_ECOUT RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     6e-16  28%  246 aa  WECG_ECOK1 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     6e-16  28%  246 aa  WECG_ECO45 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   44::243     8e-16  28%  249 aa  WECG_ERWCT RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHISS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHIFL RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHIF8 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHIDS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHIBS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_SHIB3 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOSM RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOSE RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOLU RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOLC RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOL6 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOL5 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECOHS RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO8A RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO81 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO7I RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO55 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO27 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     1e-15  28%  246 aa  WECG_ECO24 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   42::220     5e-15  28%  247 aa  WECG_ENTS8 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     5e-15  28%  246 aa  WECG_ECOLI RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     5e-15  28%  246 aa  WECG_ECODH RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   41::239     5e-15  28%  246 aa  WECG_ECOBW RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
   42::229     3e-14  26%  247 aa  WECG_ENT38 RecName: Full=Probable UDP-N-acetyl-D-mannosaminuronic
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TARA_BACSU      ----------------------------------------------------------------------
TAGA_BACSU      ----------------------------------------------------------------------
WECG_KLEP7      ----------------------------------------------------------------------
WECG_KLEP3      ----------------------------------------------------------------------
WECG_PHOLL      ----------------------------------------------------------------------
WECG_YERPY      ----------------------------------------------------------------------
WECG_YERPS      ----------------------------------------------------------------------
WECG_YERPB      ----------------------------------------------------------------------
WECG_YERP3      ----------------------------------------------------------------------
WECG_SERP5      ----------------------------------------------------------------------
WECG_YERPP      ----------------------------------------------------------------------
WECG_YERPN      ----------------------------------------------------------------------
WECG_YERPG      ----------------------------------------------------------------------
WECG_YERPE      ----------------------------------------------------------------------
WECG_YERPA      ----------------------------------------------------------------------
WECG_SALTY      ----------------------------------------------------------------------
WECG_SALPB      ----------------------------------------------------------------------
WECG_SALNS      ----------------------------------------------------------------------
WECG_SALG2      ----------------------------------------------------------------------
WECG_SALEP      ----------------------------------------------------------------------
WECG_SALDC      ----------------------------------------------------------------------
WECG_CITK8      ----------------------------------------------------------------------
TAGA_STAAR      ----------------------------------------------------------------------
WECG_PECCP      ----------------------------------------------------------------------
TAGA_STAAW      ----------------------------------------------------------------------
TAGA_STAAU      ----------------------------------------------------------------------
TAGA_STAAS      ----------------------------------------------------------------------
TAGA_STAAN      ----------------------------------------------------------------------
TAGA_STAAM      ----------------------------------------------------------------------
TAGA_STAAC      ----------------------------------------------------------------------
WECG_SALSV      ----------------------------------------------------------------------
WECG_SALPC      ----------------------------------------------------------------------
WECG_SALHS      ----------------------------------------------------------------------
WECG_SALCH      ----------------------------------------------------------------------
WECG_SALA4      ----------------------------------------------------------------------
WECG_PROMH      ----------------------------------------------------------------------
WECG_SALTI      ----------------------------------------------------------------------
WECG_SALPK      ----------------------------------------------------------------------
WECG_SALPA      ----------------------------------------------------------------------
WECG_ECO5E      ----------------------------------------------------------------------
WECG_ECO57      ----------------------------------------------------------------------
WECG_ESCF3      ----------------------------------------------------------------------
WECG_SALAR      ----------------------------------------------------------------------
WECG_ECOUT      ----------------------------------------------------------------------
WECG_ECOK1      ----------------------------------------------------------------------
WECG_ECO45      ----------------------------------------------------------------------
WECG_ERWCT      ----------------------------------------------------------------------
WECG_SHISS      ----------------------------------------------------------------------
WECG_SHIFL      ----------------------------------------------------------------------
WECG_SHIF8      ----------------------------------------------------------------------
WECG_SHIDS      ----------------------------------------------------------------------
WECG_SHIBS      ----------------------------------------------------------------------
WECG_SHIB3      ----------------------------------------------------------------------
WECG_ECOSM      ----------------------------------------------------------------------
WECG_ECOSE      ----------------------------------------------------------------------
WECG_ECOLU      ----------------------------------------------------------------------
WECG_ECOLC      ----------------------------------------------------------------------
WECG_ECOL6      ----------------------------------------------------------------------
WECG_ECOL5      ----------------------------------------------------------------------
WECG_ECOHS      ----------------------------------------------------------------------
WECG_ECO8A      ----------------------------------------------------------------------
WECG_ECO81      ----------------------------------------------------------------------
WECG_ECO7I      ----------------------------------------------------------------------
WECG_ECO55      ----------------------------------------------------------------------
WECG_ECO27      ----------------------------------------------------------------------
WECG_ECO24      ----------------------------------------------------------------------
WECG_ENTS8      ----------------------------------------------------------------------
WECG_ECOLI      ----------------------------------------------------------------------
WECG_ECODH      ----------------------------------------------------------------------
WECG_ECOBW      ----------------------------------------------------------------------
WECG_ENT38      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DRAETAKVMVDEALKRRGQWRYPAYMTSTNGEVTYRCAVDPSERAMFLEADAIHADGMPHVFVSRFKCQT
TARA_BACSU      -----------------------AFIVTANPEIGFEAMQNPRYEAVLSSADFILPDGIGVVMVSKL-IGK
TAGA_BACSU      -----------------------AVISTVNPEIAFAAIKDRDYFDVLSSSNFILPDGIGVVMMSRLT-NN
WECG_KLEP7      -------------------------LVAINAEKMLAVEDNPEVRALIEAAEFKYADGISVVRSLRKKYPQ
WECG_KLEP3      -------------------------LVAINAEKMLAVEDNPEVRALIEAAEFKYADGISVVRSLRKKYPQ
WECG_PHOLL      -------------------------MVAINAEKVLTAEEDTALSTLLSDAEYLYADGISIVRAIRRKYPD
WECG_YERPY      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPS      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPB      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERP3      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_SERP5      DMAQCMDFLFDGGRVKRGT------LVAMNAEKILTAEQDTELHALLDEAEYKYADGISMVRSIRRKYPG
WECG_YERPP      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPN      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPG      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPE      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_YERPA      -------------------------LVAMNAEKLLKAEDDTALCELIKNAEYLYADGISMVRAIRRKYPQ
WECG_SALTY      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALPB      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALNS      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALG2      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALEP      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALDC      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_CITK8      -------------------------LVAINAEKMLTAEDDPEVRALIDAAEFKYADGISVVRSVRKKFPQ
TAGA_STAAR      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
WECG_PECCP      -------------------------LVAINAEKVLTAEKDVALRTLLDRAEYKYADGISIVRSIRRKYPQ
TAGA_STAAW      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
TAGA_STAAU      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
TAGA_STAAS      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
TAGA_STAAN      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
TAGA_STAAM      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
TAGA_STAAC      ------------------------FIVTANPEIVNYATTHQAYLELINQASYIVADGTGVVKASH-RLKQ
WECG_SALSV      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALPC      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALHS      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALCH      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALA4      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_PROMH      -------------------------LIAINAEKILTAETDKGLNQLLDEADYLYADGISVVRGIRRKYPD
WECG_SALTI      -------------------------LVAINAEKLLTAEDNPEVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_SALPK      -------------------------LVAINAEKLLTAEDNPEVRALIGAAEFKYADGISVVRSIRKKFPQ
WECG_SALPA      -------------------------LVAINAEKLLTAEDNPEVRALIGAAEFKYADGISVVRSIRKKFPQ
WECG_ECO5E      -------------------------LVAINAEKMLTIEENAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO57      -------------------------LVAINAEKMLTIEENAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ESCF3      -------------------------LVAINAEKMLTIEDNAEVRALINAAEFKYADGISVVRSVRKKYPQ
WECG_SALAR      -------------------------LVAINAEKLLTAEDNPDVRALIAAAEFKYADGISVVRSIRKKFPQ
WECG_ECOUT      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOK1      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO45      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ERWCT      -------------------------LVAINAEKVLTAEKEVALRTLLDRAEYKYADGISIVRSIRRKYPQ
WECG_SHISS      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_SHIFL      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISIVRSVRKKYPQ
WECG_SHIF8      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_SHIDS      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_SHIBS      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_SHIB3      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOSM      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOSE      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOLU      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOLC      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOL6      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOL5      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOHS      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO8A      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO81      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO7I      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO55      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO27      -------------------------LVAINAEKILTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECO24      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ENTS8      -------------------------LVAINAEKMLALEADAEVRSLIEAAEFKYADGISVVRSVRKKYPQ
WECG_ECOLI      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECODH      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ECOBW      -------------------------LVAINAEKMLTIEDNAEVRELINAAEFKYADGISVVRSVRKKYPQ
WECG_ENT38      -------------------------LVAINAEKMLAIEDNAEVKGLIEAAEFKYADGISVVRSIRKKYPQ


                         +         .         .         .         .         *         .:210
query           PLPERVATTDLFHDVAREASVRGATMFMLGADETSNRLATELVKRRYPKLKLVGRRNGFFADEAEEIAAC
TARA_BACSU      PLQSRIAGYDLFTSLLDKADQKKKRVFFYGAAKHVIAETIERVKRDFPGIEIAGYSDGYVKDQRE---VA
TAGA_BACSU      RLQSRIAGYDVFKELLGVANKKKKRIFLYGAKKDVIKGVVSKISSEYPNIKIAGYSDGYVQDRT---LVA
WECG_KLEP7      AQVSRVAGADLWEALMQRAGAEGTPVFLVGGKPEVLAQTESRLRQRW-QVNIVGSQDGYFTPEQRQ-ALF
WECG_KLEP3      AQVSRVAGADLWEALMQRAGAEGTPVFLVGGKPEVLTQTESRLRQRW-QVNIVGSQDGYFTPEQRQ-TLF
WECG_PHOLL      TEVSRVAGADLWEAIMERAGKEGTPIFLVGGKPEILK-QTESKLRAQWNVNIVGSQNGYFTPE-ERNAVF
WECG_YERPY      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPS      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPB      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERP3      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_SERP5      ADVSRVAGADLWEALMQRAGREGTPVFLIGG-KPSVLAETEQKLRSQWNVNLVGSQDGYFKPEQRE-PLF
WECG_YERPP      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPN      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPG      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPE      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_YERPA      AELSRVAGADLWEALMQRAGQQGTPVFLVGG-KPDVLAETEAKLRAQWNVNLVGSQDGYFTPEQREALFA
WECG_SALTY      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALPB      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALNS      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALG2      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALEP      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALDC      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_CITK8      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRAQWNVNIVGSQDGYFKPEQRQ-ALF
TAGA_STAAR      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVGEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
WECG_PECCP      ADVTRIAGADLWEALMERAGKEGTPVFLVGG-KPDVLAQTEAKLRAQWNVNIVGSQDGYFAPEQRD-ALF
TAGA_STAAW      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
TAGA_STAAU      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
TAGA_STAAS      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
TAGA_STAAN      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
TAGA_STAAM      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
TAGA_STAAC      PLAHRIPGIELMDECLKIAHVNHQKVFLLGATNEVVEAAQYALQQRYPNISFA-HHHGYIDLEDETVV--
WECG_SALSV      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQ-ALF
WECG_SALPC      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALHS      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALCH      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALA4      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_PROMH      AQVSRIAGADLWEALMERAGKEGTPVFLVGGKPQVLAQTESKLKAQW-NVNIVGSQDGYFTPQDRD-ALF
WECG_SALTI      AQVSRVAGADLWEALMARAGKEGTPVFFVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALPK      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_SALPA      AQVSRVAGADLWEALMARAGKEGTPVFLVGG-KPEVLAQTEAKLRTQWNVNIVGSQDGYFTPEQRQALFA
WECG_ECO5E      AQVSRVAGADLWEELMARAGKEGTTVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO57      AQVSRVAGADLWEELMARAGKEGTTVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ESCF3      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SALAR      AQVSRVAGADLWEALMARAGKEGTPVFLIGGKPEVLAQTEEKLRAQW-NVNIVGSQDGYFTPEQSQALFA
WECG_ECOUT      AQVSRVAGADLWEELMARAGKEGTQVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOK1      AQVSRVAGADLWEELMARAGKEGTQVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO45      AQVSRVAGADLWEELMARAGKEGTQVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ERWCT      ADVTRIAGADLWEALMERAGKQETPVFLVGG-KPDVLAQTEAKLRAQWDVNIVGSQDGYFTPEQRD-ALF
WECG_SHISS      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SHIFL      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SHIF8      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SHIDS      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SHIBS      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_SHIB3      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOSM      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOSE      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOLU      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOLC      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOL6      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOL5      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOHS      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO8A      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO81      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO7I      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTETKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO55      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO27      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECO24      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ENTS8      AKVSRVAGADLWEALMARAGREGTPVFLVGGKPQVLAQTIEKLKRQW-NVNIVDAQDGYFKPE-ERAALF
WECG_ECOLI      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECODH      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ECOBW      AQVSRVAGADLWEELMARAGKEGTPVFLVGG-KPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQ-ALF
WECG_ENT38      ARVSRVAGADLWEALMARAGAANTPVFLIGG-KPEVLSQTEQKLRAQWNVNIVGSQDGYFKPEDRQ-ALF


                         .         .         .         +         .         .         .:280
query           RQIAELAPDILWISMGVPREQVFIRRHRHRLTTVGIIKTSGGLFDFLSGSKARAPQWMQRIGLEWLWRMA
TARA_BACSU      DKIAASTPDMVFVALGYPNQEFFIHKYRH-LFPQAVAVGLGGSFDVFSGNVKRAPSFFIRFHLEWMYRLL
TAGA_BACSU      KQIARANPDMVFVALGYPHQEKFIHNYRHKAVSIGL----GGSFDVFSGNVKRAPSWMIRLNLEWFYRLI
WECG_KLEP7      ERIRDSGAKIVTVAMGSPRQEIFMRDCR-RLYPHALYMGVGGTYDVFTGHVHRAPKFWQDLGLEWFYRLL
WECG_KLEP3      ERIRDSGAKIVTVAMGSPRQEIFMRDCR-RLYPHALYMGVGGTYDVFTGHVHRAPKFWQDLGLEWFYRLL
WECG_PHOLL      ERIHASGAVIVTVAMGSPKQEIFMRDCR-KIHSNALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLYRLL
WECG_YERPY      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLL
WECG_YERPS      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLL
WECG_YERPB      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLL
WECG_YERP3      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLL
WECG_SERP5      ERIRASGAAIVTVAMGSPKQEILMRDCR-KVHPQALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLL
WECG_YERPP      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
WECG_YERPN      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
WECG_YERPG      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
WECG_YERPE      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
WECG_YERPA      R-IAASGAAIVTVAMGSPKQEIFMRDCR-KFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLL
WECG_SALTY      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALPB      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALNS      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALG2      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALEP      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALDC      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_CITK8      ERIHASGAKIVTVAMGSPKQEILMRDCRV-IHPQALYMGVGGTYDVFTGHVKRAPKMWQTLGLEWLYRLL
TAGA_STAAR      KRIELFKPDYIFVGMGFPKQEEWIMTHENQFESK-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
WECG_PECCP      ERIRASGAQFVTVAMGSPRQEILMRDCRHHYPDA-LYMGVGGTYDVFTGHVKRAPLVWQNLGLEWLYRLL
TAGA_STAAW      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
TAGA_STAAU      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
TAGA_STAAS      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
TAGA_STAAN      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
TAGA_STAAM      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
TAGA_STAAC      KRIKLFKPDYIFVGMGFPKQEEWIMTHENQFEST-VMMGVGGSLEVFAGAKKRAPYIFRKLNIEWIYRAL
WECG_SALSV      SRIHASGAKIVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALPC      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALHS      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALCH      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALA4      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_PROMH      ERIKASGAKIVTIAMGSPKQELFIRACR-QVHPDALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLYRLL
WECG_SALTI      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALPK      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_SALPA      RIHASGAK-IVTVAMGSPKQELLMRDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_ECO5E      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO57      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ESCF3      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SALAR      RIHASGA-QIVTVAMGSPKQEIVMHDHPHALY-MGV----GGTYDVFTGHVKRAPKIWQNLGLEWLYRLL
WECG_ECOUT      ERIHASGAQIVTVAMGAPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOK1      ERIHASGAQIVTVAMGAPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO45      ERIHASGAQIVTVAMGAPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ERWCT      ERIRASGAQIVTVAMGSPRQEILMRDCRHHYPDA-LYMGIGGTYDVFTGHVKRAPLVWQNLGLEWLYRLL
WECG_SHISS      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SHIFL      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SHIF8      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SHIDS      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SHIBS      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_SHIB3      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOSM      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOSE      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOLU      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOLC      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOL6      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOL5      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOHS      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO8A      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO81      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO7I      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO55      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO27      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECO24      ERIHASGAQIVTVAMGSPKQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ENTS8      ARIRDSGAQIVTVAMGSPRQEIFMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKAWQNLGLEWLY---
WECG_ECOLI      ERIHASGAQIVTVAMGSPKQEIIMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECODH      ERIHASGAQIVTVAMGSPKQEIIMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ECOBW      ERIHASGAQIVTVAMGSPKQEIIMRDCR-LVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLL
WECG_ENT38      ERVRDSGAKIVTVAMGSPRQEILMRDCR-MICPDALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLL


                         .         *         .         .         .         .         +:350
query           LEPRRLGMRYLKTNPYAMYLLxxxxx
TARA_BACSU      TNPAR---------------------
TAGA_BACSU      LNPWR-WKRMLSIPKYALTVL-----
WECG_KLEP7      LQPSRIKLRYLR--------------
WECG_KLEP3      LQPSRIKLRYLR--------------
WECG_PHOLL      SQPSRIRRQF----------------
WECG_YERPY      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPS      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPB      AQPSRI-RRQLKLLKFVGY-------
WECG_YERP3      AQPSRI-RRQLKLLKFVGY-------
WECG_SERP5      SQPSRLGLRLLKFVSY----------
WECG_YERPP      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPN      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPG      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPE      AQPSRI-RRQLKLLKFVGY-------
WECG_YERPA      AQPSRI-RRQLKLLKFVGY-------
WECG_SALTY      SQPRRITLRYLR--------------
WECG_SALPB      SQPRRITLRYLR--------------
WECG_SALNS      SQPRRITLRYLR--------------
WECG_SALG2      SQPRRITLRYLR--------------
WECG_SALEP      SQPRRITLRYLR--------------
WECG_SALDC      SQPRRITLRYLR--------------
WECG_CITK8      SQPSRITLRYLR--------------
TAGA_STAAR      IDWKRIGR--LKSIPIFMY-------
WECG_PECCP      SQPSRI-FRQFKLLKYVAY-------
TAGA_STAAW      MDWKRIGR--LKSIPIFMY-------
TAGA_STAAU      IDWKRIGR--LKSIPIFMY-------
TAGA_STAAS      IDWKRIGR--LKSIPIFMY-------
TAGA_STAAN      IDWKRIGR--LKSIPIFMY-------
TAGA_STAAM      IDWKRIGR--LKSIPIFMY-------
TAGA_STAAC      IDWKRIGR--LKSIPIFMY-------
WECG_SALSV      SQPKRITLRYLR--------------
WECG_SALPC      SQPKRITLRYLR--------------
WECG_SALHS      SQPKRITLRYLR--------------
WECG_SALCH      SQPKRITLRYLR--------------
WECG_SALA4      SQPKRITLRYLR--------------
WECG_PROMH      SQPSRIKRQF----------------
WECG_SALTI      SQPKRITLRYLR--------------
WECG_SALPK      SQPKRITLRYLR--------------
WECG_SALPA      SQPKRITLRYLR--------------
WECG_ECO5E      SQPSRIKLRYLR--------------
WECG_ECO57      SQPSRIKLRYLR--------------
WECG_ESCF3      SQPSRIKLRYLR--------------
WECG_SALAR      SQPSRITLRYLR--------------
WECG_ECOUT      SQPSRIKLRYLR--------------
WECG_ECOK1      SQPSRIKLRYLR--------------
WECG_ECO45      SQPSRIKLRYLR--------------
WECG_ERWCT      SQPSRI-FRQLRLLKYVAY-------
WECG_SHISS      SQPSRIKLRYLR--------------
WECG_SHIFL      SQPSRIKLRYLR--------------
WECG_SHIF8      SQPSRIKLRYLR--------------
WECG_SHIDS      SQPSRIKLRYLR--------------
WECG_SHIBS      SQPSRIKLRYLR--------------
WECG_SHIB3      SQPSRIKLRYLR--------------
WECG_ECOSM      SQPSRIKLRYLR--------------
WECG_ECOSE      SQPSRIKLRYLR--------------
WECG_ECOLU      SQPSRIKLRYLR--------------
WECG_ECOLC      SQPSRIKLRYLR--------------
WECG_ECOL6      SQPSRIKLRYLR--------------
WECG_ECOL5      SQPSRIKLRYLR--------------
WECG_ECOHS      SQPSRIKLRYLR--------------
WECG_ECO8A      SQPSRIKLRYLR--------------
WECG_ECO81      SQPSRIKLRYLR--------------
WECG_ECO7I      SQPSRIKLRYLR--------------
WECG_ECO55      SQPSRIKLRYLR--------------
WECG_ECO27      SQPSRIKLRYLR--------------
WECG_ECO24      SQPSRIKLRYLR--------------
WECG_ENTS8      --------------------------
WECG_ECOLI      SQPSRIKLRYLR--------------
WECG_ECODH      SQPSRIKLRYLR--------------
WECG_ECOBW      SQPSRIKLRYLR--------------
WECG_ENT38      SQPSRI--------------------