[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38484.1

[Show Plain Result]


## Summary of Sequence Search
    1::489
   72::531     2e-81  39%  535 aa  D2HDH_RAT RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   69::528     2e-81  40%  533 aa  D2HDH_DANRE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   72::531     1e-80  39%  535 aa  D2HDH_MOUSE RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   76::540     2e-79  40%  544 aa  D2HDH_BOVIN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   79::517     6e-76  39%  521 aa  D2HDH_HUMAN RecName: Full=D-2-hydroxyglutarate dehydrogenase,
   82::530     6e-73  35%  530 aa  DLD2_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 2,
   62::524     1e-72  38%  526 aa  YN53_SCHPO RecName: Full=Putative D-lactate dehydrogenase C713.03,
    9::496     1e-65  33%  496 aa  DLD3_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 3;   
   37::457     4e-48  34%  470 aa  GLCD_BACSU RecName: Full=Glycolate oxidase subunit glcD;
   27::484     2e-43  30%  484 aa  LDHD_MOUSE RecName: Full=Probable D-lactate dehydrogenase,
   30::507     4e-38  32%  507 aa  LDHD_HUMAN RecName: Full=Probable D-lactate dehydrogenase,
   40::470     3e-37  29%  499 aa  GLCD_ECOLI RecName: Full=Glycolate oxidase subunit glcD;
   40::470     3e-37  29%  499 aa  GLCD_ECOL6 RecName: Full=Glycolate oxidase subunit glcD;
  153::574     3e-29  31%  587 aa  DLD1_YEAST RecName: Full=D-lactate dehydrogenase [cytochrome] 1,
  146::566     8e-25  26%  576 aa  DLD1_KLULA RecName: Full=D-lactate dehydrogenase [cytochrome],
   41::539     4e-20  28% 1018 aa  YDIJ_ECOLI RecName: Full=Uncharacterized protein ydiJ;
  143::587     3e-15  28%  611 aa  ADAS_DICDI RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
   44::542     4e-14  26% 1027 aa  Y1163_HAEIN RecName: Full=Uncharacterized protein HI1163;
  133::304     3e-13  28%  613 aa  ADAS_TRYBB RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
   54::479     4e-13  29%  484 aa  YGCU_ECOLI RecName: Full=Uncharacterized FAD-linked oxidoreductase
   54::479     4e-13  29%  484 aa  YGCU_ECO57 RecName: Full=Uncharacterized FAD-linked oxidoreductase
    5::118     2e-12  37%  564 aa  LDHD_HAEIN RecName: Full=D-lactate dehydrogenase;       
  125::580     2e-12  28%  597 aa  ADAS_CAEEL RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
  208::385     3e-12  28%  658 aa  ADAS_CAVPO RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  195::372     5e-12  27%  645 aa  ADAS_MOUSE RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  208::385     8e-12  28%  658 aa  ADAS_HUMAN RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  194::371     2e-11  31%  644 aa  ADAS_RAT RecName: Full=Alkyldihydroxyacetonephosphate synthase,
  155::338     3e-10  25%  631 aa  ADAS_DROME RecName: Full=Alkyldihydroxyacetonephosphate synthase;  
   18::170     4e-08  25%  350 aa  GLCE_ECOLI RecName: Full=Glycolate oxidase subunit glcE;
   18::195     6e-07  27%  440 aa  GGLO_MOUSE RecName: Full=L-gulonolactone oxidase;       
   74::320     4e-06  27%  560 aa  VAOX_PENSI RecName: Full=Vanillyl-alcohol oxidase;       
   17::107     4e-06  36%  571 aa  DLD_ECOLI RecName: Full=D-lactate dehydrogenase;       
   65::242     1e-05  27%  524 aa  CKX7_ARATH RecName: Full=Cytokinin dehydrogenase 7;       
   36::197     3e-05  24%  305 aa  MURB_CLOTH RecName: Full=UDP-N-acetylenolpyruvoylglucosamine
   73::193     3e-05  27%  461 aa  ALO_SCHPO RecName: Full=D-arabinono-1,4-lactone oxidase;       
   22::262     4e-05  22%  521 aa  DH4C_PSEPU RecName: Full=4-cresol dehydrogenase [hydroxylating]
  159::230     6e-05  33%  567 aa  DIM_PEA RecName: Full=Cell elongation protein diminuto;
   65::282     7e-05  30%  583 aa  GLDH2_ORYSJ RecName: Full=L-galactono-1,4-lactone dehydrogenase 2,
  109::247     7e-05  25%  525 aa  DIML_CAEEL RecName: Full=Diminuto-like protein;
   72::269     1e-04  26%  534 aa  CKX1_MAIZE RecName: Full=Cytokinin dehydrogenase 1;       
   66::195     2e-04  28%  440 aa  GGLO_RAT RecName: Full=L-gulonolactone oxidase;         Short=LGO; 
  110::250     2e-04  24%  561 aa  DIM_ARATH RecName: Full=Cell elongation protein DIMINUTO;AltName:
   62::247     2e-04  27%  504 aa  CKX6_ARATH RecName: Full=Cytokinin dehydrogenase 6;       
   89::288     2e-04  27%  600 aa  GLDH_BRAOL RecName: Full=L-galactono-1,4-lactone dehydrogenase,
   99::196     3e-04  30%  610 aa  GLDH_ARATH RecName: Full=L-galactono-1,4-lactone dehydrogenase,
   29::245     6e-04  28%  540 aa  CKX5_ARATH RecName: Full=Cytokinin dehydrogenase 5;       
   26::195     8e-04  24%  440 aa  GGLO_PIG RecName: Full=L-gulonolactone oxidase;         Short=LGO; 
    1::489

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLR
D2HDH_RAT       ---------------------PFSTVSEEDLAAFECIIPGR-VITDPEQLQTCNVDWLRTVRGCSKVLLR
D2HDH_DANRE     ---------------------PFSRVTQEDLSFFRALLPGR-TITDPDLLKSSNVDWLKTVQGSSDVLLR
D2HDH_MOUSE     ---------------------PFSTVSEEDLAAFECIIPGR-VITDPEQLQTCNVDWLKTVRGCSKVLLR
D2HDH_BOVIN     ---------------------PVQRLPFSVVSELAALVVPGRVITDPEELEPPNVDWLRTVRGSSKVLLR
D2HDH_HUMAN     -------------------------------------------VTDPEALQAPNVDWLRTLRGCSKVLLR
DLD2_YEAST      --------------------------------------------SESEDLSFYNEDWMRKYKGQSKLVLR
YN53_SCHPO      -----------------------------IIGKDGSLIDGLDKSTDPADLDAFNIDWMNKYRGKTQLALK
DLD3_YEAST      -------QLTAEAYPKVKRNPNFKVLDSEDLAYFRSILSNDEILNSPEELASFNQDWMKKYRGQSNLILL
GLCD_BACSU      ------------------------------------------------------------YQSMPDAVIA
LDHD_MOUSE      -------------------------LSQDFVEALKAVVGSPHVSTASAVREQHGHDE-SMHRCQPPAVVW
LDHD_HUMAN      ----------------------------DFVEALKAVVGGSHVSTAAVVREQHGRDE-SVHRCEPPAVVW
GLCD_ECOLI      ------------------------------------------------EIIPYECDGLSAYRTRPLLVVL
GLCD_ECOL6      ------------------------------------------------EIIPYECDGLSAYRTRPLLVVL
DLD1_YEAST      ------------------------------------------------------------------IILF
DLD1_KLULA      ------------------------------------------------------------------IVLY
YDIJ_ECOLI      -----------------------------------------------------MSTDNSIYQLLPDAVVF
ADAS_DICDI      ------------------------------------------------------------------LIVL
Y1163_HAEIN     --------------------------------------------------------DNSVYQQLPQAILF
ADAS_TRYBB      -------------------------------------------------------------------VIL
YGCU_ECOLI      -------------------------------------------------------------------VVK
YGCU_ECO57      -------------------------------------------------------------------VVK
LDHD_HAEIN      ----------------------------QLISRLTDIVGSRYIITDPTKTEAY----RSGYRGNALAVVR
ADAS_CAEEL      ----------------------------------------------------------NLREGKIPIVVW
ADAS_CAVPO      ------------------------------------------------------------------IVLW
ADAS_MOUSE      ------------------------------------------------------------------IVVW
ADAS_HUMAN      ------------------------------------------------------------------IVLW
ADAS_RAT        ------------------------------------------------------------------IVVW
ADAS_DROME      ------------------------------------------------------------FRRIPDLVVW
GLCE_ECOLI      ----------------------------------------------------------------------
GGLO_MOUSE      --------------------------------------------------------------GCSPMYYQ
VAOX_PENSI      -------------------------------------------------------------------IVA
DLD_ECOLI       ----------------------------------ARLVGSSHLLTDPAKTARYRKGFRS-GQGDALAVVF
CKX7_ARATH      -------------------------------------------------------------------VVR
MURB_CLOTH      --------------------------------------------------------------GPADILVT
ALO_SCHPO       ----------------------------------------------------------------------
DH4C_PSEPU      ------------------------------VQKFRALLGDDNVLVESDQLVPYIMMPVENXXXXXXXXXX
DIM_PEA         ----------------------------------------------------------------------
GLDH2_ORYSJ     -------------------------LPPDALHKKA--VPFKYAPL-PDDLHA-VSNWSATHEVHTRVLLQ
DIML_CAEEL      ----------------------------------------------------------------------
CKX1_MAIZE      -------------------------------------------------------------------VLY
GGLO_RAT        ----------------------------------------------------------------------
DIM_ARATH       ----------------------------------------------------------------------
CKX6_ARATH      -------------------------------------------------------------------VLH
GLDH_BRAOL      ------------------------------IFRYAPLPEDLHTVSNWSGTHEVQTRNFN----------Q
GLDH_ARATH      ------------------------------IFRYAPLPEDLHTVSNWSGTHEVQTRNFN----------Q
CKX5_ARATH      ---------------------------PSELLRIGAIDVDGHFTVHPSDLASVSSDFGMLKSPEEPLVLH
GGLO_PIG        ---------------------------------------------------------------------Q


                         .         .         *         .         .         .         .:140
query           PGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQ
D2HDH_RAT       PQTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILSTALMNQVISFHDVSGILVCQAGCVLE
D2HDH_DANRE     PKTTEGVSQILRYCNERNLAVCPQGGNTGLVGGSVPVFDEIILSTSLMNQVFAFDNISGILTCQAGCVLE
D2HDH_MOUSE     PQTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILSTALMNQVISFHDVSGILVCQAGCVLE
D2HDH_BOVIN     PRTTQEVAHILRYCHERNLAVNPQGGNTGMVGGSTPVFDEIILSTALMNQVLSFHDVSGVLVCQAGCVLE
D2HDH_HUMAN     PRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLE
DLD2_YEAST      PKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDPVSGILKCDAGVILE
YN53_SCHPO      PKTTQQVSEILKYCNQKKLAVVPQGGNTGLVGGSVPVFDEIVLNLGLMNQIHTFDEISGVITLDSGVILE
DLD3_YEAST      PNSTDKVSKIMKYCNDKKLAVVPQGGNTDLVGASVPVFDEIVLSLRNMNKVRDFDPVSGTFKCDAGVVMR
GLCD_BACSU      PRNTDEISRILTICSEHRVPIVPRGSGTNLCGGTCPTEGGLVLLFKHMNQILEIDEENLTATVQPGVITL
LDHD_MOUSE      PQNVDQVSRVASLCYNQGVPIIPFGTGTGVEGGVCAVQGGVCINLTHMDQITELNTEDFSVVVEPGVTRK
LDHD_HUMAN      PQNVEQVSRLAALCYRQGVPIIPFGTGTGLEXXXXXXXXXXXXNLTHMDRILELNQEDFSVVVEPGVTRK
GLCD_ECOLI      PKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNL
GLCD_ECOL6      PKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLLVMARFKEILDINPVGRRARVQPGVRNL
DLD1_YEAST      PHTTEEVSKILKICHDNNMPVVPFSGGTSLEGHFLPIGDTITVDLSKMNNVVKFDKLDLDITVQAGLPWE
DLD1_KLULA      PRNTEDVSKLLKICHKYSIPVIPFSGGTSLEGHFLPTRPGSCVVLKYLNKIIQLNKEDLDVVVQGGVPWE
YDIJ_ECOLI      PRSTADVALIARLAAQERYSFTPRGGGTG-TNGQALNQGIIVDMSRHMNRIIEINPEEGWVRVEAGVIKD
ADAS_DICDI      PHSHEEVERLVQLAHKYNVVIIPMGGGSNIVGAIEPVSNEVSIDMRRMNKVLWVDRREMTACIQVGIMGP
Y1163_HAEIN     PKTVADIVRITKLANLPEISFTPRGGGTG-TNGQS-INNNIIVDLSRMTAILELNVKERWVRVQAGVVKD
ADAS_TRYBB      PNNHDDCVKIMELAQKHNVVVVPFGGGTNVTGGVEPNPFEISIDMRRMGRMLHIDTESGTAVFEVGVLGP
YGCU_ECOLI      LGSTEQVSRVLNFMNAHKINGVPRTGASATEGGETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLE
YGCU_ECO57      LGSTEQVSRVLNFMNAHKINGVPRTGASATEGGETVVENSVVLDGSAMNQIINIDIENMQATAQCGVPLE
LDHD_HAEIN      PATLLEFWNIVKVCVEHDVIVINQAANTGLTGGSTPDGNDVVINTMRIDGIQLINNASQVICLPGSTL--
ADAS_CAEEL      PKSEHEIVKIIEGAMSHNCAIIPIGGGTSVTNAETEKRAVISMDMALLDKILWIDRENLTCRAQAGIVGQ
ADAS_CAVPO      PTCHDDVVKIVNLACKYNLCIIPIGGGTGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQ
ADAS_MOUSE      PTCHDDVVKIVNLACKYNLCIIPIGGGTGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQ
ADAS_HUMAN      PTCHDDVVKIVNLACKYNLCIIPIGGGTGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQ
ADAS_RAT        PTCHDDVVKIVNLACKYNLCIIPIGGGTGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQ
ADAS_DROME      PRCHDEVVQLVRLANKHNVMLVPFGGGTSVSGAITCPQNECALDTSQMNRLLWLNRENLTVCFESGIVGQ
GLCE_ECOLI      -------------AISDKTPLVIQGSNSKAFLGR-PVTGQ-TLDVRCHRGIVNYDPTELVITARVGTPLV
GGLO_MOUSE      PTSVGEVREVLALARQQNKKVKVVGG--GHSPSDIACTDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLT
VAOX_PENSI      PRNVADVQSIVGLANKFSFPLWPIGRNSGYGGAAPRVSGSVVLDMKNMNRVLEVNVEGAYCVVEPGVTLH
DLD_ECOLI       PGSLLELWRVLKACVTADKIILMQAANTGLTEGSTP-NGNVIISTLRLDKL-------------------
CKX7_ARATH      PVGPEDIAGAVKAALRSDKLTVAARGNGHSINGQAMAEGGLVVDMSTAENHFEVGYLSGFVDVSGGALWE
MURB_CLOTH      PVSVSQLSQILKLCKNKSVPVFVMGNGTNLIVRDKGIRGVVV---KIFDNLNQFTVKDDIITAYAGILL-
ALO_SCHPO       -----------------------------------------LLSLDKMNKVVSFDPDSLSITVQAGIRFY
DH4C_PSEPU      XXXVEQVQGVVKICNEHKIPIISTGRNFGYGSAAPVQRGQVILDLKKMNKIIKIDPEMCYALVEPGVTFG
DIM_PEA         ----------------------------------------------------------------------
GLDH2_ORYSJ     PDSLPVLHDALAAAHGERRKLRPLG--SGLSPNGLALSRAGMVNLALMDKVLDVDAKKKTVTVQAGIRV-
DIML_CAEEL      ------------------------------------------IATDKLFDILDLDVEKMTVKAEPGVTMG
CKX1_MAIZE      PSSTGDLVALLSAANSTPYTIAFRGRGHSLMG-QAFAPGGVVVNMASLGDAARINVSADGRYVDAGGEQV
GGLO_RAT        -----------------------------------------MIHMGKMNRVLQVDKEKKQITVEAGILLA
DIM_ARATH       ------------------------------------------VDLGEFRNILEINKEKMTARVEP--LVN
CKX6_ARATH      PKSVSDIASIWMMGTHSQLTVAARGRGHSLQGQAQTRHG-IVIHMESLHQVYSVDSPAPYVDVSGGELWI
GLDH_BRAOL      PETLADLEALVKEAHEKKNRIRPVG--SGLSPNGIGLSRSGMVNLALMDKVLEVDKEKKRVRVQAGIRVQ
GLDH_ARATH      PENLADLEALVKESHEKKLRIRPVG--SGLSPNGIGLSRSGMVNLALMDKVLEVDKEKKRVTVQAGIRVQ
CKX5_ARATH      PSSAEDVARLVRTAYGSATAFVSARGHGHSINGQAAANGVVVEMLVRPDEMY-VDVWGGELWVDVKKTLE
GGLO_PIG        PTSVEEIREVLALARQQNKRVKVVGG--GHSPSDIACTDGFMIHMGKMNRVLKVDMEKKQVTVEAGILLA


                         +         .         .         .         .         *         .:210
query           HAQERAASVDRLFPLSLGAQGSCTIGGNLSTNXXXXXXXXXXXXRDMALGLEVVLADGRILNLLSKLKKD
D2HDH_RAT       ELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRKD
D2HDH_DANRE     NLSHYLEERDFIMPLDLGAKGSCHIGGNVSTNAXXXXXXXXXXXXXTVLGLEVVLADGHVLNCLATLRKD
D2HDH_MOUSE     ELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGLEVVLADGTILNCLTSLRKD
D2HDH_BOVIN     ALSQYVEERGFIMPLDLGAKGSCHIGGNVATNAGGLRVLRYGSLRGTVLGLEVVLADGTVLNCLTSLRKD
D2HDH_HUMAN     ELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKD
DLD2_YEAST      NANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNSMHSMRKD
YN53_SCHPO      NADNFLAEKGYMFPLDLGAKGSCQVXXXXXXXXXXXXXXXXXXXXXSILGMEAVLPDGTILDNLVTLRKD
DLD3_YEAST      DAHQFLHDHDHIFPLDLPSRNNCQVGGVVSTNAGGLNFLRYGSLHGNVLGLEVVLPNGEIISNINALRKD
GLCD_BACSU      DMIRAVESKGLFYPPDPSSMKISTIGGNINENSGGLRGLKYGVTRDYVIGLEVVLANGDIIRTGGKLAKD
LDHD_MOUSE      ALNTHLRDSGLWFPVDPGADAS--LCGMAATGASGTNAVRYGTMRDNVINLEVVLPDGRLLHTAGRYRKS
LDHD_HUMAN      ALNAHLRDSGLWFPVDPGADAS--LCGMAATGASGTNAVRYGTMRDNVLNLEVVLPDGRLLHTAGRRRKS
GLCD_ECOLI      AISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDAL-D
GLCD_ECOL6      AISQAVAPHNLYYAPDPSSQIACSIGGNVAENAGGVHCLKYGLTVHNLLKIEVQTLDGEALTLGSDAL-D
DLD1_YEAST      DLNDYLSDHGLMFGCDPGP--GAQIGGCIANSCSGTNAYRYGTMKENIINMTIVLPDGTIVKTKKRPRKS
DLD1_KLULA      ELNEYLNDHGLLFGCDPGP--GAQIAGCIANSCSGTNAYRYGTMKENVVNITMCMADGTIVKTKRRPRKS
YDIJ_ECOLI      QLNQYLKPFGYFFAPELSTSNRATLGGMINTDASGQGSLVYGKTSDHVLGVRAVLLGGDILDLAETLGKS
ADAS_DICDI      ELEKQLHKQG----VSLGHDPDSTLGGWLATCSSGHQSDKYGDIEDMAVSFRTVTPTGTLE--LRNGARS
Y1163_HAEIN     QLNQFLKPHGLFFAPELSTSNRATLGGMINTDASGQGSLQYGKTSNHVLALRAVLINGEILDTLPQLNRF
ADAS_TRYBB      DIDEQLSRYGFMMGHDPDSYAYSTLGGWIAARGSGAMSNKYGDIENMILAMRVVTPVGVVETPLTSRP--
YGCU_ECOLI      VLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRI-KNVPRR
YGCU_ECO57      VLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEAVLADGTVTRI-KNVPRR
LDHD_HAEIN      ----------------------------------------------------------------------
ADAS_CAEEL      SLERQLNKKGFTCGHEPDSIEFSTLGGWVSTRASGMKKNKYGNIEDLVVHLNFVCPKG-IIQKQCQVPRM
ADAS_CAVPO      ELERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKVVTPRG-VIEKSCQGPRM
ADAS_MOUSE      DLERQLKESGYCTGHEPDSLEFSTVGGWISTRASGMKKNIYGNIEDLVVHMKMVTPRG-VIEKSSQGPRM
ADAS_HUMAN      ELERQLKESGYCTGHEPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRG-IIEKSCQGPRM
ADAS_RAT        DLERQ-----------LKESGYCTVGGWISTRASGMKKNVYGNIEDLVVHMKMVTPRG-VIEKSSQGPRM
ADAS_DROME      DLERVLRSEGLTVGHEPDSYEFSTLGGWVATRASGMKKNVYGNIEDLVVRVRMVTPSGTLERECSA-PRV
GLCE_ECOLI      TIEAALESAGQMLPCEPPHYGEATWGGMVACGLAGPRRPWSGSVRDFVLGTRIITGAGKHLRFGGEVMKN
GGLO_MOUSE      DLHPQ-LDKHGLALSNLGAVSDVTVGGVIGSGTHNTGIKHGILATQV-VALTLMKADGTVLECSESSK--
VAOX_PENSI      NYLEANNLRDKLW-LDVPDLGGGSVLGNAVERGVGYTPYGDHWM--MHSGMEVVLANGELLETMGLKPED
DLD_ECOLI       ----------------------------------------------------------------------
CKX7_ARATH      DVLKRCVSEYGLAPRSWTDYLGLTVGGTLSNAGVSGQAFRYGPQTSNVTELDVVTGNGDVVT-CSEIENS
MURB_CLOTH      ---SRVSTIAYENGLT-GLEFACGIPGTLGGAVAMNAGAYGGEMKDVVVETEYMDKDGEI----RVVRDD
ALO_SCHPO       QVQEILQNLGYSLPI-VGSISETSVSGIMSTCTHGSSLQHQVLPHYIK-SMRIMLADGSIVTCSRELQK-
DH4C_PSEPU      QMYDYIQ--ENNLPVMLSFSAPSAIAGPVNTMDRGVGYTPYGEHFMMQCGMEVVLANGDVYRTMGGVPGS
DIM_PEA         -----------------------TVGGLINGYGIEGSSHKYGLFSDTVVAFEIILADGSLV----KATKD
GLDH2_ORYSJ     -----AELVDTLREHGLTLQNFASIGGIIQVGAHGTGARLPPIDEQVISMKLVTPAKGTI--ELSREKDP
DIML_CAEEL      QLSQYLISRGYTLPV-LPELDDLTVGGLINGCGVESGSFKYGMFQHICTGYEVVMSDGELKNVYSAAKTE
CKX1_MAIZE      WIDVLRASLARVAPRSWNDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNAD
GGLO_RAT        DLHPQ-LDEHGLAMSNLGAVSDVTVAGVIGSGTHNTGIKHGILATQV-VALTLMTADGEVLECSESRN--
DIM_ARATH       MGQISRATVPMNLSLAVVAEDDLTVGGLINGYGIEGSSHIYGLFADTVEAYEIVLAGGELV----RATRD
CKX6_ARATH      NILHETLKYG-LAPKSWTDYLHLTVGGTLSNAGISGQAFRHGPQISNVHQLEIVTGKGEILNCT---KRQ
GLDH_BRAOL      QL------VDAIQEYGLTLQNFASIRGGIIQVGAHGTGARLPPIDEQVIGMKLVTAKGTI-----ELSKD
GLDH_ARATH      ----------------------------------------------------------------------
CKX5_ARATH      HGLAPKSWTDYLY---------LTVGGTLSNAGISGQAFHHGPQISNVLELDVVTGKGEVMRCS---EEE
GGLO_PIG        DLHPQ-LDKHGLALSNLGAVSDVTAGGVIGSGTHNTGIKHGILATQV-VELTLLTPDGTVL-----VCSE


                         .         .         .         +         .         .         .:280
query           NTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAE
D2HDH_RAT       NTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFTEVLQTFRTCKGQLGEILSAFEFMDA
D2HDH_DANRE     NTGYDLKQLFIGSEGTLGVITAVSILCPRKPKAVNVAFLGCSSFQQLLETFQCCRGMLGEILSAFEFLDA
D2HDH_MOUSE     NTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGCPGFAEVLQTFRTCRGMLGEILSAFEFMDT
D2HDH_BOVIN     NTGYDLKQLFIGSEGTLGVITAVSILCPPKPSTVNVAFLGCPGFAEVLQTFRTCRAMLGEILSAFEFMDA
D2HDH_HUMAN     NTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDA
DLD2_YEAST      NTGYDLKQLFXXXXXXXXXXXXXXXLTVPKPKAFNVSYLSVESFEDVQKVFVRARQELSEILSAFEFMAK
YN53_SCHPO      NTGLDIKQLFIGSEGYLGVITKLSVICPKRPSSTNVAFFGVPSYENVLKAFSETRSHLTEILSAFELMDN
DLD3_YEAST      NTGYDLKQLFIGAEXXXXXXXXXXXXXXXKPKALNAVFFGIENFDTVQKLFVKAKSELSEILSAFEFMDR
GLCD_BACSU      VAGYDLTRLFVGSEGTLGIVTEAIVKLVPKPETKKT-LLALYENID-------AAAQTVSDIIAAKII-P
LDHD_MOUSE      AAGYNLTGLFVGSEGTLGIITSTTLRLHPAPEATVAAFPSVQAAVDST----VQILQAAVPVARIEFLDD
LDHD_HUMAN      AAGYNLTGLFVGSEGTLGLITATTLRLHPAPEAATCAFPSVQAAVDST----VHILQAAVPVARIEFLDE
GLCD_ECOLI      SPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLAVGIANGIIPGGLEMMDNLSI
GLCD_ECOL6      SPGFDLLALFTGSEGMLGVTTEVTVKLLPKPPVARVLLASFDSVEKAGLAVGIANGIIPGGLEMMDNLSI
DLD1_YEAST      SAGYNLNGLFVGSEGTLGIVTEATVKCHVKPKAETVAVVSFDTIKDA--------AACASNLTGIHLNAM
DLD1_KLULA      SAGYNLNGLIIGSEGTLGIVTEATIKCHVRSTFETVAVVPFPTVSDA--------ASCSSHLAGIQLNAM
YDIJ_ECOLI      NTGYDLRHVFTGSEGTLAFITEARLDITRLPKVRRLVNVKYDSFDSALRNAPMVEARALSVETVDSKVLN
ADAS_DICDI      GAGINYKHIILGSEGTLGIITEAVMKVHAVPQAVE--YYGFLFPTFAHAVSALQQIRSS-----------
Y1163_HAEIN     LTGYDLKNVFTGSEGSLAFICEAKLNLLLIPQYRTLINIKYRSFDAALRNAPMVKANALSVETVDSKVLN
ADAS_TRYBB      -CGVDLNAMFVGSEGAFGLVTEAVVKI-------------------------------------------
YGCU_ECOLI      AAGPDIRHIIIGNEGALCYITEVTVKIF------------------------------------------
YGCU_ECO57      AAGPDIRHIIIGNEGALCYITEVTVKIF------------------------------------------
LDHD_HAEIN      ----------------------------------------------------------------------
ADAS_CAEEL      SSGPDIHQIILGSEGTLGVVSEVTIKIFPIP---------------------------------------
ADAS_CAVPO      STGPDIHHFIMGSEGTLGVITEATIKIRPTP---------------------------------------
ADAS_MOUSE      STGPDIHHFIMGSEGTLGVITEATIKIRPTP---------------------------------------
ADAS_HUMAN      STGPDIHHFIMGSEGTLGVITEATIKIRPVP---------------------------------------
ADAS_RAT        STGPDIHHFIMGSEGTLGVITEATIKIRPTP---------------------------------------
ADAS_DROME      SCGPDFNHVILGSEGTLGVITEVVLKVRPLP---------------------------------------
GLCE_ECOLI      VAGYDLSRLMVGSYGCLGVLTEISMKV-------------------------------------------
GGLO_MOUSE      ------ADVFQAARGCLGVILTVTLQCVPQFHLLETSF--------------------------------
VAOX_PENSI      QPWSKIAHLFLFSQSNMGIVTKIGIWLMPNPRGYQSYLITLPKDGDLKQAVDIIRPLRLGALQNVPTIRH
DLD_ECOLI       ----------------------------------------------------------------------
CKX7_ARATH      ELFFSV----LGGLGQFGIITRARVLLQPAPDMV------------------------------------
MURB_CLOTH      GHQFGYRTSFIQKNSGIVIKTSMKLK--------------------------------------------
ALO_SCHPO       -------DMFAAAQGALGVIVDITISVVP-----------------------------------------
DH4C_PSEPU      NTGPTLDGMF--TQANYGICTKMGFWLMPKPPVFKPFEVIFEDEADIVEIV-------------------
DIM_PEA         NEYSDLFYAIPWSQGTLGLLVAAEVKLIP-----------------------------------------
GLDH2_ORYSJ     DLFYLAR----CGLGGLGVVAEVTLQCVERHQLIEHTFV---SSADEVK---------------------
DIML_CAEEL      QAKQD-NSLFFASQGTICFLVAATIKIIPCKKYVKLTY--------------------------------
CKX1_MAIZE      -----LFDAVLGGLGQFGVITRARIAVEPAPRFVYTDFAAFSADQERL----------------------
GGLO_RAT        ------ADVFQAARGCLGIILTVTLQCVPQFHLQETSF--------------------------------
DIM_ARATH       NEYSDLYYAIPWSQGTLGLLVAAEIRLIKVKEYMRLTYIPVKGDLQAL----------------------
CKX6_ARATH      NS--DLFNGVLGGLGQFGIITRARIALEPAPTMDQEQLISAQ----------------------------
GLDH_BRAOL      NDP-ELFHLARCGLGGLGVVAEVTLQCVERQELLEHTYV-------------------------------
GLDH_ARATH      ----------------------------------------------------------------------
CKX5_ARATH      NTR--LFHGVLGGLGQFGIITRARISLEPAPQRV------------------------------------
GGLO_PIG        SSNAEVFQAARVHLGCLGVILTVTLQCVPQFHLQETTF--------------------------------


                         .         *         .         .         .         .         +:350
query           IALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKL
D2HDH_RAT       ECMQLVGQHLHLTNPVQ-ESPFYVLVETSSAGHDAE-KLTNVLEQVLNSGLVIDGTMATDQRKVQMLWAL
D2HDH_DANRE     SCMNLLEKHLKLTNPI-TECPFYIVIETASNATHDEEKLHQFLEEVMTSSLVTDGTVATEATKIKALWSL
D2HDH_MOUSE     ECMQLVGQHLQLTNPVQ-ESPFYVLVETSSAGHDAE-KLTNVLEQVLNSGLVTDGTMATDQRKVQMLWAL
D2HDH_BOVIN     ECMKLVRLHLGLSCPVQ-ESPFYVLIETSGPGHDAE-KLGCFLEQVLDSGLVTDGTLGSDERRIKMLWAL
D2HDH_HUMAN     VCMQLVGRHLHLASPVQ-ESPFYVLIETSGSNHDAE-KLGHFLEHALGSGLVTDGTMATDQRKVKMLWAL
DLD2_YEAST      SQVLAKSQLKDAAFPLEDEHPFYILIETSSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWKW
YN53_SCHPO      TSQTLVDKYSGTQRPLEDEHPFYVLVETGSNKEHDEQKITALVEDLLEKEIISDGVLAQDESQLRVLWER
DLD3_YEAST      GSIECTIEYLKDLPPLENQHNFYVLIETSKRHDDEK--LTAFLKDTTDSKLISEGMMAKDKADFDRLWTW
GLCD_BACSU      ATLEFLVIEDYAKIGLPTSAKAVLLIEQDGPFETVERDMEKI-EAICKKGDAV--SVQTAQTEEEAFXXX
LDHD_MOUSE      VMMDACNRHSKLNCPVAPT----LFLEFHGSQQTLAEQLQRT-EAITQDNGGSHFSWAKEAEKRNELWAA
LDHD_HUMAN      VMMDACNRY--------SKLNCLVAPTLFLEFHGSQQALEEQLQRTEEQNGASDFSWAKEAEERSRLWTA
GLCD_ECOLI      RAAEDFIHAGYPVDAEA-----ILLCELDGVESDVQEDCERVNDILLKAGAT-DVRLAQDEAERVRFWAG
GLCD_ECOL6      RAAEDFIHAGYPVDAEA-----ILLCELDGVESDVQEDCERVNDILLKAGAT-DVRLAQDEAERVRFWAG
DLD1_YEAST      ELLDENMMKLINASESTDRCDW---VEKPTMFFKIGGRSPNIV-----NALVDEVKAVAQLNHCNSFQFA
DLD1_KLULA      ELLDDNMMKIINQSGATSKDNWVLFFKIGGRSXXXXXXXXXXXXXXASQHNNTKFEFATDEDSKLELWEA
YDIJ_ECOLI      LAREDIVWHSVSEDVPDQEMLGLNIVEFAALIDERVNALCARLDEASHQAGVIGWQVCRELAGVERIYAM
ADAS_DICDI      ----------------------------------------------------------------------
Y1163_HAEIN     LAKQDIIWHSVNKDPILGLNIVEFAGNNKEKIDRQVTALCRLLDEKIEQDHIIGYQVCSDLPSIERIYAM
ADAS_TRYBB      ----------------------------------------------------------------------
YGCU_ECOLI      ----------------------------------------------------------------------
YGCU_ECO57      ----------------------------------------------------------------------
LDHD_HAEIN      ----------------------------------------------------------------------
ADAS_CAEEL      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
GLCE_ECOLI      ----------------------------------------------------------------------
GGLO_MOUSE      ----------------------------------------------------------------------
VAOX_PENSI      ILLDAAV---------------------------------------------------------------
DLD_ECOLI       ----------------------------------------------------------------------
CKX7_ARATH      ----------------------------------------------------------------------
MURB_CLOTH      ----------------------------------------------------------------------
ALO_SCHPO       ----------------------------------------------------------------------
DH4C_PSEPU      ----------------------------------------------------------------------
DIM_PEA         ----------------------------------------------------------------------
GLDH2_ORYSJ     ----------------------------------------------------------------------
DIML_CAEEL      ----------------------------------------------------------------------
CKX1_MAIZE      ----------------------------------------------------------------------
GGLO_RAT        ----------------------------------------------------------------------
DIM_ARATH       ----------------------------------------------------------------------
CKX6_ARATH      ----------------------------------------------------------------------
GLDH_BRAOL      ----------------------------------------------------------------------
GLDH_ARATH      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
GGLO_PIG        ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           REEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKA
D2HDH_RAT       RERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTR---LGPRAKVVGYGHLGDGNLHLNVT--AEAFSQ
D2HDH_DANRE     RERVTEALTHEGYTYKYDISLPVEKIYDLVQDMRRHLGGMAKNV--VGYGHVGDGNLHLNITSPKDFDLL
D2HDH_MOUSE     RERITEALSRDGYVFKYDLSLPVERLYDLVIDLRTR---LGPRAKVVGYGHLGDGNLHLNVT--AEAFSR
D2HDH_BOVIN     RERITEALSRDGYVYKYDLSLPLDRLYDLVGDLRAR---LGPSAKVVGYGHLGDGNLHLNVTS--EAFST
D2HDH_HUMAN     RERITEALSRDGYVYKYDLSLPVERLYDIVTDLRAR---LGPHAKVVGYGHLGDGNLHLNVT--AEAFSP
DLD2_YEAST      REMIPEASQANGGVYKYDVSLPLKDLYSLVEATNARLEAELVGDSPKPYGHVGDGNLHLNV-----AVRE
YN53_SCHPO      REGITECAKAGSGVYKYDVSLPLPVLYDLVNDTKKRLIEFHPVIDVVGFGHMGDGNLHLNIVRQFDKRVE
DLD3_YEAST      RKSVPTACNSYGGMYKYDMSLQLAAVTERLNAAGLIGDAPKPVVKSCGYGHVGDGNIHLNIAVREFTKQI
GLCD_BACSU      XXXXXXXXKPT--TILEDATVPRSEIANMVKAIND--IAAKYDISICTFGHAGDGNLHPTCT--TDIRNK
LDHD_MOUSE      RHNAALALSPGSKAYSTDVCVPISRLPEILVETKEEIASKLTGAI---VGHVGDGNFHCILL--VDPDDA
LDHD_HUMAN      RHNAALATRPGCKGYSTDVCVPISRLPEIVEDLNAS------GLTGSIVGHVGDGNFHCILL--VNPDDA
GLCD_ECOLI      RKNAFPAV----GRISPDYTIPRRALPGVLE--GIARLSQQYDLRVANVFHAGDGNMHPLIL--FDANEP
GLCD_ECOL6      RKNAFPAV----GRISPDYTIPRRALPGVLE--GIARLSQQYDLRVANVFHAGDGNMHPLIL--FDANEP
DLD1_YEAST      KDELWEARKVALWSVTTDVAVPVSQFDKVIHETKSKLINAI-------VGHAGDGNFHAFIVYRTPEE--
DLD1_KLULA      RKDTGRKTNPDANIWTTDVAVPIS---KFADVINATKEEMASGLLTSLVGHAGDGNFHAFIIYNTEQRKT
YDIJ_ECOLI      RKKAVGLLGNAKGAAKEDTCVPPEHLADYIAEFRALLHGLSYGM----FGHVDAGVLHVRPALDMCDPQQ
ADAS_DICDI      ----------------------------------------------------------------------
Y1163_HAEIN     RKKAVGLLGNAKGAAKEDTCVPPENLADYISEFRALLDQ--HNLQYGMFGHVDAGVLH--VRPALDLCDK
ADAS_TRYBB      ----------------------------------------------------------------------
YGCU_ECOLI      ----------------------------------------------------------YNV---VDCKPE
YGCU_ECO57      ----------------------------------------------------------YNV---VNCKPE
LDHD_HAEIN      ----------------------------------------------------------------------
ADAS_CAEEL      ----------------------------------------------------------------------
ADAS_CAVPO      ----------------------------------------------------------------------
ADAS_MOUSE      ----------------------------------------------------------------------
ADAS_HUMAN      ----------------------------------------------------------------------
ADAS_RAT        ----------------------------------------------------------------------
ADAS_DROME      ----------------------------------------------------------------------
GLCE_ECOLI      ----------------------------------------------------------------------
GGLO_MOUSE      ----------------------------------------------------------------------
VAOX_PENSI      ----------------------------------------------------------------------
DLD_ECOLI       ----------------------------------------------------------------------
CKX7_ARATH      ----------------------------------------------------------------------
MURB_CLOTH      ----------------------------------------------------------------------
ALO_SCHPO       ----------------------------------------------------------------------
DH4C_PSEPU      ----------------------------------------------------------------------
DIM_PEA         ----------------------------------------------------------------------
GLDH2_ORYSJ     ----------------------------------------------------------------------
DIML_CAEEL      ----------------------------------------------------------------------
CKX1_MAIZE      ----------------------------------------------------------------------
GGLO_RAT        ----------------------------------------------------------------------
DIM_ARATH       ----------------------------------------------------------------------
CKX6_ARATH      ----------------------------------------------------------------------
GLDH_BRAOL      ----------------------------------------------------------------------
GLDH_ARATH      ----------------------------------------------------------------------
CKX5_ARATH      ----------------------------------------------------------------------
GGLO_PIG        ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           AFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL
D2HDH_RAT       ELLG---ALEPYVYAWTAEQRGSVSAEHGLGFKKKNVLGYSKPPVAVKLMQQLKAMLDPKGILNPYKTL
D2HDH_DANRE     A------AIEPYVYEWTSQWKGSISAEHGLGLKKRNYIYYSKPSEAVALMGSIKAMLDPKGILNPYKTL
D2HDH_MOUSE     ELLG---ALEPYVYAWTAEQRGSVSAEHGLGFKKKDVLGYSKPPVAVTLMQQLKAMLDPKGILNPYKTL
D2HDH_BOVIN     SLLG---ALEPYVYEWTAGQRGSVSAEHGLGFKKKDVLGYSKPPEALQLMRQLKALLDPKGILNPYKML
D2HDH_HUMAN     SLLA---ALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSKPPGXXXXXXXXXXXXDPKGILNPYKTL
DLD2_YEAST      YNKNIEKTLEPFVYEFVSSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI
YN53_SCHPO      KCLEPW------VYEWVSRHRGSISAEHGLGLLKKPFVGYSKSKEMIHLMKTLKNVFDPNGIMLPYK--
DLD3_YEAST      EDL-----LEPFVYEYIASKKGSISAEHGIGFHKKGKLHYTRSDIEIRFMKDIKNHYDPNGILNPYKYI
GLCD_BACSU      DEMERVEQAFAEIFEKAIELGGTITGEHGVGEMKAPYLEMKLKKEGIDAMKALKAAFDPRNILNPGKM-
LDHD_MOUSE      EEQRRVKAFAENLGRRALALGGTCTGEHGIGLGKRQLLQEEVGPVGVETMRQLKNTLDPRGLMNPGKVL
LDHD_HUMAN      EELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEVGAVGVETMRQLKAVLDPQGLMNPGKVL
GLCD_ECOLI      GEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFHAVKAAFDPDGLLNPGK--
GLCD_ECOL6      GEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFHAVKAAFDPDGLLNPGK--
DLD1_YEAST      ------HETSQLVDRMVKRAEGTCTGEHGVGIGKREYLLEELGEAPVDLMRKIKLAIDPKRIMNPDKI-
DLD1_KLULA      A--------ETIVENMVKRAEGTCTGEHGVGIGKRDYLLEEVGEDTVAVMRKLKLALDPKRILNPDKI-
YDIJ_ECOLI      EILMK--QISDDVVALTAKYGGLLWGEHGKG-FRAEYSPAFFGEELFAELRKVKAAFDPHNRLNPGKI-
ADAS_DICDI      --MAQYIEAKKLMTDIIFKYGGSLSHHHGVGYEHVPWMTRYATRGWINVYRSLKETIDPKDICNPRKLI
Y1163_HAEIN     EQVKLFKQISDEVAELTIKYGGLLWGEHGKGVRSHYGEKFFTPELWHEL-RYIKTLFDPNNRLNPGKI-
ADAS_TRYBB      ---------------------------------------------------------------------
YGCU_ECOLI      EEIDKYHNLNKIICEETIRLGGSMVHHHGIG-KHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTI-
YGCU_ECO57      EEIDKYHNLNKIICEETIRLGGSMVHHHGIG-KHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTI-
LDHD_HAEIN      ---------------------------------------------------------------------
ADAS_CAEEL      -----YDRIETAARDEIIACGGSISHHHGVGKIRKQWMLTTNGAVGIALLKAIKSELDPANI-------
ADAS_CAVPO      ---------------------------------------------------------------------
ADAS_MOUSE      ---------------------------------------------------------------------
ADAS_HUMAN      ---------------------------------------------------------------------
ADAS_RAT        ---------------------------------------------------------------------
ADAS_DROME      ---------------------------------------------------------------------
GLCE_ECOLI      ---------------------------------------------------------------------
GGLO_MOUSE      ---------------------------------------------------------------------
VAOX_PENSI      ---------------------------------------------------------------------
DLD_ECOLI       ---------------------------------------------------------------------
CKX7_ARATH      ---------------------------------------------------------------------
MURB_CLOTH      ---------------------------------------------------------------------
ALO_SCHPO       ---------------------------------------------------------------------
DH4C_PSEPU      ---------------------------------------------------------------------
DIM_PEA         ---------------------------------------------------------------------
GLDH2_ORYSJ     ---------------------------------------------------------------------
DIML_CAEEL      ---------------------------------------------------------------------
CKX1_MAIZE      ---------------------------------------------------------------------
GGLO_RAT        ---------------------------------------------------------------------
DIM_ARATH       ---------------------------------------------------------------------
CKX6_ARATH      ---------------------------------------------------------------------
GLDH_BRAOL      ---------------------------------------------------------------------
GLDH_ARATH      ---------------------------------------------------------------------
CKX5_ARATH      ---------------------------------------------------------------------
GGLO_PIG        ---------------------------------------------------------------------