[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38488.1

[Show Plain Result]


## Summary of Sequence Search
    1::339
   72::408     9e-29  30%  484 aa  VAT1_DANRE RecName: Full=Synaptic vesicle membrane protein VAT-1
   78::384     9e-29  40%  386 aa  QORL_ARATH RecName: Full=Quinone oxidoreductase-like protein
    8::311     1e-28  30%  329 aa  QOR_PONAB RecName: Full=Quinone oxidoreductase;       
    8::311     1e-27  30%  329 aa  QOR_HUMAN RecName: Full=Quinone oxidoreductase;       
    1::324     2e-26  30%  329 aa  YOGA_BACSU RecName: Full=Uncharacterized zinc-type alcohol
    8::248     2e-26  32%  330 aa  QOR_BOVIN RecName: Full=Zeta-crystallin;
    8::327     2e-25  30%  330 aa  QOR_LAMGU RecName: Full=Quinone oxidoreductase;       
    8::311     2e-25  30%  329 aa  QOR_CAVPO RecName: Full=Quinone oxidoreductase;       
    1::328     2e-24  30%  332 aa  QORX_HUMAN RecName: Full=Quinone oxidoreductase PIG3;       
   61::400     3e-24  35%  406 aa  VAT1_MOUSE RecName: Full=Synaptic vesicle membrane protein VAT-1
    8::327     2e-23  29%  329 aa  QOR_PIG RecName: Full=Quinone oxidoreductase;       
   48::387     5e-23  34%  393 aa  VAT1_HUMAN RecName: Full=Synaptic vesicle membrane protein VAT-1
    8::239     5e-23  31%  331 aa  QOR_MOUSE RecName: Full=Quinone oxidoreductase;       
    8::222     2e-21  33%  329 aa  QOR_RAT RecName: Full=Quinone oxidoreductase;       
   48::347     2e-21  29%  349 aa  QORL2_BOVIN RecName: Full=Quinone oxidoreductase-like protein 2;   
   37::348     4e-21  28%  350 aa  QORL2_MOUSE RecName: Full=Quinone oxidoreductase-like protein 2;   
   10::330     9e-21  29%  334 aa  QOR_YEAST RecName: Full=Probable quinone oxidoreductase;       
    9::327     9e-21  30%  327 aa  QOR_SALTY RecName: Full=Quinone oxidoreductase;       
   21::334     1e-20  30%  339 aa  ADH2_BACST RecName: Full=Alcohol dehydrogenase;         Short=ADH; 
   37::348     3e-20  28%  350 aa  QORL2_RAT RecName: Full=Quinone oxidoreductase-like protein 2;     
   21::335     1e-19  32%  339 aa  ADH3_BACST RecName: Full=Alcohol dehydrogenase;       
   40::361     1e-19  27%  365 aa  QORL2_NEMVE RecName: Full=Quinone oxidoreductase-like protein 2
   29::355     2e-19  30%  379 aa  VAT1_TORCA RecName: Full=Synaptic vesicle membrane protein VAT-1;  
  109::327     2e-19  34%  327 aa  QOR_ECOLI RecName: Full=Quinone oxidoreductase;       
   21::334     6e-19  32%  337 aa  ADH1_BACST RecName: Full=Alcohol dehydrogenase;       
 1421::1741    1e-18  32% 2111 aa  MCAS_MYCBO RecName: Full=Mycocerosic acid synthase;       
   29::380     5e-18  26%  387 aa  RT4I1_DANRE RecName: Full=Reticulon-4-interacting protein 1
   43::393     7e-18  30%  396 aa  RT4I1_MOUSE RecName: Full=Reticulon-4-interacting protein 1,
    9::346     7e-18  30%  350 aa  ADH_SCHPO RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
   10::300     9e-18  36%  325 aa  QOR_PSEAE RecName: Full=Quinone oxidoreductase;       
   43::393     3e-17  28%  396 aa  RT4I1_HUMAN RecName: Full=Reticulon-4-interacting protein 1,
   43::393     4e-17  27%  396 aa  RT4I1_BOVIN RecName: Full=Reticulon-4-interacting protein 1,
   40::376     6e-17  28%  417 aa  VAT1L_MOUSE RecName: Full=Synaptic vesicle membrane protein VAT-1
   42::378     1e-16  28%  419 aa  VAT1L_HUMAN RecName: Full=Synaptic vesicle membrane protein VAT-1
    3::343     3e-16  26%  346 aa  YGD6_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
    8::344     3e-16  25%  348 aa  ADH1_KLUMA RecName: Full=Alcohol dehydrogenase 1;       
   47::275     8e-16  32%  377 aa  ZADH2_BOVIN RecName: Full=Zinc-binding alcohol dehydrogenase
    1::347     1e-15  27%  347 aa  ADH_SULTO RecName: Full=NAD-dependent alcohol dehydrogenase;       
  147::344     2e-15  33%  349 aa  YKM8_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1871::2188    7e-15  30% 2603 aa  PKS16_DICDI RecName: Full=Probable polyketide synthase 16;       
    1::341     7e-15  32%  344 aa  ADH_SULAC RecName: Full=NAD-dependent alcohol dehydrogenase;       
  120::349     3e-14  25%  353 aa  ADH1_NEUCR RecName: Full=Alcohol dehydrogenase 1;       
   47::275     6e-14  30%  377 aa  ZADH2_HUMAN RecName: Full=Zinc-binding alcohol dehydrogenase
 1952::2189    8e-14  31% 2604 aa  PKS17_DICDI RecName: Full=Probable polyketide synthase 17;       
   47::361     8e-14  28%  377 aa  MECR_DANRE RecName: Full=Trans-2-enoyl-CoA reductase,
   47::284     1e-13  29%  377 aa  ZADH2_MOUSE RecName: Full=Zinc-binding alcohol dehydrogenase
    6::329     1e-13  31%  329 aa  QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog,
   43::372     2e-13  26%  373 aa  MECR_HUMAN RecName: Full=Trans-2-enoyl-CoA reductase,
 1607::1848    2e-13  31% 2505 aa  FAS_RAT RecName: Full=Fatty acid synthase;       
   10::346     4e-13  27%  350 aa  ADH1_CANAL RecName: Full=Alcohol dehydrogenase 1;       
 1938::2170    5e-13  25% 3010 aa  PKS2_DICDI RecName: Full=Probable polyketide synthase 2;       
  109::353     9e-13  29%  358 aa  YDJL_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
 1802::1943    9e-13  32% 2837 aa  PKS3_DICDI RecName: Full=Probable polyketide synthase 3;       
 1606::1847    9e-13  31% 2504 aa  FAS_MOUSE RecName: Full=Fatty acid synthase;       
   23::347     1e-12  30%  351 aa  TDH_SYMTH RecName: Full=L-threonine 3-dehydrogenase;       
 1615::1856    1e-12  29% 2513 aa  FAS_BOVIN RecName: Full=Fatty acid synthase;       
 1842::1967    2e-12  34% 2968 aa  PKS37_DICDI RecName: Full=Probable polyketide synthase 37;       
 1613::1770    2e-12  31% 2511 aa  FAS_HUMAN RecName: Full=Fatty acid synthase;       
 2831::3132    2e-12  29% 3567 aa  ERYA2_SACER RecName: Full=Erythronolide synthase, modules 3 and 4;   
   24::334     2e-12  29%  357 aa  DHSO_MOUSE RecName: Full=Sorbitol dehydrogenase;       
   24::238     3e-12  31%  357 aa  DHSO_HUMAN RecName: Full=Sorbitol dehydrogenase;       
  111::344     3e-12  26%  348 aa  ADH2_KLULA RecName: Full=Alcohol dehydrogenase 2;       
   29::329     3e-12  27%  329 aa  QORH_SPIOL RecName: Full=Quinone-oxidoreductase homolog,
   24::334     3e-12  29%  357 aa  DHSO_RAT RecName: Full=Sorbitol dehydrogenase;       
   34::370     3e-12  27%  374 aa  ADH3_KLULA RecName: Full=Alcohol dehydrogenase 3, mitochondrial;   
 2005::2252    6e-12  29% 3097 aa  PKS45_DICDI RecName: Full=Probable polyketide synthase 45;       
   24::261     6e-12  30%  357 aa  DHSO_PONAB RecName: Full=Sorbitol dehydrogenase;       
   43::357     7e-12  26%  373 aa  MECR_RAT RecName: Full=Trans-2-enoyl-CoA reductase, mitochondrial; 
   16::339     1e-11  29%  341 aa  TDH_YERPP RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPN RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPG RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPE RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPA RecName: Full=L-threonine 3-dehydrogenase;       
 1985::2239    1e-11  29% 3078 aa  PKS44_DICDI RecName: Full=Probable polyketide synthase 44;       
  111::344     1e-11  25%  348 aa  ADH2_CANAL RecName: Full=Alcohol dehydrogenase 2;       
   16::339     1e-11  29%  341 aa  TDH_YERPY RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPS RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERPB RecName: Full=L-threonine 3-dehydrogenase;       
   16::339     1e-11  29%  341 aa  TDH_YERP3 RecName: Full=L-threonine 3-dehydrogenase;       
   43::372     2e-11  30%  373 aa  MECR_BOVIN RecName: Full=Trans-2-enoyl-CoA reductase,
  100::208     2e-11  39%  339 aa  INC11_TRIAT RecName: Full=Protein indc11;
  110::332     2e-11  26%  337 aa  ADH1_ZYMMO RecName: Full=Alcohol dehydrogenase 1;       
  154::340     2e-11  33%  345 aa  P1_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P1;  
   24::238     2e-11  29%  357 aa  DHSO_MACFA RecName: Full=Sorbitol dehydrogenase;       
 1832::2059    3e-11  26% 2542 aa  PKS41_DICDI RecName: Full=Probable polyketide synthase 41;       
 1920::2063    4e-11  29% 2552 aa  PKS40_DICDI RecName: Full=Probable polyketide synthase 40;       
   43::372     4e-11  26%  373 aa  MECR_MOUSE RecName: Full=Trans-2-enoyl-CoA reductase,
  108::344     4e-11  24%  348 aa  ADH1_PICST RecName: Full=Alcohol dehydrogenase 1;       
   23::237     5e-11  28%  356 aa  DHSO_BOVIN RecName: Full=Sorbitol dehydrogenase;       
 1947::2169    8e-11  27% 2999 aa  PKS18_DICDI RecName: Full=Probable polyketide synthase 18;       
   22::235     8e-11  28%  354 aa  DHSO_SHEEP RecName: Full=Sorbitol dehydrogenase;       
   34::223     1e-10  30%  347 aa  YBI2_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
 1679::1997    1e-10  24% 2380 aa  PKS25_DICDI RecName: Full=Probable polyketide synthase 25;       
   22::212     1e-10  29%  336 aa  ZDH1_STAES RecName: Full=Zinc-type alcohol dehydrogenase-like
   16::329     1e-10  28%  341 aa  TDH_YERE8 RecName: Full=L-threonine 3-dehydrogenase;       
   46::358     1e-10  29%  375 aa  MECR_ARATH RecName: Full=Probable trans-2-enoyl-CoA reductase,
 2041::2262    2e-10  28% 3147 aa  PKS1_DICDI RecName: Full=Probable polyketide synthase 1;       
   22::212     4e-10  29%  336 aa  ZDH1_STAEQ RecName: Full=Zinc-type alcohol dehydrogenase-like
 1906::2147    4e-10  30% 3127 aa  PKS33_DICDI RecName: Full=Probable polyketide synthase 33;       
   16::339     5e-10  28%  341 aa  TDH_SERP5 RecName: Full=L-threonine 3-dehydrogenase;       
 2103::2249    5e-10  29% 3174 aa  PKS15_DICDI RecName: Full=Probable polyketide synthase 15;       
  152::338     5e-10  32%  343 aa  P2_ARATH RecName: Full=Probable NADP-dependent oxidoreductase P2;  
  122::347     7e-10  26%  351 aa  ADH5_YEAST RecName: Full=Alcohol dehydrogenase 5;       
  122::347     7e-10  26%  351 aa  ADH5_SACPS RecName: Full=Alcohol dehydrogenase 5;       
   25::346     7e-10  24%  350 aa  ADH1_ASPFN RecName: Full=Alcohol dehydrogenase 1;       
   28::328     9e-10  28%  330 aa  YHFP_BACSU RecName: Full=Putative quinone oxidoreductase yhfP;     
    5::283     9e-10  29%  366 aa  ADH_RALEU RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  108::210     2e-09  34%  333 aa  ZDH1_STAAC RecName: Full=Zinc-type alcohol dehydrogenase-like
   19::273     2e-09  26%  341 aa  TDH_PHOLL RecName: Full=L-threonine 3-dehydrogenase;       
  113::305     2e-09  28%  341 aa  TDH_CHRVO RecName: Full=L-threonine 3-dehydrogenase;       
 1929::2173    2e-09  22% 3133 aa  PKS38_DICDI RecName: Full=Probable polyketide synthase 38;       
   19::305     2e-09  28%  341 aa  TDH_PSEHT RecName: Full=L-threonine 3-dehydrogenase;       
 1910::2150    2e-09  31% 3078 aa  PKS34_DICDI RecName: Full=Probable polyketide synthase 34;       
 2014::2238    2e-09  26% 3101 aa  PKS32_DICDI RecName: Full=Probable polyketide synthase 32;       
 2058::2280    2e-09  24% 2690 aa  PKS28_DICDI RecName: Full=Probable polyketide synthase 28;       
  108::211     3e-09  33%  335 aa  ZDH1_STAAN RecName: Full=Zinc-type alcohol dehydrogenase-like
  108::211     3e-09  33%  335 aa  ZDH1_STAAM RecName: Full=Zinc-type alcohol dehydrogenase-like
  109::326     3e-09  28%  339 aa  YJMD_BACSU RecName: Full=Uncharacterized zinc-type alcohol
   16::305     3e-09  32%  341 aa  TDH_SALTY RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALSV RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALPK RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALPC RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALPB RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALPA RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALNS RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALHS RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALEP RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALDC RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALCH RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     3e-09  32%  341 aa  TDH_SALA4 RecName: Full=L-threonine 3-dehydrogenase;       
   48::256     3e-09  31%  344 aa  MECR1_CAEEL RecName: Full=Probable trans-2-enoyl-CoA reductase 1,
  111::344     3e-09  23%  348 aa  ADH2_PICST RecName: Full=Alcohol dehydrogenase 2;       
  108::211     4e-09  33%  335 aa  ZDH1_STAAR RecName: Full=Zinc-type alcohol dehydrogenase-like
   16::305     4e-09  32%  341 aa  TDH_SALTI RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-09  32%  341 aa  TDH_SALAR RecName: Full=L-threonine 3-dehydrogenase;       
   23::337     4e-09  28%  357 aa  DHSO2_YEAST RecName: Full=Sorbitol dehydrogenase 2;       
   19::245     4e-09  34%  346 aa  BDHA_BACSU RecName: Full=(R,R)-butanediol dehydrogenase;       
  108::211     6e-09  33%  335 aa  ZDH1_STAAW RecName: Full=Zinc-type alcohol dehydrogenase-like
  108::211     6e-09  33%  335 aa  ZDH1_STAAS RecName: Full=Zinc-type alcohol dehydrogenase-like
  138::281     6e-09  35%  347 aa  YDJJ_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   25::312     8e-09  39%  348 aa  TDH_PYRFU RecName: Full=Probable L-threonine 3-dehydrogenase;      
  100::337     8e-09  32%  340 aa  QOR_LEIAM RecName: Full=Probable quinone oxidoreductase;       
   23::337     8e-09  28%  357 aa  DHSO1_YEAST RecName: Full=Sorbitol dehydrogenase 1;       
 1617::1774    1e-08  31% 2512 aa  FAS_CHICK RecName: Full=Fatty acid synthase;       
 1988::2132    1e-08  26% 2623 aa  PKS31_DICDI RecName: Full=Probable polyketide synthase 31;       
 1905::2127    1e-08  25% 2531 aa  PKS26_DICDI RecName: Full=Probable polyketide synthase 26;       
  117::344     1e-08  24%  348 aa  ADH1_YEAST RecName: Full=Alcohol dehydrogenase 1;       
   25::312     2e-08  32%  350 aa  TDH_THEON RecName: Full=Probable L-threonine 3-dehydrogenase;      
   25::312     2e-08  38%  348 aa  TDH_PYRHO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   16::305     2e-08  32%  341 aa  TDH_KLEP7 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     2e-08  32%  341 aa  TDH_KLEP3 RecName: Full=L-threonine 3-dehydrogenase;       
 1736::1882    2e-08  27% 2779 aa  PKS21_DICDI RecName: Full=Probable polyketide synthase 21;       
 1937::2258    3e-08  21% 3108 aa  PKS39_DICDI RecName: Full=Probable polyketide synthase 39;       
  110::334     3e-08  25%  336 aa  ADH_STAAW RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAAS RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAAR RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAAC RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAAB RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAA8 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     3e-08  25%  336 aa  ADH_STAA3 RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::224     3e-08  31%  336 aa  ADHP_ECOLI RecName: Full=Alcohol dehydrogenase,
   25::347     4e-08  26%  347 aa  TDH_THETN RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-08  31%  341 aa  TDH_ENT38 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-08  32%  341 aa  TDH_ECOLI RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-08  32%  341 aa  TDH_ECODH RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-08  32%  341 aa  TDH_ECOBW RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURPS RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURP6 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURP1 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURP0 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURMS RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURMA RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURM9 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     4e-08  27%  343 aa  TDH_BURM7 RecName: Full=L-threonine 3-dehydrogenase;       
 1997::2141    4e-08  25% 3075 aa  PKS30_DICDI RecName: Full=Probable polyketide synthase 30;       
   19::305     5e-08  27%  341 aa  TDH_SHESH RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     5e-08  31%  341 aa  TDH_CITK8 RecName: Full=L-threonine 3-dehydrogenase;       
   82::347     5e-08  26%  349 aa  QORL1_HUMAN RecName: Full=Quinone oxidoreductase-like protein 1;   
   82::347     5e-08  26%  349 aa  QORL1_BOVIN RecName: Full=Quinone oxidoreductase-like protein 1;   
 1996::2135    5e-08  27% 3106 aa  PKS29_DICDI RecName: Full=Probable polyketide synthase 29;       
 1733::1879    5e-08  27% 2778 aa  PKS19_DICDI RecName: Full=Probable polyketide synthase 19;       
  110::334     5e-08  25%  336 aa  ADH_STAAN RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  110::334     5e-08  25%  336 aa  ADH_STAAM RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  114::344     5e-08  24%  348 aa  ADH2_KLUMA RecName: Full=Alcohol dehydrogenase 2;       
   25::346     5e-08  21%  350 aa  ADH1_EMENI RecName: Full=Alcohol dehydrogenase 1;       
   16::305     6e-08  31%  341 aa  TDH_ECOLU RecName: Full=L-threonine 3-dehydrogenase;       
  140::322     6e-08  28%  349 aa  PTGR1_RABIT RecName: Full=Prostaglandin reductase 1;       
  139::328     6e-08  32%  329 aa  PTGR1_CAVPO RecName: Full=Prostaglandin reductase 1;       
   26::351     6e-08  25%  353 aa  DHSO_BACSU RecName: Full=Sorbitol dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_SHIFL RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_SHIF8 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_SHIBS RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_SHIB3 RecName: Full=L-threonine 3-dehydrogenase;       
   25::312     8e-08  38%  348 aa  TDH_PYRAB RecName: Full=Probable L-threonine 3-dehydrogenase;      
   16::305     8e-08  32%  341 aa  TDH_ESCF3 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOUT RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOSM RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOSE RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOLC RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOL6 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOL5 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOK1 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECOHS RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO8A RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO81 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO7I RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO5E RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO57 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO55 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO45 RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     8e-08  31%  341 aa  TDH_ECO27 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     8e-08  27%  343 aa  TDH_BURTA RecName: Full=L-threonine 3-dehydrogenase;       
   82::223     8e-08  29%  348 aa  QORL1_MOUSE RecName: Full=Quinone oxidoreductase-like protein 1;   
  189::347     8e-08  29%  347 aa  ADH_SULSR RecName: Full=NAD-dependent alcohol dehydrogenase;       
   16::305     1e-07  31%  341 aa  TDH_SHISS RecName: Full=L-threonine 3-dehydrogenase;       
   25::312     1e-07  35%  350 aa  TDH_PYRKO RecName: Full=Probable L-threonine 3-dehydrogenase;      
   16::305     1e-07  31%  341 aa  TDH_ECO24 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     1e-07  26%  342 aa  TDH_BURS3 RecName: Full=L-threonine 3-dehydrogenase;       
   21::264     1e-07  28%  348 aa  DHSO_BOMMO RecName: Full=Sorbitol dehydrogenase;       
   16::320     2e-07  25%  341 aa  TDH_PROMH RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     2e-07  30%  341 aa  TDH_ENTS8 RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     2e-07  26%  342 aa  TDH_BURCJ RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     2e-07  26%  342 aa  TDH_BURCH RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     2e-07  26%  342 aa  TDH_BURCC RecName: Full=L-threonine 3-dehydrogenase;       
   21::305     2e-07  26%  342 aa  TDH_BURCA RecName: Full=L-threonine 3-dehydrogenase;       
  113::305     2e-07  31%  341 aa  TDH_ALTMD RecName: Full=L-threonine 3-dehydrogenase;       
  163::368     2e-07  28%  379 aa  ADHP_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 1;  
  113::306     2e-07  29%  340 aa  TDH_PSEA6 RecName: Full=L-threonine 3-dehydrogenase;       
   39::287     2e-07  29%  366 aa  IDND_VITVI RecName: Full=L-idonate 5-dehydrogenase;       
  115::336     3e-07  28%  340 aa  ADHA_RHIME RecName: Full=Alcohol dehydrogenase;         EC=1.1.1.1;
  113::346     4e-07  23%  350 aa  ADH1_KLULA RecName: Full=Alcohol dehydrogenase 1;       
   31::318     5e-07  24%  356 aa  XYL2_YEAST RecName: Full=D-xylulose reductase;       
   19::305     7e-07  27%  361 aa  TDH_ERWCT RecName: Full=L-threonine 3-dehydrogenase;       
   16::226     7e-07  27%  342 aa  TDH_AERHH RecName: Full=L-threonine 3-dehydrogenase;       
  139::327     7e-07  29%  329 aa  PTGR1_MOUSE RecName: Full=Prostaglandin reductase 1;       
  163::368     7e-07  27%  379 aa  ADHQ_RABIT RecName: Full=Alcohol dehydrogenase class-2 isozyme 2;  
  166::322     9e-07  34%  365 aa  YMN1_YEAST RecName: Full=Uncharacterized membrane protein YML131W;
   21::305     9e-07  26%  342 aa  TDH_BURVG RecName: Full=L-threonine 3-dehydrogenase;       
  113::330     2e-06  25%  342 aa  Y053_HAEIN RecName: Full=Uncharacterized zinc-type alcohol
   21::305     2e-06  26%  342 aa  TDH_BURM1 RecName: Full=L-threonine 3-dehydrogenase;       
   97::203     2e-06  32%  297 aa  TOXD_COCCA RecName: Full=Protein TOXD;
   16::224     3e-06  26%  342 aa  TDH_AERS4 RecName: Full=L-threonine 3-dehydrogenase;       
  108::219     3e-06  31%  337 aa  MTDH_PETCR RecName: Full=Mannitol dehydrogenase;       
  164::251     4e-06  40%  339 aa  YFMJ_BACSU RecName: Full=Putative NADP-dependent oxidoreductase
   19::306     4e-06  25%  342 aa  TDH_SILPO RecName: Full=L-threonine 3-dehydrogenase;       
   16::305     4e-06  26%  341 aa  TDH_EDWI9 RecName: Full=L-threonine 3-dehydrogenase;       
   25::320     5e-06  29%  329 aa  QOR_SCHPO RecName: Full=Probable quinone oxidoreductase;       
  126::277     5e-06  28%  349 aa  ADHA_BACSU RecName: Full=Probable formaldehyde dehydrogenase adhA; 
  119::348     5e-06  22%  352 aa  ADH3_EMENI RecName: Full=Alcohol dehydrogenase 3;       
  128::239     8e-06  30%  357 aa  CADH_POPDE RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
 1893::2038    1e-05  27% 2512 aa  PKS5_DICDI RecName: Full=Probable polyketide synthase 5;       
  128::231     1e-05  30%  365 aa  CADH_SACOF RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
  139::240     1e-05  32%  376 aa  YNN4_YEAST RecName: Full=Uncharacterized protein YNL134C;
    1::196     1e-05  27%  324 aa  YHDH_ECOLI RecName: Full=Putative quinone oxidoreductase yhdH;     
  124::322     1e-05  25%  350 aa  MECR_DICDI RecName: Full=Trans-2-enoyl-CoA reductase,
   29::262     2e-05  25%  325 aa  YBJB_SCHPO RecName: Full=Zinc-type alcohol dehydrogenase-like
    1::174     2e-05  24%  352 aa  RT4I1_DICDI RecName: Full=Reticulon-4-interacting protein 1
 1941::2110    2e-05  27% 2499 aa  PKS22_DICDI RecName: Full=Probable polyketide synthase 22;       
  131::245     3e-05  29%  365 aa  MTDH_APIGR RecName: Full=Mannitol dehydrogenase;       
  131::232     5e-05  32%  368 aa  YCZ2_YEAST RecName: Full=Uncharacterized protein YCR102C;
  139::269     5e-05  31%  329 aa  PTGR1_BOVIN RecName: Full=Prostaglandin reductase 1;       
   46::335     5e-05  26%  357 aa  MECR_DROME RecName: Full=Probable trans-2-enoyl-CoA reductase,
  125::237     5e-05  26%  375 aa  CADH3_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 3;        
  144::265     7e-05  26%  353 aa  YNCB_ECOLI RecName: Full=Putative NADP-dependent oxidoreductase
  148::308     7e-05  27%  354 aa  CADH1_ORYSJ RecName: Full=Probable cinnamyl alcohol dehydrogenase
  128::239     7e-05  28%  354 aa  CADH1_EUCGU RecName: Full=Probable cinnamyl alcohol dehydrogenase
   19::306     9e-05  28%  342 aa  TDH_STRAW RecName: Full=L-threonine 3-dehydrogenase;       
   17::338     9e-05  22%  340 aa  TDH_LEGPA RecName: Full=L-threonine 3-dehydrogenase;       
  131::238     9e-05  26%  376 aa  CADH2_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 2;        
  139::240     1e-04  32%  376 aa  YL460_YEAST RecName: Full=Uncharacterized protein YLR460C;
 1941::2110    1e-04  26% 2499 aa  PKS23_DICDI RecName: Full=Probable polyketide synthase 23;       
  123::349     1e-04  26%  353 aa  YPHC_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   17::338     1e-04  22%  340 aa  TDH_LEGPH RecName: Full=L-threonine 3-dehydrogenase;       
 1938::2087    1e-04  24% 2998 aa  PKS14_DICDI RecName: Full=Probable polyketide synthase 14;       
  131::278     1e-04  30%  376 aa  ETR1_YARLI RecName: Full=Probable trans-2-enoyl-CoA reductase,
  236::347     1e-04  26%  347 aa  ADH_SULSO RecName: Full=NAD-dependent alcohol dehydrogenase;       
  110::334     1e-04  21%  340 aa  ADH_STAEQ RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  111::335     2e-04  24%  339 aa  YJGB_ECOLI RecName: Full=Uncharacterized zinc-type alcohol
   18::132     2e-04  31%  261 aa  YGCW_ECOLI RecName: Full=Uncharacterized oxidoreductase ygcW;      
   17::338     2e-04  22%  340 aa  TDH_LEGPL RecName: Full=L-threonine 3-dehydrogenase;       
   19::338     2e-04  22%  340 aa  TDH_LEGPC RecName: Full=L-threonine 3-dehydrogenase;       
  108::186     2e-04  30%  339 aa  DOIAD_STRSD RecName: Full=2-deoxy-scyllo-inosamine dehydrogenase;  
  110::334     2e-04  21%  340 aa  ADH_STAES RecName: Full=Alcohol dehydrogenase;         Short=ADH;  
  163::297     3e-04  31%  329 aa  PTGR1_RAT RecName: Full=Prostaglandin reductase 1;       
  128::231     3e-04  26%  357 aa  CADH5_ARATH RecName: Full=Cinnamyl alcohol dehydrogenase 5;        
  128::239     3e-04  28%  357 aa  CADH1_TOBAC RecName: Full=Probable cinnamyl alcohol dehydrogenase
   16::306     3e-04  28%  342 aa  TDH_STRCO RecName: Full=L-threonine 3-dehydrogenase;       
  128::239     3e-04  27%  356 aa  CADH_EUCGL RecName: Full=Probable cinnamyl alcohol dehydrogenase;  
  128::239     3e-04  27%  356 aa  CADH2_EUCGU RecName: Full=Probable cinnamyl alcohol dehydrogenase
  139::319     4e-04  28%  360 aa  DHSO_SCHPO RecName: Full=Putative sorbitol dehydrogenase;       
  128::242     4e-04  25%  354 aa  CADH4_ORYSJ RecName: Full=Putative cinnamyl alcohol dehydrogenase
    3::203     7e-04  26%  338 aa  XYLD_MORMO RecName: Full=D-xylulose reductase;       
  139::246     7e-04  26%  329 aa  PTGR1_HUMAN RecName: Full=Prostaglandin reductase 1;       
  143::266     7e-04  35%  367 aa  ADH2_EMENI RecName: Full=Alcohol dehydrogenase 2;       
    5::88      0.001  34%  244 aa  FABG_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein]
  147::254     0.001  30%  372 aa  ETR1_SCHPO RecName: Full=Probable trans-2-enoyl-CoA reductase,
  128::239     0.001  27%  357 aa  CADH1_OCIBA RecName: Full=Cinnamyl alcohol dehydrogenase 1;        
  129::244     0.001  24%  355 aa  CADH1_ARATH RecName: Full=Probable cinnamyl alcohol dehydrogenase
    1::339

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRAMVLREHGGLEKLSFDSNFPDPDIGPGDVLLRVRATSLNYHDIFTRRGMPGIKIPLPVIMGLDXXXXX
VAT1_DANRE      -RALVLTGYGGYDKVKLQVKKGKPALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVI
QORL_ARATH      MKAWVYSDYGGVDVLKLESNIVVPEIKEDQVLIKVVAAALNPVDAKRRQGFKATDSPLPTVPGYXXXXXX
QOR_PONAB       MRAVRVFEFGGPEVLKLQSDIAVPIPKDHQALIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVI
QOR_HUMAN       MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVI
YOGA_BACSU      MKAVIHNGKAGLLGLSVQ-DVPSTKPGYGEVKVKLKSAGLNHRDLFLMKNKS--EQDPHMILGSDGAXXX
QOR_BOVIN       MRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNIKPLLPYTPGFDVAGII
QOR_LAMGU       MRAIRVSEFGGPEVLKLQSDVAVPIPEEHQVLIKVQACGVNPVDTYIRSGTYSRKPRLPYTPGLDVAGLI
QOR_CAVPO       MRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTY-TRIPLPYTPGTDVAGVV
QORX_HUMAN      MLAVHFDKPGGPENL-YVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHV
VAT1_MOUSE      LRCLVLTGFGGYDKVKLQSRPAVPPAGPGQLTLRVRACGLNFADLMGRQGLYDRLPPLPVTPGMXXXXXX
QOR_PIG         MSAIRVFKFGGPEVMKLQSDVAIPIPKDNQVLIKVHACGVNPVDTYIRSGTHNMKPLLPYTPGLDVAGIV
VAT1_HUMAN      LRCLVLTGFGGYDKVKLQSRXXXXXXXXXXQLLRLRACGLNFADLMARQGLYDRLPPLPVTPGMXXXXXX
QOR_MOUSE       MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGII
QOR_RAT         MRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGII
QORL2_BOVIN     -------------------------VQPHEVRVNVHFCGINFADILACQGQYQERHQLPFTPGMEFSGMV
QORL2_MOUSE     ------------QPLTIQEVAPRP-VGPQEVRVDVHFCGVNFADILACRGQYQEKPPLPFTPGMEFSGAV
QOR_YEAST       -KVILIDEIGGYDVIKYE-DYPVPSISEEELLIKNKYTGVNYIESYFRKGI--YPCEKPYVLGREASGTV
QOR_SALTY       -------KHGGPEVLQ-TVEFTPAEPAEHEIQVENKAIGINFIDTYIRSGLYPPP-SLPAGLGTEAAGVV
ADH2_BACST      -----------------------PKLEEGEVLVKIEACGVCHTDLHAAHGDWPIKPKLPLIPGHEGVGIV
QORL2_RAT       ------------QPLTIQEVAPRP-IGPQEVRVDVHFCGINFADNLVCRGQYQEKPPLPFTPGMEFSGVV
ADH3_BACST      -----------------------PTISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLXXXXXXXXXX
QORL2_NEMVE     -RAVMCNELG--KPLVVEDKFSTENLGTSQVRVAVHSCGINFADILKCIGKYQEKPELPFVPGTEISGEV
VAT1_TORCA      --AIVLNGVGGYDKVKVEVKKGVPTLKSDEILVRVQACGLNFSDLLVRQGAFGKHHSL----GTECAGVV
QOR_ECOLI       ----------------------------------------------------------------------
ADH1_BACST      -----------------------PKISYGEVLVRIKACGVCHTDLHAAHGDWPVKPKLPLXXXXXXXXXX
MCAS_MYCBO      MRVQV-RRPGDLQTLEFVASDRVPP-GPGQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFXXXX
RT4I1_DANRE     MPAWVIDKYGKNDVLRFTKNAALPIIHPNEVVVKVHAAGLNPIDISMRGGYGAATMAMPLILGRDVSGEI
RT4I1_MOUSE     MPAWVIDKYGKNEVLRFTQNMMLPIIHPNEVIIKVHAASVNPIDVNMRSGYGATALNMPLTLGRDVSGVV
ADH_SCHPO       --AAVFHTHGGPENVKFEE-VPVAEPGQDEVLVNIKYTGVCHTDLHALQGDWPLPAKMPLIXXXXXXXXX
QOR_PSEAE       --------YGGPEVLEY-RDYQPAEPGPREVRVRNRAIGLNFIDTYYRSGL----YPAP---GLPSGLXX
RT4I1_HUMAN     MPAWVIDKYGKNEVLRFTQNMMMPIIHPNEVIVKVHAASVNPIDVNMRSGYGATALPLHVIKGEEFPLTL
RT4I1_BOVIN     MPAWVIDKYGSNEVLRFTQNMMIPMIHPNEVIIKVHAASINPIDVNMRSGYGATALPLHVIKGEEFPLTL
VAT1L_MOUSE     MRAVVLAGFGGLNKLRLSRKMPEPQ--DGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIV
VAT1L_HUMAN     MRAVVLAGFGGLNKLRFRKAMPEPQ--DGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIV
YGD6_SCHPO      LRYVVHDEISGFDQLKPEEYEVPQKLNPGEVLVKLKAASLNYRDLIITKGXXXXXXXXXXXXGSDGAGII
ADH1_KLUMA      -KGVIFYEHGG--ELQY-KDIPVPKPKPNELLINVKYSGVCHTDLHAWQGDWPLDTKLPLVGGHEGAGIV
ZADH2_BOVIN     ------------EAVTLRRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKTPFDAGFEGVG--
ADH_SULTO       MRAMRLVEIGKPLKLE---DIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGLGVKLPVTLGHEIAGRI
YKM8_SCHPO      ----------------------------------------------------------------------
PKS16_DICDI     ----------------------------GSVEIKVMSTGINYKDNLFYRGL----LPQEIFTKGDIYSPP
ADH_SULAC       MKAMLLHKFGEPLRLE---DMDVPKVGVGQVLVKVDYAGVCHTDLSVRSGISSSKPTLPLVIGHEIAXXX
ADH1_NEUCR      ----------------------------------------------------------------------
ZADH2_HUMAN     ------------EAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEV
PKS17_DICDI     ----------------------------------------------------------------------
MECR_DANRE      --ALLYRNHGEPSQVVQLESLDLPQVGAECVLVKMLAAPINPSDLNMLQGTYAILPELPAVGGNEGVAQV
ZADH2_MOUSE     ------------EAVTLRRDCPVPLPGDGDLLVRNRFVGINASDINYSAGRYDPSLKPPFDIGFEGIGEV
QORH_ARATH      MHALQYNSYGGGAAGLEHVQVPVPTPKSNEVCLKLEATSLNPVDWKIQKGMPFLPRKFPCIPATDXXXXX
MECR_HUMAN      VRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQV
FAS_RAT         ----------------------------------------------------------------------
ADH1_CANAL      -KAVVFDTNGG--QLVY-KDYPVPTPKPNELLIHVKYSGVCHTDLHARKGDWPLATKLPLXXXXXXXXXX
PKS2_DICDI      ----------------------------------------------------------------------
YDJL_ECOLI      ----------------------------------------------------------------------
PKS3_DICDI      ----------------------------------------------------------------------
FAS_MOUSE       ----------------------------------------------------------------------
TDH_SYMTH       ---------------------PIPTIGPRDVLVKVRAASIDYH-IYTWDPWSAGRVKPPLTIGHELAGEV
FAS_BOVIN       ----------------------------------------------------------------------
PKS37_DICDI     ----------------------------------------------------------------------
FAS_HUMAN       ----------------------------------------------------------------------
ERYA2_SACER     ---------GAIDSVAFE---PAPDVEQGEVRVDVRATGVNFRDVLLALGM----YPQKADMGTEAAGVV
DHSO_MOUSE      -------------------NYPIPELGPNDVLLKMHSVGICGSDVYWEHGRIGFVVKKPMVLGHEAAGTV
DHSO_HUMAN      -------------------NYPIPEPGPNEVLLRMHSVGICGSDVYWEYGRIGFIVKKPMVLGHEASGTV
ADH2_KLULA      ----------------------------------------------------------------------
QORH_SPIOL      -----------------------PDPKSDELLLKIEAATLNPIDWKIQKGVPLLPRKFPTIPGTDVAGEV
DHSO_RAT        -------------------NYPIPELGPNDVLLKMHSVGICGSDVYWEHGRIGFVVKKPMVLGHEAAGTV
ADH3_KLULA      -KGVIFYENGG--KLEY-KDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLXXXXXXXXXX
PKS45_DICDI     ----------------------------------------------------------------------
DHSO_PONAB      -------------------NYPIPEPGPNEVLLRMHSVGICGSDVYWEDGRIGFIVKKPMVLGHEASGTV
MECR_RAT        VRALVYGNHGDPAKVIQLKNLELTAVEGSDVHVKMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQV
TDH_YERPP       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPN       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPG       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPE       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPA       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
PKS44_DICDI     ----------------------------------------------------------------------
ADH2_CANAL      ----------------------------------------------------------------------
TDH_YERPY       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPS       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERPB       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_YERP3       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
MECR_BOVIN      VRALVYGHHGDPAKVVELKNLELAAVGGSHVHVKMLAAPINPSDINMIQGNYGLLPQLPAVGGNEXXXXX
INC11_TRIAT     ----------------------------------------------------------------------
ADH1_ZYMMO      ----------------------------------------------------------------------
P1_ARATH        ----------------------------------------------------------------------
DHSO_MACFA      -------------------NYPIPEPGPNEVLLRMHSVGICGSDVYWEEGRIGFIVKKPMVLGHEASGTV
PKS41_DICDI     ---------------------PTSILKENEVEIKVMSTGLNYKDYLIYAGLVESVEP---IFGIEFSGII
PKS40_DICDI     ----------------------------------------------------------------------
MECR_MOUSE      VRALVYGNHGDPAKVVQLKNLELTAVEGSDVHVRMLAAPINPSDINMIQGNYGLLPKLPAVGGNEGVGQV
ADH1_PICST      ----------------------------------------------------------------------
DHSO_BOVIN      -------------------NYPIPEPGPNEVLLKMHSVGICGSDVYWQHGRIGFVVKKPMVLGHEASGTV
PKS18_DICDI     ----------------------------------------------------------------------
DHSO_SHEEP      -------------------NYPIPEPGPNEVLLKMHSVGICGSDVHYWQGRIGFVVKKPMVLGHEASGTV
YBI2_SCHPO      -------------------HIPNPELGPYDVLVEVVATSINYKLMNTYQMIAKALFKLPNIPGYDFAGRV
PKS25_DICDI     ------------ENLDYQLKSKDSILKPYDIEVEIKATGLNYKDYLVYSGLIKLKGD-SVDFGLDFSGRV
ZDH1_STAES      -------------------NFDIPHPSGHELLVKVQSISVNPVDT-KQRTMPVDKVPR--VLGFDAVGVI
TDH_YERE8       ------------------TNVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
MECR_ARATH      -KAIVYEEHGSPDSVTRLVNLPPVEVKENDVCVKMIAAPINPSDINRIEGVYPVRPXXXXXXXXXXXXXX
PKS1_DICDI      ----------------------------------------------------------------------
ZDH1_STAEQ      -------------------NFDIPHPSGHELLVKVQSISVNPVDT-KQRTMPVDKAPR--VLGFDAVGVI
PKS33_DICDI     ------------------------ELNSNEVEIEIKATGINYKDYLMYIGMIGSD--LDIKYGKEYXXXX
TDH_SERP5       ------------------TDVPQPELGHNDIMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
PKS15_DICDI     ----------------------------------------------------------------------
P2_ARATH        ----------------------------------------------------------------------
ADH5_YEAST      ----------------------------------------------------------------------
ADH5_SACPS      ----------------------------------------------------------------------
ADH1_ASPFN      ---------------------PVPKPGPDEILVKVRYSGVCHTDLHALKGDWPLPVKMPLXXXXXXXXXX
YHFP_BACSU      ------------------------DLPKDGVLIKVAYSGINYKDGLAGKAGGNIVREYPLILGIDAAGTV
ADH_RALEU       MKAAVFVEPGRIEL----ADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVAKGLTV--GHEPVGII
ZDH1_STAAC      ----------------------------------------------------------------------
TDH_PHOLL       ---------------------PEPELGHNDVMIKIRKTAICGTDIYNWDDWSQKTIPVPMVVGHEYVGEV
TDH_CHRVO       ----------------------------------------------------------------------
PKS38_DICDI     ------------------------ELNSNEVEIEIKATSINYKDYLMYIGMIGTDIDIKY--GKEYEIEN
TDH_PSEHT       ---------------------PKPEVGHNDLLIKIRKTAICGTDVHIYKWDEWAQIPTPMVVGHEYVGEV
PKS34_DICDI     -------------------------LNSNEVEIEVKATGINYKDYLMYIGMIGSD--LDIKYGKEYXXXX
PKS32_DICDI     ----------------------------------------------------------------------
PKS28_DICDI     ----------------------------------------------------------------------
ZDH1_STAAN      ----------------------------------------------------------------------
ZDH1_STAAM      ----------------------------------------------------------------------
YJMD_BACSU      ----------------------------------------------------------------------
TDH_SALTY       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALSV       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALPK       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALPC       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALPB       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALPA       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALNS       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALHS       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALEP       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALDC       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALCH       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
TDH_SALA4       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDDWSQKTIPVPMXXXXXXXXXX
MECR1_CAEEL     ------------------------------VLVQWIAAPINPADLNQIQGVYPVKPALPAVGGNEGFGKV
ADH2_PICST      ----------------------------------------------------------------------
ZDH1_STAAR      ----------------------------------------------------------------------
TDH_SALTI       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_SALAR       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
DHSO2_YEAST     ---------------------PIPTIDPHYVKLAIKATGICGSDIHYYRGIGKYILKAPMVLGHESSGQV
BDHA_BACSU      ----------------------EPKTEPGKVKIKVKWCGICGSDLHEYLGGP-IFIPVPVTMGHEFSXXX
ZDH1_STAAW      ----------------------------------------------------------------------
ZDH1_STAAS      ----------------------------------------------------------------------
YDJJ_ECOLI      ----------------------------------------------------------------------
TDH_PYRFU       -----------------------PKPGPGEVLIKILATSICGTDIYEWNEWAQTRIRPPQIMXXXXXXXX
QOR_LEIAM       ----------------------------------------------------------------------
DHSO1_YEAST     ---------------------PIPTIDPHYVKLAIKATGICGSDIHYYRGIGKYILKAPMVLGHESSGQV
FAS_CHICK       ----------------------------------------------------------------------
PKS31_DICDI     ----------------------------------------------------------------------
PKS26_DICDI     ----------------------------------------------------------------------
ADH1_YEAST      ----------------------------------------------------------------------
TDH_THEON       -----------------------PKPGPGEVLIKVLATSICGTDIYEWNEWAQSRIKPPQIMGHEVAGEV
TDH_PYRHO       -----------------------PKPGPGEVLIKVLATSICGTDIYEWNEWAQSRIKPPQIMGHXXXXXX
TDH_KLEP7       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_KLEP3       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
PKS21_DICDI     ----------------------------------------------------------------------
PKS39_DICDI     ------------------------ELNSNEVEIEIKATGINYKDYLLHIGMIGTNLEIKYGKEIENGIGF
ADH_STAAW       ----------------------------------------------------------------------
ADH_STAAS       ----------------------------------------------------------------------
ADH_STAAR       ----------------------------------------------------------------------
ADH_STAAC       ----------------------------------------------------------------------
ADH_STAAB       ----------------------------------------------------------------------
ADH_STAA8       ----------------------------------------------------------------------
ADH_STAA3       ----------------------------------------------------------------------
ADHP_ECOLI      ----------------------------------------------------------------------
TDH_THETN       -----------------------PKIGPDEVLIKVKATSICGTDIYVWNEWAKSRIKPPKTMGHEFVGEV
TDH_ENT38       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOLI       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECODH       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOBW       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_BURPS       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURP6       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURP1       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURP0       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURMS       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURMA       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURM9       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURM7       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
PKS30_DICDI     ----------------------------------------------------------------------
TDH_SHESH       ---------------------PKPEMGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
TDH_CITK8       ------------------TDVPVPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
QORL1_HUMAN     ----------------------------------------------------------------------
QORL1_BOVIN     ----------------------------------------------------------------------
PKS29_DICDI     ----------------------------------------------------------------------
PKS19_DICDI     ----------------------------------------------------------------------
ADH_STAAN       ----------------------------------------------------------------------
ADH_STAAM       ----------------------------------------------------------------------
ADH2_KLUMA      ----------------------------------------------------------------------
ADH1_EMENI      ---------------------PVPKPGPDQILVKIRYSGVCHTDLHAMMGHWPIPVKMPLVGGHEGAGIV
TDH_ECOLU       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
PTGR1_RABIT     ----------------------------------------------------------------------
PTGR1_CAVPO     ----------------------------------------------------------------------
DHSO_BACSU      ---------------------PVPDINHDEVLIKVMAVGICGSDLYTNGRIGNYVVEKPFILGHECAGEI
TDH_SHIFL       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_SHIF8       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_SHIBS       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_SHIB3       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_PYRAB       -----------------------PKPGPGEVLIKVIATSICGTDIYEWNEWAQSRIKPPQIMXXXXXXXX
TDH_ESCF3       ------------------TDVPEPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOUT       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOSM       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOSE       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOLC       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOL6       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOL5       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOK1       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECOHS       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO8A       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO81       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO7I       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO5E       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO57       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO55       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO45       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_ECO27       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_BURTA       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
QORL1_MOUSE     ----------------------------------------------------------------------
ADH_SULSR       ----------------------------------------------------------------------
TDH_SHISS       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_PYRKO       -----------------------PKPGPGEVLIKVLATSICGTDIYEWNEWAQSRIKPPQIMXXXXXXXX
TDH_ECO24       ------------------TDVPVPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_BURS3       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
DHSO_BOMMO      ---------------------PVPEINDDEVLIKIDCVGICGSDVYSTGTCGADVIDKPIVIGHEGAGTV
TDH_PROMH       ------------------TDVPVPELGHNDVMIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYIGEI
TDH_ENTS8       ------------------TDVPEPEVGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMXXXXXXXXXX
TDH_BURCJ       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURCH       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURCC       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_BURCA       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TDH_ALTMD       ----------------------------------------------------------------------
ADHP_RABIT      ----------------------------------------------------------------------
TDH_PSEA6       ----------------------------------------------------------------------
IDND_VITVI      -----------------------PSLGPYDVKVRIKAVGICGSDVFKTMRCANFIVKKPMVIGHECAGII
ADHA_RHIME      ----------------------------------------------------------------------
ADH1_KLULA      ----------------------------------------------------------------------
XYL2_YEAST      ---------------------------PNEVIIQIKATGICGSDIYTHGRIANYVVESPMVLGHESSGIV
TDH_ERWCT       ---------------------PMPELGHNDIMIKIRKSAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEI
TDH_AERHH       ------------------TDVPAPELGHNDLLIKIRKTAICGTDIYNWDEWSQKTIPVPMVVGHEYVGEV
PTGR1_MOUSE     ----------------------------------------------------------------------
ADHQ_RABIT      ----------------------------------------------------------------------
YMN1_YEAST      ----------------------------------------------------------------------
TDH_BURVG       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
Y053_HAEIN      ----------------------------------------------------------------------
TDH_BURM1       -----------------------PEVGHNDVLIKIRRTAICGTDIHIWKWDDWAQIPVPMHVGHEYVGEI
TOXD_COCCA      ----------------------------------------------------------------------
TDH_AERS4       ------------------TDVPAPELGHNDLLIKIRKTAICGTDIYNWDEWAQKTIPVPMVVGHEYVGEV
MTDH_PETCR      ----------------------------------------------------------------------
YFMJ_BACSU      ----------------------------------------------------------------------
TDH_SILPO       ---------------------PVPEIGPDDVLIKIKKTGICGTDIWNWDEWAAHTVPVPMITGHEFAGEI
TDH_EDWI9       ------------------TDVPLPALGHNDIMIKIRKAAICGTDIYNWDTWSQKTIPVPMVVGHEYVGEV
QOR_SCHPO       -----------------------PKPAPNGLVIKNAYAGLNYIDTYLRTGL--YTAPLPYIPGXXXXXXX
ADHA_BACSU      ----------------------------------------------------------------------
ADH3_EMENI      ----------------------------------------------------------------------
CADH_POPDE      ----------------------------------------------------------------------
PKS5_DICDI      ----------------------------------------------------------------------
CADH_SACOF      ----------------------------------------------------------------------
YNN4_YEAST      ----------------------------------------------------------------------
YHDH_ECOLI      MQALLLEQQDG-KTLASVQTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGID--FAG
MECR_DICDI      ----------------------------------------------------------------------
YBJB_SCHPO      ---------------------PIPQPKNGELLVKIEAAAINPSDLMNATGGFPYTV-YPRIVGRDYAGTV
RT4I1_DICDI     MKGILLNGYGSLDLLEYKTDLPVPKPIKSQVLIKIHSTSINPLDNVMRKGIVDLKLKLPIILGRECSGEI
PKS22_DICDI     ----------------------------------------------------------------------
MTDH_APIGR      ----------------------------------------------------------------------
YCZ2_YEAST      ----------------------------------------------------------------------
PTGR1_BOVIN     ----------------------------------------------------------------------
MECR_DROME      -----------------------PDPKDNQVLVKILAAPINPADINTIQGKYPVKPKFPAVGGNECVAEV
CADH3_ARATH     ----------------------------------------------------------------------
YNCB_ECOLI      ----------------------------------------------------------------------
CADH1_ORYSJ     ----------------------------------------------------------------------
CADH1_EUCGU     ----------------------------------------------------------------------
TDH_STRAW       ---------------------PEPEIGPGDVLIKVLRTGICGTDLHIRSGWAQQAVRTPLVLGHEFVGEV
TDH_LEGPA       -------------------DIPVPEYGVNDVLIKIKRTAICGTDIYSWDEWAQATIPVPMTVGHEFYGEI
CADH2_ARATH     ----------------------------------------------------------------------
YL460_YEAST     ----------------------------------------------------------------------
PKS23_DICDI     ----------------------------------------------------------------------
YPHC_ECOLI      ----------------------------------------------------------------------
TDH_LEGPH       -------------------DIPVPEYGVNDVLIKIKRTAICGTDIYSWDEWAQATIPVPMTVGHEFYGEI
PKS14_DICDI     ----------------------------------------------------------------------
ETR1_YARLI      ----------------------------------------------------------------------
ADH_SULSO       ----------------------------------------------------------------------
ADH_STAEQ       ----------------------------------------------------------------------
YJGB_ECOLI      ----------------------------------------------------------------------
YGCW_ECOLI      ----------------------------------------------------------------------
TDH_LEGPL       -------------------DIPVPEYGVNDVLIKIKRTAICGTDIYSWDEWAQATIPVPMTVGHEFYGEI
TDH_LEGPC       ---------------------PVPEYGVNDVLIKIKRTAICGTDIYSWDEWAQATIPVPMTVGHEFYGEI
DOIAD_STRSD     ----------------------------------------------------------------------
ADH_STAES       ----------------------------------------------------------------------
PTGR1_RAT       ----------------------------------------------------------------------
CADH5_ARATH     ----------------------------------------------------------------------
CADH1_TOBAC     ----------------------------------------------------------------------
TDH_STRCO       ------------------ADVPEPTIGSGDVLIKVLRTGICGTDLHIRAGWAQQAIRTPLVVGHEFVGEV
CADH_EUCGL      ----------------------------------------------------------------------
CADH2_EUCGU     ----------------------------------------------------------------------
DHSO_SCHPO      ----------------------------------------------------------------------
CADH4_ORYSJ     ----------------------------------------------------------------------
XYLD_MORMO      MKALVLEKAGKIAIQDWQSN---EVLGDDDVEIKIHTVGICGSDVYYQHGRIGFVVDEPMVLGHEASGVI
PTGR1_HUMAN     ----------------------------------------------------------------------
ADH2_EMENI      ----------------------------------------------------------------------
FABG_VIBCH      ----------------------------------------------------------------------
ETR1_SCHPO      ----------------------------------------------------------------------
CADH1_OCIBA     ----------------------------------------------------------------------
CADH1_ARATH     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXDRVLVDPLNRVEGGLMGETMNGGLAELCKARAHQLVRIPDNVSFEQAAALPVAYGTA
VAT1_DANRE      EAVGEEVTDRKVGDKVLV--LNR----------SGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITA
QORL_ARATH      XXXXXXXXXLKEGDEVYA---NVSEKALEGPKQFGSLAEYTAVEEKLLALKPKNIDFAQAAGLPLAIETA
QOR_PONAB       EAVGGNASAFKKGDRVFTS-----------STISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTA
QOR_HUMAN       EAVGDNASAFKKGDRVFTS-----------STISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTA
YOGA_BACSU      XXXXXXVKNVTVQTEVVIFPTLNWDPEILGGPSDGTLAEYVIIPSQNAIKKPAYLSWEEAGVLPLSALTA
QOR_BOVIN       EAVGESVSAFKKGDRVFTT-----------RTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTA
QOR_LAMGU       EAVGERVSAFKKGDRVFTT-----------STVSGGYAEYALAADHTVYKLPGELDFQKGAAIGVPYFTA
QOR_CAVPO       ESIGNDVSAFKKGDRVFTT-----------STISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTA
QORX_HUMAN      AELGPGCQGHW-----------KIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTA
VAT1_MOUSE      XXXXXXXXDRKAGDRVMV--LNR----------SGMWQEEVTVPSAQTFLMPEAMTFEEAAALLVNYITA
QOR_PIG         EAVGEHVSSFKKGDRVFTV-----------STLSGGYAEYALAADDTVYMLPEKLDFKQGAAIGIPYFTA
VAT1_HUMAN      XXXXXXXSDRKAGDRVMV--LNR----------SGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITA
QOR_MOUSE       ESVGDKVSAFKKGDRVFCY-----------STVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTA
QOR_RAT         ESVGDGVSAFKKGDRVFCF-----------STVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTA
QORL2_BOVIN     LETGTDVSTVKEGDRVI---------GLPGFS---GMAEECITDHKNLWQIPEKVSLREAAALPVSYGTA
QORL2_MOUSE     LETGTDVSTVKKGDRVI------------GVSSFHAMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTA
QOR_YEAST       VAKGKGVTNFEVGDQVAY-------------ISNSTFAQYSKISSQPVMKLPKGTSDEELAAGLLQVLTA
QOR_SALTY       SKVGNGVEHIRVGDRVVY-----------AQSTLGAYSSVHNVTADKAAILPDAISFEQAAASFLKGLTV
ADH2_BACST      VEVAKGVKSIKVGDRVLYSACGECEYCLTGQSVDGGYAEYCKAPADYVAKIPDNLDPVEVAPILCAGVTT
QORL2_RAT       LEAGADVSTVKKGDRVI------------GVSNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTA
ADH3_BACST      XXXXXXXTHLKVGDRVGIPWLYSACGHCAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTT
QORL2_NEMVE     VEVGSKVTSLSKGDRVL---------GVCGQ--GGGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTA
VAT1_TORCA      EAIGDLVIDRKVGDKIIM--LN-IDGGLW--------TELVVTTVNRTFLMPDGMSFQEAAAISVNYTAA
QOR_ECOLI       --------------------------------------------------LPAAISFEQAAASFLKGLTV
ADH1_BACST      XXXXXXXTHLKVGDRVGIPWLYSACGHCAGYSVDGGYAEYCRAAADYVVKIPDNLSFEEAAPIFCAGVTT
MCAS_MYCBO      XXXXXXXXXHQVGDRV---------GGF---SEGGCWRTFLTCDANLAVTLPPGLTDEQXXXXXXXXXXX
RT4I1_DANRE     MECGLDVKYFKPGDQVWA---------AIPPWKQGSLAEFVVVSGNEVSHKPKSLRHDEAASIPYVAATA
RT4I1_MOUSE     MECGLDVKYFQPGDEVAVPPWKQ-----------GTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTA
ADH_SCHPO       XXXXXXXTRLKIGDRVGVKWMNSSCGNLSGYTVDGTFQHYCIANATHATIIPESVPLEVAAPIMCAGITC
QOR_PSEAE       XXXXXXXXXXXXXTRFKVDRVAYATGPL------GAYSELHVLAEEKLVHLPDGIDFEQAAAVMLKGLTT
RT4I1_HUMAN     GRDVSGVVMECGLDVKYFKPGDEVWAAVP-PWKQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPTAWSAI
RT4I1_BOVIN     GRDVSGVVMECGLDVRYFKPGDEVWAAVP-PWKQGTLSEFVVVSGNEVSHKPRSLTHTQAASLPTAWSAI
VAT1L_MOUSE     EALGDSVKGYEIGDRV------------MAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTA
VAT1L_HUMAN     EALGDSVKGYEIGDRV------------MAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTA
YGD6_SCHPO      EKVGEDVEGFEKGDSVVCNPTDFATHSALGGTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPCAAVTA
ADH1_KLUMA      VAMGENVTGWEIGDYAGIKWLNGSKADLSGYTHDGSFQQYATADAVQAARIPKNVDLAEVAPILCAGVTV
ZADH2_BOVIN     --------------EVVALGLSASAAFMVGQAVAGSFAEYTVVPARVAIPVPGLKP--EYLTLLVSGTTA
ADH_SULTO       EEVGDEVVGYSKGDLVAVNPWEG-EGNCLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTT
YKM8_SCHPO      --------------------------------------------------------------------TA
PKS16_DICDI     FGLECAGYIT----RVAPSGVTRFKVGVVGFASHS-LSSLAITHQDKIVLKPENISFNEAAAVCVVYATS
ADH_SULAC       XXXXXXXXXFKKSDKVLIDPWIG-DGSCLGINVNGGYGEYVLVPDYRYMFKLRNLSTSTASPLACSGVTA
ADH1_NEUCR      ---------------------------LSGYTVDGSFQQYAIAKAAHVAKIPKGCDLETTAPVLCAGITV
ZADH2_HUMAN     VALG------------LSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVP-SVKPEYLTLL-VSGTTA
PKS17_DICDI     ---------------------------------------------NKIVLKPENISFNEAAAVCVVYATS
MECR_DANRE      MEVGDKVKTLKVGDWVIPK-----DAGI------GTWRTAAVLKADDLVTLPKDIPVLSAATLGVNPCTA
ZADH2_MOUSE     VALG------------LSASARYTVGQAVAYMAPGSFAEYTVVPASIAIPMP-SVKPEYLTML-VSGTTA
QORH_ARATH      XXXXXXXKNFKAGDKVVA---------VLSHLGGGGLAEFAVATEKLTVKRPQXXXXXXXXXXXXXXXXX
MECR_HUMAN      VAVGSNVTGLKPGDWVI--PANAGLGTWRTEAVFSEEA---------LIQVPSDIPLQSAATLGVNPCTA
FAS_RAT         ---------------------------VMGLVPAEGLATSVLLSPDFLWDVPSSWTLEEAASVPVVYTTA
ADH1_CANAL      XXXXXXXKGWKIGDFAGIKWLNGSEADLSGYTHDGSFEQYATADAVQAAKIPAGTDLANVAPILCAGVTV
PKS2_DICDI      ---------------------------------------------------PKNLTHVEAASIPVVYLTS
YDJL_ECOLI      ----------------------KVNLGLDNNTWGGGFSKYCKIHRHALWEIPDGVDYEDAAVLPIC--NA
PKS3_DICDI      ---------------------------------------------------PNNLSHEQASTIPVVYSTS
FAS_MOUSE       ---------------------------VMGLVPAEGLATSVLLSSDFLWDVPSSWTLEEAASVPVVYTTA
TDH_SYMTH       VAVGREVTACKVGDYVSAETCNRCPRCHMGEDTDGAFAEYVAVPEQNIWVNDKDIPFELQSIQEPLGNAV
FAS_BOVIN       ---------------------------VMGLVPAEGLATSTLVPQSFLWDVPSNWTLEEAASVPVVYSTA
PKS37_DICDI     ----------------------------------------------------------QYCTIPIVFLTS
FAS_HUMAN       ---------------------------VMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTA
ERYA2_SACER     TAVGPDVDAFAPGDRVL---------GLF----QGAFAPIAVTDHRLLARVPDGWSDADAAAVPIAYTTA
DHSO_MOUSE      TKVGELVKHLKPGDRVAIEPYCKIGRYNLTPTIDGNLCRFYKHNADFCYKLPDSVTFEEGALIPLSVGI-
DHSO_HUMAN      EKVGSSVKHLKPGDRVAIEPRENDEFCKMGRYNDGNLCRFYKHNAAFCYKLPDNVTFEEGALIPLSVGIH
ADH2_KLULA      ---------------------NCPDADLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV
QORH_SPIOL      VQAGSAVNRFKTGDKVVA---------VLSHATGGALAEYAVAKENLTVARPPEVSXXXXXXXXXXXXXX
DHSO_RAT        TKVGPMVKHLKPGDRVAIEPYNLTPSIFFCATPDGNLCRFYKHSADFCYKLPDSVTFEEGALIPLSVGI-
ADH3_KLULA      XXXXXXXKGWNIGDFALSNESNCPDADLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV
PKS45_DICDI     ---------------------------------------------------PDNISFVEAASIPLVYCTS
DHSO_PONAB      EKVGSLVKHLKPGDRVAIEPGAPRENDEFCKIGDGNLCRFYKHNAAFCYKLPDNVTFEEGAMIPLSVGIH
MECR_RAT        IAVGSSVSGLKPGDWVI--PANAGLGTWRTEAVFSEEA---------LIGVPKDIPLQSAATLGVNPCTA
TDH_YERPP       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPN       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPG       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPE       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPA       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
PKS44_DICDI     ---------------------------------------------------PDNISFVEAASIPIVYCTS
ADH2_CANAL      ---------------------NCAEADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTV
TDH_YERPY       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPS       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERPB       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_YERP3       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
MECR_BOVIN      XXXXXXXXXXKPGDWVI--PANPGLGTWRTEAVFG---------EEELITVPSDIPLQSAATLGVNPCTA
INC11_TRIAT     -------------------------------------AEYINIPEKYLLAIPDGVDPKVAAALPVDWSTA
ADH1_ZYMMO      -----------------------------GYTVDGAMAEECIVVADYSVKVPDGLDPAVASSITCAGVTT
P1_ARATH        ----------------------------------------------------------------------
DHSO_MACFA      EKVGSLVKHLKPGDRVAIEPGVPRENDEFCKSGDGNLCRFYKHNAAFCYKLPDNVTFEEGALIPLSVGIH
PKS41_DICDI     TRISTGSKEFKVGDHVY---------GIGKSTTSSHIITDIDVISHK----PSNISHSEASSIPVVYLTS
PKS40_DICDI     ---------------------------------------------------PSNISHSEASSIPVVYLTS
MECR_MOUSE      IAVGSSVSALKPGDWVI--PANAGLGTWRTEAVFSEEA---------LIGIPKDIPLQSAATLGVNPCTA
ADH1_PICST      ------------------DEPNCAKADLSGYTHDGSFQQYATADAVQAARLPKGTDLAQAAPILCAGITV
DHSO_BOVIN      VKVGSLVRHLQPGDRVAIEPFCKIGRYNLSPTIDGNLCRFYKHNANFCYKLPDNVTFEEGALIPLSVGIH
PKS18_DICDI     ---------------------------------------------------PTNISFQEAASIPCVYLTS
DHSO_SHEEP      VKVGSLVRHLQPGDRVAIQPFCKIGRYNLSPTIDGNLCRFYKHNANFCYKLPDNVTFEEGALIPLSVGI-
YBI2_SCHPO      LAVGSEVKEFSATQRVW-----GCQSFPRAGRQGGSCATHIVTGDKDVWHLPDGVSFNEGAGFGIAGLTA
PKS25_DICDI     -------------SRVGIKSSKEFKVGVYGIGQSTSSSHIIIDSMHACHK-PSKITHVQAASIPAVYATS
ZDH1_STAES      EKIGDQVSMFQEGDVVFYSG---------SPNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTA
TDH_YERE8       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
MECR_ARATH      XXXXSNVNGFSPGDWVIPSPPS-----------SGTWQTYVVKEESVWHKIDKECPMEYAATITVNPLTA
PKS1_DICDI      ---------------------------------------------------PDTISFSEAASIPVVYCTA
ZDH1_STAEQ      EKIGDQVSMFQEGDVVFYSG---------SPNQNGSNEEYQLIEEYLVAKAPTNLKSEQAASLPLTGLTA
PKS33_DICDI     XXXXXXXXXXXXFSGIITRLGNNVKKFKVGDQVCGIGPKA--SSSHVIVDFPFNCNHSVSASIPSIYITS
TDH_SERP5       VAIGQEVKGFTVGDRVTCGHCRNCRGGRVGVNRPGSFAEYLVIPAFNAFKIPDNISDELASIFDPFGNAV
PKS15_DICDI     ------------------------------------------------VKKPTNLSHSEAASIPAVYLTS
P2_ARATH        ----------------------------------------------------------------------
ADH5_YEAST      -----------------------------GFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV
ADH5_SACPS      -----------------------------GFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV
ADH1_ASPFN      XXXXDLVTEFEIGDHAGLKWLNGSNASLSGYTVDGTFQQYAIGKATHASKLPKNVPLDAVAPVLCAGITV
YHFP_BACSU      VSSNDPRFAEG--DEVIATSYE------LGVSRDGGLSEYASVPGDWLVPLPQNLSLKEA----MVYGTA
ADH_RALEU       EKLGSAVTGYREGQRVIAGAIKATAGWRFGNMIDGTQAELVPDAQANLTPIPDGLTDEQVLMCPDIMSTG
ZDH1_STAAC      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
TDH_PHOLL       VAIGQEVKGFKIGDRVSGEGCRNCRGGRVGVNRAGCFAQYLVIPAFNAFKIPDNISDELAAIFDPFGNAV
TDH_CHRVO       ----------------------------VGVNREGAFAEYLVIPAFNAFPIPDDISDDLASIFDPFGNAV
PKS38_DICDI     GIGIDNPKIGNDFSGIITRLGCNVKDFKVGDQVCGVGSKTNSSHINYIYYKPLNYSYSVSASIPSVYITS
TDH_PSEHT       VDMGQEVRGFKVGDRVSGEGLCRNTTGV-GVNREGAFAEYLVIPAFNAFKIPDNISDELASIFDPFGNAV
PKS34_DICDI     XXXXXXXXXXXXFSGIITRLGNNVKKFKVGDQVCGIGSKA--SSSHVIVDFPLNYSHSVSASIPSIYITS
PKS32_DICDI     ---------------------------------------------------PLNYNHSVSASIPSIYITS
PKS28_DICDI     ---------------------------------------------------PLNYNHSISASIPSIYVTS
ZDH1_STAAN      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
ZDH1_STAAM      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
YJMD_BACSU      ---------------------------VFGVHEDGGMREYIVLPERQLHAVSKDLPWEEAVAEPYTIGA-
TDH_SALTY       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALSV       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALPK       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALPC       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALPB       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALPA       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALNS       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALHS       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALEP       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALDC       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALCH       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALA4       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
MECR1_CAEEL     ISVGSNVSSIKVGDHVIPD-----RSGL------GTWRELGLHQENDLFPIDNTLSMEYAATFQVNPPTA
ADH2_PICST      ---------------------NCPDADLSGYTHDGSFQQYATADAIQAARIPKGTDLALIAPILCAGITV
ZDH1_STAAR      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
TDH_SALTI       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SALAR       XXXXQEVKGFNIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
DHSO2_YEAST     VEVGDAVTRVKVGDRVAIEP--GVPSRYSDETKEGSY-NLCPHMAFALVKLPEGVSYEEGACVPLSVGVH
BDHA_BACSU      XXXXXXXXNYKVGDRVVVEPIFATHGHQGAYNLDEQMSEYVSVDEELLFKLPDELSYEQGALVEPSAVAL
ZDH1_STAAW      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
ZDH1_STAAS      -----------------------------------------------VAKAPHNISANEAVSLPLTGITA
YDJJ_ECOLI      -------------------------------------------------KLPDNMTMEGALVEPAAVGMH
TDH_PYRFU       XXXXXXXXXXXXXDYVSVE--THIVCGIFGVDTDGVFAEYAVVPAQNVWKNPKNIPPEYAT-LQEPLGNA
QOR_LEIAM       ----------------------------------GCFAEFLDAPAERCIPVPELKP--EYSVLPVSALTA
DHSO1_YEAST     VEVGDAVTRVKVGDRVAIEP--GVPSRYSDETKEGRY-NLCPHMAFALVKLPEGVSYEEGACVPLSVGVH
FAS_CHICK       ---------------------------VMGLLPAKGLATVVDCDKRFLWEVPENWTLEEXXXXXXXXXXX
PKS31_DICDI     ---------------------------------------------------PLNCSHSVSASIPSIYITT
PKS26_DICDI     ---------------------------------------------------PSKLSHTIASSIPVVYITS
ADH1_YEAST      ---------------------------LSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITV
TDH_THEON       IEVGPGVDTINVGDYISAETHNRYHTKIFGVDMDGVFAEYAIVPAQNAWKNPKDMPPEYAT-LQEPLGNA
TDH_PYRHO       XXXXXXXXXXXXXDYVSVE--THIVCGIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYAT-LQEPLGNA
TDH_KLEP7       XXXXQEVRGFKIGDRVSGEGLCRNTIGV-GVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_KLEP3       XXXXQEVRGFKIGDRVSGEGLCRNTIGV-GVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
PKS21_DICDI     ---------------------------------------------------PENISHVEAASLPVIFSTC
PKS39_DICDI     DNPKIGNDFSGIITRLGCN----VKEFKVGDQVCGFGS---KTNSSHIIVDSDSIYYKPSASIPSIYITS
ADH_STAAW       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAAS       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAAR       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAAC       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAAB       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAA8       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAA3       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADHP_ECOLI      -----------------------------GYSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTT
TDH_THETN       VEIGENVTSVKVGD--LVSAETHIVCGILGVDTDGAFAEYIKVPESNVWINDKNIPLEILSIQEPLGNAV
TDH_ENT38       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOLI       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAV
TDH_ECODH       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAV
TDH_ECOBW       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAV
TDH_BURPS       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURP6       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURP1       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURP0       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURMS       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURMA       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURM9       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
TDH_BURM7       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
PKS30_DICDI     ---------------------------------------------------PLNYNHSVSASIPSIYITS
TDH_SHESH       IDMGIEVRGFDVGDRVTCGHCRNCRGGRVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAV
TDH_CITK8       XXXXQEVKGFRIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVLPAFNAFKIPDNISDDLASIFDPFGNAV
QORL1_HUMAN     -------------------PDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRA
QORL1_BOVIN     -------------------PDDEVVGILPLDSEDPGLCEAVRVHEHYLVHKPEKVTWTEAAGTIRDGLRV
PKS29_DICDI     ---------------------------------------------------PLNYSHSVSALIPSVYITS
PKS19_DICDI     ---------------------------------------------------PNNISHIEAASLPIIFSTC
ADH_STAAN       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH_STAAM       -----------------------------GYTVDGAMAEQVIVTADYAVKVPEKLDPAAASSITCAGVTT
ADH2_KLUMA      ------------------------DADLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGVTV
ADH1_EMENI      VAKGELVHEFEIGDQAGIKWLNGSCGELSGYTVDGTFQQYALGKASHASKIPAGVPLDAAAPVLCAGITV
TDH_ECOLU       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
PTGR1_RABIT     ----------------------------------------------------------------------
PTGR1_CAVPO     ----------------------------------------------------------------------
DHSO_BACSU      AAVGSSVDQFKVGDRVAVEPCGRCEACKEGRPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGI
TDH_SHIFL       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SHIF8       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SHIBS       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_SHIB3       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_PYRAB       XXXXXXXXXXXXXDYVSVE--THIVCGIFGVDTDGVFAEYAVVPAQNVWKNPKSIPPEYAT-LQEPLGNA
TDH_ESCF3       XXXXQEVKGFKIGDRVSGEGLCRNTIGV-GVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOUT       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOSM       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOSE       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOLC       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOL6       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOL5       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOK1       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECOHS       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO8A       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO81       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO7I       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO5E       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO57       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO55       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO45       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_ECO27       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_BURTA       VEMGQEVRGFSIGDRVSGEGLCRNTVGV-GVNREGAFAEYLAIPAFNAFKIPPEISDDLAAIFDPFGNAT
QORL1_MOUSE     -------------------PDDEVVGILPLDSEDPGLCEVIRVHEHYLVHKPEKVSWTEAAGVIRDGVRA
ADH_SULSR       ----------------------------------------------------------------------
TDH_SHISS       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_PYRKO       XXXXXXXXDLQVGDYISVETHNRYHTKIFGVDMDGVFAHYAIVPAKNAWKNPKDMPPEYAA-LQEPLGNA
TDH_ECO24       XXXXQEVKGFMIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_BURS3       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
DHSO_BOMMO      VKVGDKVSSLRVGDRVAIEPTQRGKYNLCVESSMGAPGNLCRYYKHVADKLPDNLTMEEGAAVQPLAIVI
TDH_PROMH       VAIGQEVKGFNIGDRVTCGHCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNIPDELAAIFDPFGNAV
TDH_ENTS8       XXXXQEVKGFKIGDRVSGEGCRNCRGGRVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
TDH_BURCJ       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
TDH_BURCH       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
TDH_BURCC       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
TDH_BURCA       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
TDH_ALTMD       ----------------------------VGVNRPGAFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAV
ADHP_RABIT      -----------------------------------------------LAKIDDDANLERVCLIGCGFSTG
TDH_PSEA6       ----------------------------VGVNRAGAFAEYLSIPAFNAFKIPDNISDDLAAIFDPFGNAV
IDND_VITVI      EEVGSEVKNLVAGDRVALEPCNRCSLCRNGQPTNGSLANQVVHPSNLCFKLPDNVSLEEGAMCPLSVG-I
ADHA_RHIME      -----------------------------GYSVDGTFAQYGLADPDFVGRLPARLEFGPAAPVLCAGVTV
ADH1_KLULA      ---------------------NCPEADLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTV
XYL2_YEAST      ALIGENVKTLKVGDRVALEPSPEMKEGRYNLDPNGTLTKYYKTMKDFVYKLPDDVSFEEGALIEPLSVAI
TDH_ERWCT       VAIGQEVNGFHIGDRVSGEGLCRNAIGV-GVNRPGSFAEYLVIPAYNAFRIPDNISDELAAIFDPFGNAV
TDH_AERHH       VAIGQEVRGFAVGDRVSGEGLCRNTIGV-GVNRPGAFAEYLVIPAFNAFKLPDNVPDELAAIFDPFGNAV
PTGR1_MOUSE     ----------------------------------------------------------------------
ADHQ_RABIT      -----------------------------------------------LAKIDDDANLKRVCLIGCGFSTG
YMN1_YEAST      ----------------------------------------------------------------------
TDH_BURVG       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
Y053_HAEIN      ---------------------------VIGVHIDGGMQEVIRHPAHLLTKVPDNLPIHQAEPLTIALHAL
TDH_BURM1       VEMGQEVRGFAIGDRVSGEHLCRNTVG-VGVNREGAFAEYLAIPAFNAFKIPPEISDDLASIFDPFGNAT
TOXD_COCCA      ---------------------------------DGTFAEVITVKGDIQAWIPENLSFQEAATLGVGIKTV
TDH_AERS4       VAVGQEVRGFAVGDRVSGEGLCRNTIGV-GVNRPGSFAEYLVIPAFNAFKLPDNIPDELAAIFDPFGNAV
MTDH_PETCR      -----------------------------GSITYGGYADSMVADQHFVLRWPENLPLDSGAPLLCAGITT
YFMJ_BACSU      ----------------------------------------------------------------------
TDH_SILPO       VELGRDVTGLSIGQRVLIGTESRLDPGTRGIGVNGAFAQYLRLPAFNVVPLPEDIPDEIGAILDPLGNAV
TDH_EDWI9       VAVGQEVRGFRIGDRVSGEGLCRNTIGV-GVNRQGAFAEYLVIPAFNAFKIPDNIP-DALAAIFDPFGNA
QOR_SCHPO       XXXXXXXXXXFKVDRVVY------------LTPFGAYAQYTNVPTTLVSKVSEKIPLKIASAALLQGLTA
ADHA_BACSU      -----------------------------GNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGITT
ADH3_EMENI      ---------------------------LSGYTVDGTFQQYTIGKAALASKIPDNVPLDAAAPILCAGITV
CADH_POPDE      -----------------------------GKPTQGGFAESMVVHQKFVVRIPDGMSPEQAAPLLCAGLTV
PKS5_DICDI      ---------------------------------------------HERIQIPSNISHIEAASIPIDYLTS
CADH_SACOF      -----------------------------GRPTQGGFASTMVVDQKFVMKIPAGLAPEQAAPLLCAGVTV
YNN4_YEAST      -------------------------------------------------------SLEGAVSLPVSLTTA
YHDH_ECOLI      TVRTSEDPRFHAGQEVL------LTGWGVGENHWGGLAEQARVKGDWLVAMPQGLDARKAMIIGTAGFTA
MECR_DICDI      ----------------------------------------------QLFKVPSDIPTEYLSTISINPTTA
YBJB_SCHPO      ISGA---------SHLVGTRVFGTSGSELSFTKDGTHAEYCIIPEKAAVRMPSNLSFTEAASVGVPFTTA
RT4I1_DICDI     VEIGDSVWDYEIGDQV---------WSASPPFSMGSHCEYITVDESEISLKPKNLTHQQSASIPFASLTA
PKS22_DICDI     ----------------------------------------------------------------------
MTDH_APIGR      -----------------------------GTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITT
YCZ2_YEAST      -------------------------------------------------------SLEGAATIPVSLTTA
PTGR1_BOVIN     ----------------------------------------------------------------------
MECR_DROME      ICVGDKVKGFEAGQHVI--PL---ASGLGTWTTHAVYKE------DQLLIVSKKVGLAEAATSTVNPTTA
CADH3_ARATH     -----------------------------GTRNQGGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITV
YNCB_ECOLI      --------------------------------------------------------------------TA
CADH1_ORYSJ     -------------------------------------------------KIPDGYPLEKAAPLLCAGITV
CADH1_EUCGU     -----------------------------GKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTV
TDH_STRAW       VETGRDVVDIKAGDRV------SGEGHLVGKCRNAGRRHLCRATVG--LGVGRDGAFAEYVALPAANVWV
TDH_LEGPA       VEVGKEVQGLKVGQRVSGE--GHITCGFVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAA
CADH2_ARATH     ----------------------------------GGYSDVIVVDHRFVLSIPDGLPSDSGAPLLCAGITV
YL460_YEAST     -------------------------------------------------------SLEGVATIPVSLTTA
PKS23_DICDI     ----------------------------------------------------------------------
YPHC_ECOLI      -----------------------------GWQRDGGHAEYLLAEEKDLILLPDALSYEDGAFISCGVGTA
TDH_LEGPH       VEVGKEVQGLKVGQRVSGE--GHITCGFVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAA
PKS14_DICDI     ---------------------------------------------NQIYHKPTNINHIEAASIPGVYLTS
ETR1_YARLI      -------------------------------------------RSHALVEADTVVKIDQATTVSVNPSTA
ADH_SULSO       ----------------------------------------------------------------------
ADH_STAEQ       -----------------------------GYTVDGAMAEEVIVDANYAVKVPENLDPAAASSITCAGVTT
YJGB_ECOLI      ------------------------EQGAVPTIMNGGFAEKLRADWQWVIPLPENIDIESAGPLLCGGITV
YGCW_ECOLI      ----------------------------------------------------------------------
TDH_LEGPL       VEVGKEVQGLKVGQRVSGE--GHITCGFVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAA
TDH_LEGPC       VEVGKEVQGLKVGQRVSGE--GHITCGFVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAA
DOIAD_STRSD     ----------------------------LGFTRDGACAEYMTIPTGNLHVLPEGLSLRAACQVEPVAVAL
ADH_STAES       -----------------------------GYTVDGAMAEEVIVDANYAVKVPENLDPAAASSITCAGVTT
PTGR1_RAT       ----------------------------------------------------------------------
CADH5_ARATH     -----------------------------GQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTV
CADH1_TOBAC     -----------------------------GKPTQGGFAKSMVVDQKFVVKIPEGMAPEQAAPLLCAGITV
TDH_STRCO       VDTGRDVTDIKAGDRV------SGEGHLVGKCRNAGRRHLCRATVG--LGVGRDGAFAEYVALPASNVWV
CADH_EUCGL      -----------------------------GKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTV
CADH2_EUCGU     -----------------------------GKPTQGGFAGEIVVGERFVVKIPDGLESEQAAPLMCAGVTV
DHSO_SCHPO      -------------------------------------------------KLPKQISVEEGALFEPMSVAV
CADH4_ORYSJ     -----------------------------GTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITV
XYLD_MORMO      TAAGKNVKHLKVGDRVCMEPLDPAVRFWATPPIDGCLRESVIHPAAFTFKLPDNVSFAQGAMVPLAIG--
PTGR1_HUMAN     ----------------------------------------------------------------------
ADH2_EMENI      --------------------------------------------AQYVTPIPDGLPSAEAAPLLCAGVTV
FABG_VIBCH      ----------------------------------------------------------------------
ETR1_SCHPO      -------------------------------------------------------SIAEAATLSVNPCTA
CADH1_OCIBA     -----------------------------GKPTQGGFAGAMVVDQKFVVKIPDGMAPEQAAPLLCAGVTV
CADH1_ARATH     -----------------------------GSVTKGGYSSHIVVHERYCYKIPVDYPLESAAPLLCAGITV


                         +         .         .         .         .         *         .:210
query           HRMMTTNGHVKAGEKVLILGASGGVGVCCVQLAKIAGAYVIACAGSEEKGQRLKEVGADEVILYTKEDFM
VAT1_DANRE      YMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKHEVISQGGVTHPIDYRTRDYV
QORL_ARATH      DEGLVRT-EFSAGKSILVLNGAGGVGSLVIQLAKVYGASKVAATASTEKLELVRSLGADLAIDYTKENIE
QOR_PONAB       YRALIHSAHVKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREVNYI
QOR_HUMAN       YRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYI
YOGA_BACSU      YRALFTKGQLKKGEHLLIPGIGSGVATYALFMAKAIGATVSVTSRSEEKRKKALKLGAD----YAFDSYS
QOR_BOVIN       YRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLENGAHKVFNHKEADYI
QOR_LAMGU       YRALLHSACAKAGESVLVHGASGGVGLAACQIARACCFKVLGTAGTEEGQRVVLQNGAHEVFNHREDINI
QOR_CAVPO       CRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYI
QORX_HUMAN      FQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFS
VAT1_MOUSE      YMVLFDFGNLRPGHSXXXXXXXXXXXXXXXQLCRTVENVTVFGTASASKHEVLKENGVTHPIDYHTTDYV
QOR_PIG         CLALLHSACVKAGEIVLIHGASGGVGIAACQIARAYGLKVLGTAGTEEGQNIVLQNGAHEVFNHREVNYI
VAT1_HUMAN      YMVLFDFGNLQPGHSVLVHXXXXXXXXXXXQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYV
QOR_MOUSE       CRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYI
QOR_RAT         CRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYI
QORL2_BOVIN     IFALEHRACTQPGEXXXXXXXXXXXXXXXIDVANILQAKVIAAAGSDEKCQLAMQSGAQSSVNYSRGSLK
QORL2_MOUSE     ILAVDHRARIQPGEXXXXXXXXXXXXXXXIDVANVFRAKVIAATGSDEKCKLAVQRGAQFSVNYSQGSLR
QOR_YEAST       LSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDIL
QOR_SALTY       FYLLRKTYEVKPDEPFLFHAAAGGVGLIACQWAKALGAKLIGTVGSAQKAQRALDAGAWQVINYREESIV
ADH2_BACST      YKALKVSG-ARPGEWVAIYGI-GGLGHIALQYAKAMGLNVVAVDISDEKSKLAKDLGADIAINGLKEDPV
QORL2_RAT       ILAVDHRARIQPGEXXXXXXXXXXXXXXXIDVANVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYSQGSLK
ADH3_BACST      YKALKVTG-AKPGEWVAIYGI-GGLGHVAVQYAKAMGLNVVAVDIGDEKLELAKELGADLVVNPLKEDAA
QORL2_NEMVE     YIGLKHKANLQPGQXXXXXXXXXXXXXXXXXXXNVFGAKVIG-ASRKEKLVIVQEIGATATIDYTRENIK
VAT1_TORCA      YVMIYDFANLRPSQSILIHMAAGGVGIAATQLCKLVHDVTIFGTASPSKHETIKENGVTYPIDYTTLDYA
QOR_ECOLI       YYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLV
ADH1_BACST      YKALKVTG-AKPGEWVAIYGI-GGLGHVAVQYAKAMGLNVVAVDLGDEKLELAKQLGADLVVNPKHDDAA
MCAS_MYCBO      WYGLNDLAQIKAGDKVLIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLRDMGVEHVYDSRSVEFA
RT4I1_DANRE     WSAIVNTGGLNAKKRVLILGGSGGVGTFAIQMVKAWGAHVVTCSQNAER--LVRDLGADDVVDYTAGPVE
RT4I1_MOUSE     WSAINKVGGLSKGKRALILGASGGVGTFAIQVMKAWGAHVTAVC-SKDASELVRKLGADEVIDYTVEEQL
ADH_SCHPO       YRALKES-KVGPGEWICIPGAGGGLGHLAVQYAKAMAMRVVAIDTGDDKAELVKSFGAEVFLDFKKEDMI
QOR_PSEAE       QYLLRQTYELRGGETILFHAAAGGVGLFACQWAKALGVQLIGTVSSPEKARLARQHGAWETIDYSHENVA
RT4I1_HUMAN     NKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYSVEEQL
RT4I1_BOVIN     NKVGGLNDRNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVC-SQDASELVRKLGADDVIDYKSGNVE
VAT1L_MOUSE     YTMLFEIANLREGMSVLVHSXXXXXXXXXXXLCSTVPNVTVFGTASTFKHEAIKDSVTH--LFDRNADYV
VAT1L_HUMAN     YVMLFEVANLREGMSVLVHSXXXXXXXXXXXLCSTVPNVTVFGTASTFKHEAIKD--SVTHLFDRNADYV
YGD6_SCHPO      NGLFGSKEHQVKPXXXXXXXXXXXXSTFALQFALAAGANVTVTSSSDEKLEFAKKLGATHTINYKK----
ADH1_KLUMA      YKALKS-AHIKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDAGDEKAKLFKELGGEYFIDFTKTKDM
ZADH2_BOVIN     YISLKELGGLSEGKKVLVTAAAGGTGQFAVQLAKKAKCHVIGTCSSAEKSAFLKSVGCDRPINYNTEHVG
ADH_SULTO       YRAVR-KASLDPSKTLVVIGAGGGLGTMAIQIAKVSGATIIGVDVREEALEAAKRAGADYVINASSQDPV
YKM8_SCHPO      YCGLKHIGKPKAGETIYISAASGAVGQMAGQLAKAMGLHVVGSVGSDEKFKICLDSGYDSVFNYKKESPF
PKS16_DICDI     YYSIFHIGAFMADESILVHSATGGVGLATLNLLKSNDASIYATVGSKEKVDYLQEKYGDLIAIYNSRDYC
ADH_SULAC       YRALRL-ANLDPSKSVMXXXXXXXXXXXXVQIAKIHGSFIIGVDVSEEGLKLATNLGADYVT--SKVDEE
ADH1_NEUCR      YKGLKESG-VRPGQCVAIVGAGGGLGSMAIQYANAMGLHAIAIDGGEEKGKNCRELGAQAYVDFTTTKDL
ZADH2_HUMAN     YISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVG
PKS17_DICDI     YSIFHIGAFIADKESILVHSATGGVGLASLNLLKSNDASIYATVGSKEKIDYLQEKYGDLIAIYNSRDYC
MECR_DANRE      YRMLTDFEELKAGDTVIQNAANSGVGQAVIQIAAAKGIHTINVIRDRQLSDRLTAMGATHVI--TEETLM
ZADH2_MOUSE     YXXXXXXXXXXXXKKVLVTAAAGGTGQFAVQLSKIAKCHVIGTCSSDEKAAFLKSIGCDRPINYRTEPVE
QORH_ARATH      LQALTNPAGLKTGKKILVTAASGGVGHYAVQLAKLANAHVTATCGARNI-EFVKSLGADEVLDYK-----
MECR_HUMAN      YRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDQKLSDRLKSLGAEHVI--TEEEL-
FAS_RAT         YYSLVVRGRIQHGETVLIHSGSGGVGQAAISIALSLGCRVFTTVGSAEKRAYLQAPQLDDTSFANSRDFE
ADH1_CANAL      YKALKT-ADLAAGQWVAIXXXXXXXXXXXVQYARAMGLRVVAIDGGDEKGEFVKSLGAEAYVDFTKDDIV
PKS2_DICDI      YYSLFVAGYIEKKESVLIHGGTGGIGLACINLLKAKGGYLFVTVGSKEKENFLRVTYGNFITIYSSQNTD
YDJL_ECOLI      YKSIAQQSKFLPGQDVVVIG-TGPLGLFSVQMARIMGAVNIVVVGLQERFPVAKELGATAVVNGSTEDVV
PKS3_DICDI      LHSIYNIGNLKNYESILIHSASGGVGLSSLNILKWKGSYIFLTVGSPEKEKYLRDTGSLITGIYSTRD-K
FAS_MOUSE       YYSLVVRGRIQRGETVLIHSGSGGVGQAAISIALSLGCRVFTTVGSAEKRAYLQAPQLDDTSFANSRDFE
TDH_SYMTH       HTAL--NGDLTA-RSVLITGC-GPIGIMSVPVAKMAGAIVMAMDINEYRLQLAGQLGADVLINPTKQDPV
FAS_BOVIN       YYALMVRGRMQPGETVLIHSGSGGVGQAAIAIALSLGCRVFPLVGSAEKRAYLQS-------RFPQLNET
PKS37_DICDI     WYSIVIQGRLKKGEKILIHSGCGGVGLATIQISMMIGAEIHVTVGSNEKKQYLKEFGIDEKRIYSSRS-L
FAS_HUMAN       YYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQ-------ARFPQLDST
ERYA2_SACER     HYALHDLAGLRAGQSVLIHXXXXXXXXXXXXXXXXXXXXXXXTAGPAKHG-TLRALGLDDEHIASSREFA
DHSO_MOUSE      --YACRRGSVSLGNKVLVCGA-GPVGMVTLLVAKAMGAQVVVTDLSASRLTKAKEVGADFTIQVGKETPQ
DHSO_HUMAN      ---ACRRGGVTLGHKVLVCGA-GPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQISKESPQ
ADH2_KLULA      YKALKS-ADLKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDTGAEKAKLFKELGGEYFVDYSKDLIK
QORH_SPIOL      XXXLTQFANIKSGERILITAASGGVGHYAVQLAKLGNTHVTATCGARNL-DFVKGLGADEVLDYK-----
DHSO_RAT        --YACRRGSVSLGNKVLVCGA-GPIGIVTLLVAKAMGAQVVVIDLSASRLAKAKEVGADFTIQVAKETPH
ADH3_KLULA      YKALKS-ANLKAGDWVXXXXXXXXXXXXXVQYAKAMGYRVVGIDGGEEKGKLVKQLGGEAFVDFTKTKDM
PKS45_DICDI     FYSLFYSGNLKINESVLIHQASGGIGLACLNILKSCGSKLYVTVGSKEKEDYLRETYGDFITIYSSRDFL
DHSO_PONAB      ---ACRRGGVTLGHKVLVCGA-GPIGMVTLLVAKAMGAQVVVTDLSATRLSKAKEIGADLVLQISKESPQ
MECR_RAT        YRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALGLKTINVIRDKKLTDRLKDLGADYVL--TEEEL-
TDH_YERPP       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVIADVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPN       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVIADVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPG       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVIADVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPE       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVIADVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPA       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVIADVNEYRLDLARKMGVTRAVNVSKENLN
PKS44_DICDI     FYSLFYSGNIKNNESVLIHQASGGIGLACLNILKSCGSKLYVTVGSKEKEDYLRETYGDFITIYSSRDFL
ADH2_CANAL      YKALKT-AELEAGQWVXXXXXXXXXXXXXVQYAKAMGYRVLAIDGGEDKGEFVKSLGAETFI-----DFT
TDH_YERPY       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPS       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERPB       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVSKENLN
TDH_YERP3       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVSKENLN
MECR_BOVIN      YRMLVDFERLRPRDSIIQNASNSGVGQAVIQIAAARGLRTINVLRDTPDLQKLKNLGANHVV--TEEEL-
INC11_TRIAT     YGMVHRAAKVSEGQRVFIHGISGAVGQAVMYLSLLQGATVYGTA-SERNHAALKEAGA-HPYLYTNKDWI
ADH1_ZYMMO      YKAVKVS-QIQPGQWLAIYGL-GGLGNLALQYAKVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAA
P1_ARATH        ----------KEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKKFGFDDAFNYKEESDL
DHSO_MACFA      ---ACRRGGVTLGHRVLVCGA-GPIGVVSLLVAKAMGAQVVVTDLSAPRLSKAKEIGADLVLQISKESPQ
PKS41_DICDI     YHSLYNIGALKNNETILIHSATGGVGLSTLEILKWKGGLIFVTVGSNEKEEYLRENYGDMISIYSNKNFV
PKS40_DICDI     YHSLYNIGALKNNETILIHSATGGVGLSTLEILKWKGGLIFVTVGSNEKEEYLRENYGDMISIYSNKNFV
MECR_MOUSE      YRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDKKLTDRLKDLGADYVL--TEEELR
ADH1_PICST      YKALKT-AQIQPGNWVCXXXXXXXXXXXXXQYAKAMGFRVIAIDGGEEKGEFVKSLGAEAYVDFTSKDIV
DHSO_BOVIN      ---ACRRAGVTLGNKVLVCGA-GPIGLVSLLAAKAMGAQVVVTDLSASRLSKAKEVGADFILQISNESPQ
PKS18_DICDI     LCSIFNIGSVSGNESILIHSGTGGVGLSALNILKWKGSHVFVTVGSKEKEKYLLDTYGDFITGIYSTRNK
DHSO_SHEEP      --HACRRAGVTLGNKVLVCGA-GPIGLVNLLAAKAMGAQVVVTDLSASRLSKAKEVGADFILEISNESPE
YBI2_SCHPO      WEVLVRQMKVKPGTKLVIEGASGGVGTFAVALAKALECEVTTIS-STENLDLCKSLGATHTLDYKKDNLV
PKS25_DICDI     IHSLYNIGNLREGESILIHSGSGGVGLSALEILKSHSSPIFVTVGSEEKKQYLINTYGNLITIYSTRD-T
ZDH1_STAES      YETLSKEPSENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGAD-VVLNHKKDLS
TDH_YERE8       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVNKENLN
MECR_ARATH      LRMLEDFVNLNSGDSVVQNGATSIVGQCVIQLARLRGISTINLAGSDEAREQLKALGADEVFSESQLNVK
PKS1_DICDI      WYSLFNIGQLSNEESILIHSATGGVGLAXXXXXXXXXTNVYATVGSNEK----KKFLIDNFNNLFKEDGE
ZDH1_STAEQ      YETLSKEPSENKGKSLLIINGAGGVGSIATQIAKFYGLKVITTASREDTIKWSVNMGAD-VVLNHKKDLS
PKS33_DICDI     LHSIYSIGNLKSNESILIHSAAGGIGISSLDLSKQHQGYIFLTVGSKDKEEYLKKYGSLITAIYSSRNKN
TDH_SERP5       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLDLARKMGVTRAVNVSKENLN
PKS15_DICDI     LYSIFNIGNIQDNESILIHSGTGGVGLSALNILKWKGSHLFVTVGSKEKEQYLIDTYGDFITGIYSTRNK
P2_ARATH        ----------KKGETVYVSAASGAVGQLVGQFAKMMGCYVVGSAGSKEKVDLLKKFGFDDAFNYKEESDL
ADH5_YEAST      YKAL-KRANVIPGQWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDFTEEDIV
ADH5_SACPS      YKAL-KRANVIPGQWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDFTEEDIV
ADH1_ASPFN      YKGLKESG-VRPGQTVAIVXXXXXXXXXXXQYAKAMGIRVVAIDGGEEKQAMCEQLGAEAYVDFTKTQDL
YHFP_BACSU      HR-LEQNGLSPEKXXXXXXXXXXXXXXXXXXMLNKRGYDVVASTGNREAADYLKQLGASEVI--SREDVY
ADH_RALEU       FKG-AENANIRIGHTVAVF-AQGPIGLCATAGARLCGATIIAIDGNDHRLEIARKMGADVVLNFRNCDVV
ZDH1_STAAC      YETISTNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
TDH_PHOLL       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVCKHVGAHVVITDVNEYRLELARKMGVTRAVNVSQENLT
TDH_CHRVO       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGAHVVITDVNDYRLELAKKMGATRAVNVAREDLK
PKS38_DICDI     LHSIYNIGNLKSNESILIHSAAGGIGISSLDLSKQHQGYIFLTVGSKDKEEYLKKYGSLITAIYSSRNKN
TDH_PSEHT       HTALSFD---LVGEDVLITGA-GPIGIMAAAVAKHVGAHVVISDVNEYRLELARKMGATRAVNVANEKLE
PKS34_DICDI     LHSIYSIGNLKSNESILIHSAAGGIGISSLDLSKQHQGYIFLTVSSKDKEEYLKKYGSLITAIYSSRNKN
PKS32_DICDI     LHSIYSIGNLKSNESILIHSAAGGIGISSLDLSKQHQGYIFLTVGSKDKEEYLKKYGSLITAIYSNKDYV
PKS28_DICDI     LHSIYGVGNLKSNESILIHSAAGGIGISSLDLLKCKQGHIFLTVGSKDKEDYLKKYGSFITAIYSNKDYV
ZDH1_STAAN      YETISHNPSENVGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
ZDH1_STAAM      YETISHNPSENVGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
YJMD_BACSU      --QAVWRGQVEKGDTVLIQGA-GPIGICVLKMAKLAGAAVMMTDLNNERLAFAKENGADAVVNVQAEHVA
TDH_SALTY       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALSV       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALPK       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALPC       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALPB       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALPA       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALNS       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALHS       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALEP       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALDC       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALCH       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALA4       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
MECR1_CAEEL     YRMLKDFIDLKKGDTVAQNGANSAVGKHVIQICRILGIKTVNVVRSEELVKELKDLGADEVI--TQEEL-
ADH2_PICST      YKALKT-AQLQAGQWXXXXXXXXXXXXXXIQYAKAMGYRVVGIDGGADKGEFAKSLGAEVFVLSSKDVVA
ZDH1_STAAR      YETISHNPSENIGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
TDH_SALTI       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLN
TDH_SALAR       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGAHVVITDVNEYRLELARKMGVTRAVNVAKESLT
DHSO2_YEAST     SNKL---AGVRFGTKVVVFGA-GPVGLLTGAVARAFGATVIFVDVFDNKLQRAKDFGATNTFNSSQFSTD
BDHA_BACSU      YAVRSSK--LKAGDKAAVFGC-GPIGLLVIEALKAAGATIYAVELSPERQQKAEELGAIIVDPSKTDDVV
ZDH1_STAAW      YETISHNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
ZDH1_STAAS      YETISHNPAENEGKSVLIINGAGGVGSIATQIAKRYGLTVITTASRQETTEWCEKMGAD-IVLNHKEDLV
YDJJ_ECOLI      AAMLAD---VKPGKKIIILGA-GCIGLMTLQACKCLGATEIAVVDVLEKRLAMAELGATVVINGAKEDTI
TDH_PYRFU       --VDTVLAGPIAGKSVLITGA-GPLGLLGIAVAKASGAYVIVSEPSEFRRNLAKKVGADYVINPFEEDVV
QOR_LEIAM       AVALGEVGRVKKGDVALVXXXXXXXXQIAVQLLKVYGCTVIGTCSSEEKAEFLKSIGCDHVINYKTESL-
DHSO1_YEAST     SNKL---AGVRFGTKVVVFGA-GPVGLLTGAVARAFGATVIFVDVFDNKLQRAKDFGATNTFNSSQFSTD
FAS_CHICK       XXXXXXRGGMKKGESVLIHSGSGGVGQAAIAIALSMGCRVFATVGSAEKRERFPQLDANSFASSRNTTFQ
PKS31_DICDI     LHSIYSIGNLKSNESILIHSAAGGIGISSLDLSKQHQGYIFLTVGSKDKEEYLNKYGSLITAIYSSRN-K
PKS26_DICDI     LYSLYNIGNIQNDESILIHSASGGIGLSALNILKWKNSHIFVTVGSKEKEKYIHDTYGDFITIYSNKDYL
ADH1_YEAST      YKALKS-ANLMAGHWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEDIV
TDH_THEON       --VDTVLAGPIAGRSTLITGA-GPLGLLGIAVAKASGAYVIVSEPSEFRRELAKKVGADYVVNPFEEDPV
TDH_PYRHO       --VDTVLAGPISGKSVLITGA-GPLGLLGIAVAKASGAYVIVSEPSDFRRELAKKVGADYVINPFEEDVV
TDH_KLEP7       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGANVVITDVNEYRLELARKMGVTRAVNVAKENLN
TDH_KLEP3       HTALSFD---LVGEDVLVSGA-GPIGVMAAAVAKHVGANVVITDVNEYRLELARKMGVTRAVNVAKENLN
PKS21_DICDI     HGMFNINFNIDDDEVILIHSATGGIGLATLEILKWKGSPIFVTVGSKDKEQYLDNYGSFITGIYSSRN-K
PKS39_DICDI     LHSIYGIGNLKSNESILIHSAAGGVGLSSLDLSKQHQGYIFLTVGSKDKEEYLNKYGSLITAIYSSRN-K
ADH_STAAW       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAAS       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAAR       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAAC       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAAB       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAA8       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAA3       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADHP_ECOLI      YKAVKLS-KIRPGQWIAIYGL-GGLGNLALQYAKVFNAKVIAIDVNDEQLKLATEMGADLAINSHTEDAA
TDH_THETN       HTVFS--GDV-VGKSVAVIGC-GPIGMMAIPLLKRTGAAAIAIEPADYRRELAHKLGATRVINPLREDVV
TDH_ENT38       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLSLARKMGVTRAVDVSKENLN
TDH_ECOLI       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECODH       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOBW       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_BURPS       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURP6       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURP1       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURP0       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURMS       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURMA       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURM9       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
TDH_BURM7       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVSRESLR
PKS30_DICDI     LHSIYSIGNLKSNESILIHSAAGGVGISSLDLSKQHQGYIFLTVGSKDKEEYLKKYGSLITAIYSSRN-K
TDH_SHESH       HTALSFD---LVGEDVLITGA-GPIGIMAAAVCRHVGAHVVITDVNEYRLELANKMGATRAVNVAKESLE
TDH_CITK8       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGAHVVITDVNEYRLELARKMGIIHTVNVAKENLT
QORL1_HUMAN     YTALHYLSHLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERF---------RPPIA
QORL1_BOVIN     YTALHYLSHLSPGKSVLIMDGASALGTIAIQLAHHRGAKVISTACSLEDKQFLERF---------RPPIA
PKS29_DICDI     LHSLYGIGSLKSNESILIHSAAGGVGISSLDLSKQHQGYIFLTVGSKDKEEYLNKYGSLITAIYSSRN-K
PKS19_DICDI     HGMFNINFNIDDDEVILIHSATGGIGLATLEILKWKGSPIFVTVGSKDKEQYLDNYGSFITGIYSSRN-K
ADH_STAAN       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH_STAAM       YKAVKVS-NVKPGQWLGVFGI-GGLGNLALQYAKVMGAKIVAFDINDDKLAFAKELGADAIINSKDVDPV
ADH2_KLUMA      YKALKT-AEMKAGDWVXXXXXXXXXXXXXVQYAKAMGFRVLGIDGGEGKEELFKSLGGEVFIDFTKSKDI
ADH1_EMENI      YKGLKEAG-VRPGQTVAIVXXXXXXXXXXXXYAKAMGIRVVAVDGGDEKRAMCESLGTETYVDFTKSKDL
TDH_ECOLU       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGVTRAVNVAKENLN
PTGR1_RABIT     ----------KSGDTVLVNXXXXXXXXXXXQIAKIKGCRVVGAAGSEEKVDYLKKIGFDFAFNYKTVKSL
PTGR1_CAVPO     ---------VKGGETVLXXXXXXXXXXXXXQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSL
DHSO_BACSU      HAAARTK--LQPGSTIAIMG-MGPVGLMXXXXXXXXXXGTIIVTDLEPRLEAAKKMGATHIINIREQDAL
TDH_SHIFL       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_SHIF8       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_SHIBS       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_SHIB3       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_PYRAB       --VDTVLAGPISGKSVLITGA-GPLGLLGIAVAKASGAYVIVSEPSDFRRELAKKVGADYVINPFEEDVV
TDH_ESCF3       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLE
TDH_ECOUT       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOSM       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOSE       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOLC       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOL6       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOL5       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOK1       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECOHS       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO8A       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO81       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO7I       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO5E       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO57       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO55       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO45       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_ECO27       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_BURTA       HTALSFN---LVGEDVLITGA-GPIGVMAVAIAKHVGANVVITDINDYRLDLARRMGATRAVNVSRESLR
QORL1_MOUSE     CTALYYLSQLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTAHSLEDKQHLERL---------RPSIA
ADH_SULSR       ------------------------------QIAKVGGATIIGVDVREEAVETAKRAGADYVINASVQDPL
TDH_SHISS       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_PYRKO       --VDTVLAGPIAGRSTLITGA-GPLGLLGIAVAKASGAYVIVSEPSEFRRKLAKKVGADYVVNPFEEDPV
TDH_ECO24       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLELARKMGITRAVNVAKENLN
TDH_BURS3       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
DHSO_BOMMO      HAC--NRAKITLGSKIVILGA-GPIGILCAMSAKAMGAKIILTDVVQSRLDAALELGADNVLLYTDEEVV
TDH_PROMH       HTALSFD---LVGEDVLVSXXXXXXXXXXXXCKHVGARHVVITDVNEYRLDLAKKMGVTRAVNVSKENLT
TDH_ENTS8       HTALSFD---LVGEDVLVSGA-GPIGIMAAAVAKHVGANVVITDVNEYRLSLARKMGVTRAVNVANESLQ
TDH_BURCJ       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
TDH_BURCH       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
TDH_BURCC       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
TDH_BURCA       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
TDH_ALTMD       HTALSFD---LVGEDVLITGA-GPIGIMAAAVAKHVGAHVVVTDINPYRLELAKKMGATRTVDVSKENLQ
ADHP_RABIT      YGAAINTAKVTPGSTCAVFGL-GGVGLSAIMGCKTAGASIIAIDINSDKFAKAKALGATDCLN-------
TDH_PSEA6       HTALSFD---LVGEDVLITGA-GPIGIMAAAVAQHVGAHVVITDVNEYRLDLARKMGASRAVNVAKESLK
IDND_VITVI      HACRRAN--VGPETNVLIMG-SGPIGLVTMLAARAFGAPRIVLVDVDD--QRLKDLGADDIIRVSTN--I
ADHA_RHIME      YKGLKET-EVRPGEWVLVSGI-GGLGHMAVQYAKAMGMHVAAADIFPDKLALAEKLGADLVVDARAPDAV
ADH1_KLULA      YKALKS-ANLKAGDWVXXXXXXXXXXXXXVQYAKAMGYRVLGIDAGEEKAKLFKDLGGEYFIDFTKSKNI
XYL2_YEAST      HANKLAK--IKFGARCVVFGA-GPIGLLAGKVASVFGAAVVFVDLLENKLETARQFGATHIV--NSGDLP
TDH_ERWCT       HTALSFD---LVGEDVLITGA-GPIGMMAAAVCRHVGANVVITDVNAYRLELASKMGATRAVNVAEEKLT
TDH_AERHH       HTALSFD---LVGEDVLITGA-GPIGIMAAAVCRHVGAHVVITDVNEYRLELARKMGATRAVNVTKEQLS
PTGR1_MOUSE     ---------VKGGETVMXXXXXXXXXXXXXQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYTVKSLE
ADHQ_RABIT      YGAAINDAKVTPGSTCAVFGL-GGVGLSAVIGCKTAGASIIAVDINSDKFAKAKALGATDCLN-------
YMN1_YEAST      ------------GKVYLISGAAGAVGTVCIQLAVFKASKVIAIAGGPEKVAFVESFGDNVVVDYKDPSFK
TDH_BURVG       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
Y053_HAEIN      HR--TT---LKSGEHIVXXXXXXXXXXXXXXXVQY-GAIPILVDILEQRLEYAKSLGIEHIVNPHKEDDI
TDH_BURM1       HTALSFN---LVGEDVLITGA-GPIGIMAVAIAKHVGANVVITDINDYRLELARKMGATRAVNVARESLR
TOXD_COCCA      GKLSWPTTPIEHAVPILIYGGSTATGTLAIQLAKLSGYRVITTC-SPHHFELMKSLGADLVFDY------
TDH_AERS4       HTALSFD---LVGEDVLITGA-GPIGIMAAAVCRHVGAHVVITDVNEYRLELARKMGATRAVNVSKEKLA
MTDH_PETCR      YSPLRYHGLDKPGTK-XXXXXXXXXXXXXXKMAKAFGAHVTVISTSESKKQELEKLGADEFLVSSDSDQM
YFMJ_BACSU      ------------------------------QIAKIKGARVVGIAGSDEKIDYLKELQFDEAINYKTADDI
TDH_SILPO       HTALSFD---LLGEDVLITGA-GPIGIMXXXXXXXXXXXXXXITDINADRLKLAQVPRARTVDVTREDLG
TDH_EDWI9       --VHTALSFDLVGEDVLVSGA-GPIGIMAAAVCRHVGAHVVITDVNDYRLDLARKMGVTRAVNVSRESLP
QOR_SCHPO       YTLIEEAYPVKTGDTXXXXXXXXXXXXXXCQMLRARNVHVIATASTAAKRRIAIKNGAEIACSY--EDLT
ADHA_BACSU      YSPLK-HWNVGPGKKVAIVGV-GGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGANHYFATSDPATF
ADH3_EMENI      YKGLKESG-ARPGQTVAIVXXXXXXXXXXXXYAKAMGLRTIAIDSGDEKKAMCEQLGAEVFI-----DFX
CADH_POPDE      YSPLKHFG-LKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSDKKREEMEHLGADEYLVSSDVESM
PKS5_DICDI      FMSLFNVGNIEDNESILIHLGSDSFGLSTFEILKWKGSNLFVTVNSDEIKQYLLNNYGDLITIYSNTDKG
CADH_SACOF      YSPLKAFGLTTPGLRGAILGL-GGVGHMGVKVAKAMGHHVVISSSSKKRAEAMDHLGADAYLV-------
YNN4_YEAST      GMILTHSSKAQRDQPILFWGGATAVGQMLIQLAKLNGFSKIIVVASRKHEKLLKEYGADELFDYHDADVI
YHDH_ECOLI      --MLCVMALEDAGVRIXXXXXXXXXXXXXXXLLHKLGYQVVAVSGRESTHEYLKSLGASRVL--------
MECR_DICDI      YLLLNDFVKLQQGDVIIQNASNSMVGLSVIQLAKARGIKTINVIGSEDNVQRLKQLGGDIVV---SEEYV
YBJB_SCHPO      Y-LALSRGETKGSDIXXXXXXXXXXXXXXCQIAEDWGCKVITVSRS----------GSTDINTVVDPELK
RT4I1_DICDI     YNVLPXXXXXXXXXXXLVNGGNGSVGFFILQLLK------------------------------------
PKS22_DICDI     --------------------------------------FLFVTVGSEEKKQFLKDRYGNEIYSTKNTDYE
MTDH_APIGR      YSPLKYYGLDKPGTKIXXXXXXXXXHV-AVKMAKAFGAQVTVIDISESKKEALEKLGADSFLLNSDQEQM
YCZ2_YEAST      GLVLTYNSTPQRNGPILLWGGATAVGQSLIQLAKLNGFTKIIVVASRKHEKLLKEYGADQLFDYHDIDVV
PTGR1_BOVIN     ---------VKGGETVLXXXXXXXXXXXXXXXXKLKGCKVVGTAGSDEKVAWLKKHGFDVALNYTVKSLE
MECR_DROME      YRMLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRELKQMLQCLGATEVLTEAEIRTS
CADH3_ARATH     YSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVVISRSSEKEREAIDRLGADSFLVTTDSQKM
YNCB_ECOLI      YMGLLDIGQPKEGEXXXXXXXXXXXXXXXXQIGKLKGCRVVGVAGGAEKCRHATEVGFDVCLDHHADDFA
CADH1_ORYSJ     YSPMMRHNMNQPGKSLGVIGL-GGLGHMAVKFGKAFGLKVTVISTSESKKEAIDLLGADNFVVSSDENQM
CADH1_EUCGU     YRPLVRFG-LKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSDKKTEALEHLGADAYLVSSDENGM
TDH_STRAW       HRVHTALSFPLVGEDVLITGA-GPIGMXXXXXXXXXXRNVMITDVSEERLELARKIGALNVADTTIADGQ
TDH_LEGPA       HCALAFD---VVGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLI
CADH2_ARATH     YSPMKYYGMTKESGKRLGVNGLGGLGHIAVKIGKAFGLRVVISRSSEKEREAIDRLGADSFLVTTDSQKM
YL460_YEAST     GLVLTYNSTPQRKGPILLWGGATAVGQSLIQLAKLNGFTKIIVVASRKHEKLLKEYGADELFDYHDIDVV
PKS23_DICDI     --------------------------------------FLFVTVGSEEKKQFLKDRYGNEIYSTKNTDYE
YPHC_ECOLI      YEGI-LRGEVSGSDNXXXXXXXXXXXXXXXXXKGRGAKRIIGVDMLPERLAMAKQLGVDHGYLATTEGLP
TDH_LEGPH       HCALAFD---VVGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLS
PKS14_DICDI     YHSIFNVGNIKRNEXXXXXXXXXXXXXXXXXXXKWKGSHIFVTVGSKEKEQYLINTYGDFITIYSNKDYS
ETR1_YARLI      YEMLKD---LKEGDWFIQNGGNSGVGRAAIQIGHIRGLKSISVVRDEVLKKELTDLGATHVI--TEEEAS
ADH_SULSO       ----------------------------------------------------------------------
ADH_STAEQ       YKAVKVSG-IEPXXXXXXXXXXXXXXXXXQYAKNVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPI
YJGB_ECOLI      FKPLLMH-HITATSRVXXXXXXXXXXXXXXXXHAM-GCEVTAFSSNPAKEQEVLAMGADKVVNSRDPQAL
YGCW_ECOLI      ------------GKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEMIEKQGV----EVDFM
TDH_LEGPL       HCALAFD---VVGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARKMGVSRAVNVKYQKLS
TDH_LEGPC       HCALAFD---VVGEDVLXXXXXXXXXXXXXXVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLS
DOIAD_STRSD     HAVSTVG--VEPGERVAVLGA-GGIGLMLMQVARQRGGVI------------------------------
ADH_STAES       YKAVKVSG-IEPXXXXXXXXXXXXXXXXXQYAKNVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPI
PTGR1_RAT       ---------------------------------KLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYTVKSLE
CADH5_ARATH     YSPLSHFG-LKQPXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSNKKREELQDLGADDYVI-------
CADH1_TOBAC     YSPLNHFG-FKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSNKKRQELEHLGADDYLVSSDTDKM
TDH_STRCO       HRVHTALSFPLVGEDVLITGA-GPIGLMXXXXXXXXXXXXXXITDSEERLELARKVGATLAL--------
CADH_EUCGL      YSPLVRFG-LKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSDKKTEALEHLGADAYLVSSDENGM
CADH2_EUCGU     YSPLVRFG-LKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSDKKTEALEHLGADAYLVSSDENGM
DHSO_SCHPO      HAM--TRGNLKCGSRVLVMGC-GTVGLLMMAVAKAYGAIIVAVDASPSRVEAQKYVGAKPFIAAKENESL
CADH4_ORYSJ     YTPMIRHNMNQPGKSLGVIGL-GGLGHMAVKFGKAFGLKVTVFSTSESKREEINLLGADNFVISSDENQM
XYLD_MORMO      -MQSATKAGIKPGDIGLVIGA-GTIGIITQSALAGGCSDVIICDVFDEK---------------------
PTGR1_HUMAN     ---------VKGGETXXXXXXXXXXXXXXXXXXKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESL
ADH2_EMENI      YASLKRS-KAQPGQWIVISGAGGGLGHLAVQIA--------------AKGMGLRVIGVD-----------
FABG_VIBCH      ------------GKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYGKGMALNVTNPESI
ETR1_SCHPO      YCLLQHVVQLNKGDWFIQDGANSMVGIATIQLAKHFGYKSINVVRNEKLKEQLKSLGA--TIVITDEELM
CADH1_OCIBA     YSPLNHFG-LKQSXXXXXXXXXXXXXXXXVKIAKAMGHHVTVISSSDKKAEALDHLGADDYLVSSDAARM
CADH1_ARATH     YAPMMRHNMNQPGKSLGVIGL-GGLGHMAVKFGKAFGLSVTVFSTSSKKEEALNLLGAENFVISSDHDQM


                         .         .         .         +         .         .         .:280
query           QVVRQRHGRPQRVGGGSSENGGVDVVVNFTGGDTWVKSLRTLKLGGRILTCGATAGYDPAEDLRVIWTFE
VAT1_DANRE      EEVRKISPK------------GLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAAAGQKKIQGNRSVCGFH
QORL_ARATH      DL-------PDK----------YDVVFDAIG--MCDKAVKVIKEGGKVV---ALTGAVTPPGFRFVVT--
QOR_PONAB       DKIKKYVGEK-----------GIDVIIEMLANVNLNKDLSLLSHGGQVIVVGSTIEINPRDTM----AKE
QOR_HUMAN       DKIKKYVGEK-----------GIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSTIEINPRDTM----AKE
YOGA_BACSU      NWDEQLQGKK------------IDVVLDSIGPALFSEYFRHVKPNGRIVSFGASSGDNLSFPVRSLFFPQ
QOR_BOVIN       DKIKKSVGEK-----------GVDVIIEMXXXXXXXXXXXXXSHGGRVIVVGS-----------------
QOR_LAMGU       DKIKKSVGEK-----------GIDVIIEMXXXXXXXXXXXXXSQGGRVIIVGSKG---PVENPRDTMTKE
QOR_CAVPO       DEIKKSIGEK-----------GVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIE--INPRDTMAKE
QORX_HUMAN      EATLK-----------FTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFK
VAT1_MOUSE      DEIKKISPK------------GVDIVMDPLGGSDTAKGYHLLKPMGKVVTYGANLLTGPKRNLRTWWVTA
QOR_PIG         DKIKKSVGEK-----------GIDVIIEMXXXXXXXXXXXXXSHGGRVIIVGSRG---PIENPRDTMTKG
VAT1_HUMAN      DEIKKISPK------------GVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGANLLTGPKRNLRTWWVTA
QOR_MOUSE       DKIKMSVG---------DKDKGVDVIIEMLANENLSNDLKLL----------------------------
QOR_RAT         DKIKT-----------SAGDKGVDVII-------------------------------------------
QORL2_BOVIN     EAVGKLVG-----------SGGVNVVIDMVGGDIFLEALRSLAYEGRIVVVGFAGGTIASVPANLLLLKN
QORL2_MOUSE     DAVKKLAG-----------SGGVNVAIDMVGGDVFLESLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKN
QOR_YEAST       QVLKFTNGK------------GVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSIKNITLVR
QOR_SALTY       ERVKE-------ITGGKK----VRVVYDSVGKDTWEASLDCLQRRGLMVSFGNASGPVTGVNLGI-----
ADH2_BACST      KAIH------DQVGG---VHAAISVAVN---KKAFEQAYQSVKRGGTLVVVGLPNADLPIPIFDTVLN-G
QORL2_RAT       DAVKKLVG-----------SSGVNVAIDMVGGDVFLDSLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKN
ADH3_BACST      KFMKEKXXXXXXXXXXXXSKPAFQSAYN------------SIRRGGACVLVGLPPEEMPIPIFDTVLN-G
QORL2_NEMVE     DKVKE-----------LTDGHGANVIMEAVGGDVFKQCLKCIAWNGYIIPVGFASGEIPQIPANILLVKN
VAT1_TORCA      EEVRKIAPK------------GVDIVLDPLGGADDSXXXXXXXXXXXXXXYGSTAPKRSSLAAAKVWWHK
QOR_ECOLI       E-------RLKEITGGKK----VRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLGI-----
ADH1_BACST      QWIKEKXXXXXXXXXXXXSKAAFE------------SAYKSIRRGGACVLVGLPPEEIPIPIFDTVLN-G
MCAS_MYCBO      EQIRR-----------DTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYGNTRFRRGLTFYY
RT4I1_DANRE     KQLKEKFDLILDSIGGETEKWALDLLKPWSGATPFLQNTDRLGLADGMMQSAVTVGCKVVKNLRKGVHYR
RT4I1_MOUSE     KSLKLFDFILDNV-GGSTETWALNFLKKWSGATPFLLNMDRLGVADGMLQTGVTVGTKALKHLHYRWAFF
ADH_SCHPO       EAVK------------AATNGGAGTLVLSTSPKSYEQAAGFARPGSTMVTVSMPAGAKLGADIFWLTVKM
QOR_PSEAE       RRVLE-----------LTDGKKCPVVYDSVGKDTWETSLDCVAPRGLLVSFGNASGPVTGVNLGILQKGS
RT4I1_HUMAN     KSLKPFDFILDNV-GGSTETWAPDFLKKWSGATPFLLNMDRLGIADGMLQTGVTVG---SKALKHFWKYR
RT4I1_BOVIN     AQLKSSKPFDFILDGGSTETWALKFLKKWSGATPFLLNMDRLGIADGMLQTGVTVG---SKTLKHFWQYR
VAT1L_MOUSE     QEVKRISAE------------GVDIVLDCLCGDNTGKGLSLLKYGSSNMVTGETKSFNPIEENKVIAGFS
VAT1L_HUMAN     QEVKRISAE------------GVDIVLDCLCGDNTGKGLSLLKYGSSNMVTGETKSFNPIEENKVIAGFS
YGD6_SCHPO      --------TPQWASPALKMTNGVGYVIEVGGEKTLPQSIACLAKDGMISMIGFVASEGTTPNLTQILNRN
ADH1_KLUMA      EVIEATNGVAHAVINVSVSEAAISTSVLYT------------RSNGTVVLVGLPRDAQCKSDVFNQVVKS
ZADH2_BOVIN     TVLRQEY--PQ----------GVDVVYESVGGAMFDLAVDALATRGRLIVIGFVSGY-------------
ADH_SULTO       SEIRR-----------ITQGKGADAVIDLNNSEKTLSIYPVLAKQGKYVMVGLF-GADLKYHAPLITLNE
YKM8_SCHPO      KALPRLCPK------------GIDIYFENVGGETMDAVLENMNLQGRIIFCGAISQYNNPNPYRVVLVKS
PKS16_DICDI     DEIKQQ-----------SAQGGVDLILNTLSGDYLSANFRSLSQVGRIMDLSVTQLVE--NDSLDFSNFK
ADH_SULAC       EVRKITTGR------------GVDAIIDFVGSEFTTSNYYTLKLG-RYVKVGTYGGGLPHDAGLRLHSMG
ADH1_NEUCR      -VADVKAATPDGLGPHA-------VILLAVSEKPFHQAVDYVRSRGTIICIGLPAGAKFQAPVFDTVIRM
ZADH2_HUMAN     TVLKQEYPE------------GVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGY-------------
PKS17_DICDI     DEIKQQ-----------SAQGGVDLILNTLSGDYLSSNFRSLSQVGRIMDLSVTVGYNTID-------LD
MECR_DANRE      KELFKSCPRPK-------------LALNGVGGKSATELLRHLQSGGSLVTYGGMAKQPVTVPVSALIFKD
ZADH2_MOUSE     TVLKQEYPE------------GVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQSPTGLSPI----
QORH_ARATH      --------TPEGAALKSPSGKKYDAVVHCANGIPFSVFEPNLSENGKVI--------DITPGPNAMWTYA
MECR_HUMAN      --------RRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKD
FAS_RAT         QHVLLHTG-----------GKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGK---FDLSNNHPLGMAIF
ADH1_CANAL      EAVK------KATDGG--PHGAINVSVSEKAIDQSVEYVRPL---GKVVLVGLPAHAKVTAPVFDAVVKS
PKS2_DICDI      YLLEIKKKIQQLTGNNGVAKMGIDLIINTLSNEFMDANFNSLCQGGRIIDLSVT--HMNSQDTTDFRKFR
YDJL_ECOLI      -------ARCQQICG----KDNLGLVIECSGANIALKAIEMLRPNGEVVRVG--MGFKPLDSINDITAWN
PKS3_DICDI      SYVQKIKDKLKELG---SDKTGVDLILNTLSSDYMDSNFNCLSKSGRIVDLSIT----------------
FAS_MOUSE       QHVLLHTG-----------GKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGGMAIFLKNVTFHGILLDA
TDH_SYMTH       EVVR-----------SYTRGYGADVVLEMSGNPTAIRGLKAARNGARISLLGLPGELDLAADVIMRGLVL
FAS_BOVIN       SFANSRDTSFEQHVLWHTAGKGADLVLNSLAEEKLQASVRCLAQHGRFLEIGK---FDLSKNHPLGMAIF
PKS37_DICDI     QFYNDLM--------VNTDGQGVDMVLNSLSGEYLEKSIQCLSQYGRFIEIG------------------
FAS_HUMAN       SFANSRDTSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIG------------------
ERYA2_SACER     RKFRERTG-----------GRGVDVVLNSLTGXXXXXXXXXXXXXGVFVEMGKTDLRDAGDFRGRYAPFD
DHSO_MOUSE      EIA----SKVESLLGSKPE-----VTIECTGAESSVQTIYATHSGGTLVIVGMGA---EMVNLPLVHAAE
DHSO_HUMAN      EIARKVEG--------------------------------------------------------------
ADH2_KLULA      EIV-------------DATNGGAHGVINVSVSEFAIQSTNYVRSNGTVVLVGLPRDAKCKSDVFTQVVKS
QORH_SPIOL      --------TPEGASLTSPSGKKYDYVVHGASGIPWSTFEPNLSEAGKVLTPGPTAMMTFAWK-KLTFSKK
DHSO_RAT        DIAK----KVESVLGSKPE-----VTIECTGAESSVQTIYATHSGGTLVVVGMGPEMINLPLVHAA-VRE
ADH3_KLULA      VAEIQ-----------EITNGGPHGVINVSVSEAAMNSTQFVRPTGTVVLVGLPAGAVIKSEVFSHVVKS
PKS45_DICDI     ENIKTDLSXXXXXXXXXXHKKGVDLIINTLPFEFLDTNFLLLGQGGRILSVNHLNNNDTTDFSKFKWTVE
DHSO_PONAB      EIARKVEGKPECTGAGASIQAGI-----------------------------------------------
MECR_RAT        --------RMPETKNIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSMLIFKD
TDH_YERPP       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPN       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPG       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPE       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPA       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
PKS44_DICDI     ENIKXESNIKELLDNDDDEKKGVDLIINTLPFEFLDTNFLLLGQGGRIVDLSVTNNNDTTDFSKFKWTVE
ADH2_CANAL      XXXXXXXXXXXXTNGG--PHGVINVSVSERAIGQSTEYVRTL---GKVVLVGLPAGAKISTPVFDAVIKT
TDH_YERPY       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPS       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERPB       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_YERP3       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRSLNSMNHGGRIAMLGI-----PPSDMSIDWNFK
MECR_BOVIN      --------RKPEMKSFFKDVPQPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVIASVSQLIFKD
INC11_TRIAT     AAMKDLGG--------------------------------------------------------------
ADH1_ZYMMO      KIIQEKXXXXXXXXXXXXXKSAFN------------SAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLD-G
P1_ARATH        TAALKR-----------CFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYEGVHNLSNIIYKR
DHSO_MACFA      EIAGKVEG--------------------------------------------------------------
PKS41_DICDI     KQIKSKISKLNPFG-----KSGVDFILNLSSSDYMDSNFKCLNMSGRIVDLSIT----------------
PKS40_DICDI     KQIKSKISKLNPFG-----KSGVDFILNLSSSDYMDSNFKCLNMSGRIVDLSIT----------------
MECR_MOUSE      MPETKTIFKDLPL---------PRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKD
ADH1_PICST      KDIQ------------TATDGGPHAAINVSVSEKAIQSCQYVRSTGTVVLVGLPAGAKVVAPVFDAVVKS
DHSO_BOVIN      EIAKKVEG--------------------------------------------------------------
PKS18_DICDI     NYVEQIKLKLKQLG---SNKNGVDLILNTLSSDYMESNFKCLNTSGRIVDLSVTXXXXXXXELTFINKFL
DHSO_SHEEP      EIAKKVEG--------------------------------------------------------------
YBI2_SCHPO      E---------------------------------------------------------------------
PKS25_DICDI     NYQKQIKNKLIELG---YETHGVDLIINTLSSEFMDSNFKCLNPEGRIVDLTIT-HLNPNEFIKFKYNFG
ZDH1_STAES      QQFKDNH---------------------------------------------------------------
TDH_YERE8       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRALNSMNHGGRIAMLGI-----PPSDMSIDWNFK
MECR_ARATH      NVKSLLGNLPEPALG-----------FNCVGGNAASLVLKYLREGGTMVTYGTTSFIFKDLALRGFWLQS
PKS1_DICDI      NIFSTRDKE-----YSNQLESKIDVILNTLSGEFVESNFKSLRSFGRLIDLSATLGNFKFDHLYSAVDLE
ZDH1_STAEQ      QQFKDNH---------------------------------------------------------------
PKS33_DICDI     YV---KDIKNKLIELGEVEQQGVDLILNTLSSEYMDSNFQCLNLSGRIIDLSIT----------------
TDH_SERP5       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLNAMNHGGRIAMLGI-----PPSDMSIDWNFK
PKS15_DICDI     DYVKQIKLKLKQLG---SNKKGVDLILNTLSSDYLDSNFKCLECGGRIVDLSIT----------------
P2_ARATH        SAALKR-----------CFPKGIDMYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYEGVHNLSNIIYKR
ADH5_YEAST      GAIIK------------ATNGGSHGVINVSVSEAAIESTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKS
ADH5_SACPS      GAIIK------------ATNGGSHGVINVSVSEAAIESTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKS
ADH1_ASPFN      -VADVKAATPEGLGAHA-------VILLAVAEKPFQQAAEYVRSRGTVVAIGLPAGAFLRAPVFNTVVRM
YHFP_BACSU      DGTLKALSKQQ-------WQGAVDPV----GGKQLASLLSKIQYGGSVAVSGLTGG---GEVPATVYPFI
ADH_RALEU       DEV-------MKLTGGR----GVDASIEALGTQTFEQSLRVLKPGGTLSSLG------------------
ZDH1_STAAC      RQFKE-----------------------------------------------------------------
TDH_PHOLL       DVMAEL---------GMTE--GFDVGLEMSGAPAAFRTLNTMNHGGRVALLGI-----PPSDMAIDW---
TDH_CHRVO       AVMQELH-----------MSEGFDVGLEMSGNQAFRQMLETMNHGGKVALLGIPPSNTAIDWNQVIFK-G
PKS38_DICDI     YVKDIKNKLIELGEVEQHQQQGVDLILNTLSSEFMDSNFQCLNLSGRIVDLSIT----------------
TDH_PSEHT       DVIKEL---------GMTE--GFDIGLEMSGVPSAFNSLNNMNHGGKVAMLGI-----PPSDMAVDWNFK
PKS34_DICDI     YV---KDIKNKLMELGEVEQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSIT----------------
PKS32_DICDI     YEIKNKLIELSVV---EQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSIT--HLTPNDYMINNHYK
PKS28_DICDI     NEIKNK-----LIELGEVKQQGVDLILNTLSSEFMDSNFQCLNMSGRIVDLSVTNDYIANNHFKYNMGYN
ZDH1_STAAN      RQFKEK----------------------------------------------------------------
ZDH1_STAAM      RQFKEK----------------------------------------------------------------
YJMD_BACSU      ERVLEWTG-----------NEGANVVIDAVCPETFALSIEAVSPAGHVVVLGFDERAAQISQL-PITKKE
TDH_SALTY       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALSV       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALPK       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALPC       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALPB       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALPA       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALNS       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALHS       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALEP       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALDC       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALCH       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALA4       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
MECR1_CAEEL     ------YSRKKKF-------PGVKLALNCVGGRSSLFLASLLDHGGCMVTYG------------------
ADH2_PICST      DVLK-------------ATNGGAHGVINVSVSEAMQQSVDYVRPTGTVVLVGLPAGAKXXXXXXXXXXRT
ZDH1_STAAR      RQFKEK----------------------------------------------------------------
TDH_SALTI       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SALAR       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPADMSIDWTFK
DHSO2_YEAST     KAQDLADGVQKLLGGNHA-----DVVFECSGADVCIAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGK-E
BDHA_BACSU      AEIAERTG------------GGVDVAFEVTG---------------------------------------
ZDH1_STAAW      RQFKEK----------------------------------------------------------------
ZDH1_STAAS      RQFKEK----------------------------------------------------------------
YDJJ_ECOLI      ARCQQ-----------FTEDMGADIVFETAGSAVTVKQAPYLVMGGKIMIVGTVPGDSAINFLKI-----
TDH_PYRFU       KEVMD-----------ITDGNGVDVFLEFSGAPKALQGLQAVTPAGRVSLLGLFPGKVSIDFNNLIIFKA
QOR_LEIAM       ------DGRLHELC-----PKGVDVVYECVGGHTFNDXXXXXXXXXXXXIIGSISSYKSGEGTSVTMLLL
DHSO1_YEAST     KAQDLADGVQKLLGGNHA-----DVVFECSGADVCIAAVKTTKVGGTMVQVGMGKNYTNFPIAEVSGK-E
FAS_CHICK       QILRVTNGK------------GVSLVLNSLAEEKLQASLRCLAQHGRFLEIG------------------
PKS31_DICDI     DYVYEIKNKLIELGVVEQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIVDLSIT----------------
PKS26_DICDI     KLIK------RKLTELGSNKKGVDIILNLSSSEHMVSNFKCLNHRGRIIDLSITNEYTCNNNFKYNYGYH
ADH1_YEAST      GAVLK------------ATDGGAHGVINVSVSEAAIESTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKS
TDH_THEON       KFVMD-----------ITDGAGVEVFLEFSGAKAFEQGLQAVTPGGRV----SLLGLFPREDINNLVIFK
TDH_PYRHO       KEVMD-----------ITDGNGVDVFLEFSGAPKALQGLQAVTPAGRVSLLGLYPGKVTIDFNNLIIFKA
TDH_KLEP7       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRSLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_KLEP3       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRSLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
PKS21_DICDI     NYVNEIKSKLNQLYGTTGKFNGVDLIINTLPNEFTHSNFLCLKERGKIIDLSIT----------------
PKS39_DICDI     NYVYEIKNKLIELGEVEQHQQGVDLILNTLSSEFMSPNFQCLNLSGRIVDLSITHLTPNDYMTNSHYKFN
ADH_STAAW       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAAS       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAAR       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAAC       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAAB       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAA8       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAA3       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADHP_ECOLI      KIVQE-----------------------------------------------------------------
TDH_THETN       SIIKSE-----------TEGYGADVVLDFSGNPTAIRGLEYIAKGGRMSILGLPDNEVPIDITNNVVFKG
TDH_ENT38       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRSLDTMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_ECOLI       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECODH       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOBW       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_BURPS       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURP6       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURP1       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURP0       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURMS       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURMA       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURM9       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURM7       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
PKS30_DICDI     DYVYEIKNKLIELGVVEQNQQGVDIILNTLSSEYMDSNFQCLNMSGCIVDLSIT----------------
TDH_SHESH       GVMEEL---------GMTE--GFDVGLEMSGVPSAFHSLDTMNHGGKIAMLGIPGGEMAIDWSKVIFK-G
TDH_CITK8       DVMANL---------GMTE--GFDVGLEMSGAPPAFRALDTMNHGGRIAMLGI-----PPSDMSIDWTFK
QORL1_HUMAN     RVIDVSNGKVHVAESCLEETGGVDIVLDYSKDDEPAVKLQLLPVGGHWVTTEENLQLDPPDSCLFLKGAT
QORL1_BOVIN     RVIDVSNGKAHVAESCLEETGGVDIVLDYSKDDEPAEKLQLLPVGGHWVTTEENLQLDP-PDSHCLFLKG
PKS29_DICDI     DYVYEIKNKLIELGVVEQHQQGVDLILNTLSSEYMDSNFQCLNLSGRIV---------------------
PKS19_DICDI     NYVNEIKSKLNQLYGTTGKFNGVDLIINTLPNEFTHSNFLCLKERGKIIDLSIT----------------
ADH_STAAN       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH_STAAM       AEVMK-----------LTDNKGLDATVVTSVAKTPFNQXXXXXXXXXXXXXXGLPVDKMNLDIPRLVLDG
ADH2_KLUMA      EVIK-------------ATNGGAHGVINVSVSEKAIESIEYCRSNGTVVLVGLPKDAKCKSDVFNQVVKS
ADH1_EMENI      -VADVKAATPDGLGAHA-------VILLAVSEKPFQQATEYVRSRGTIVAIGLPPAYLKAPVINTVVRM-
TDH_ECOLU       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
PTGR1_RABIT     EETLKK-----------AAPDGYDCYFDNVGGEFSNTVIRQMKKFGRVAICGAISMYNPGPSPESVLYQE
PTGR1_CAVPO     EEALKK-----------ASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNPGPSPESIIYKQ
DHSO_BACSU      EEIKT-----------ITNDRGVDVAWETAGNPAALQSLASVRRGGKLAIVGLPSQNEIPLNVPFIADNE
TDH_SHIFL       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SHIF8       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SHIBS       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_SHIB3       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_PYRAB       KEVMD-----------ITDGNGVDVFLEFSGAPKALQGLQAVTPAGRVSLLGLYPGKVSIDFNNLIIFKA
TDH_ESCF3       DVMAEL---------GMTE--GFDVGLEMSGAPAAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOUT       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOSM       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOSE       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOLC       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOL6       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOL5       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOK1       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECOHS       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO8A       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO81       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO7I       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO5E       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO57       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO55       DVMAEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO45       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_ECO27       DVMTEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_BURTA       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLESMNHGGKVALLGIPPAQTAIDWNQVIFK-G
QORL1_MOUSE     RVIDVSNGKVHVAESCLEETGGVDIVID------------------------------------------
ADH_SULSR       AEIRR-----------ITEGKGVDAVIDLNNSEKTLSVYKALAKQGKYIMVGLF-GADLHFHAPLITLSE
TDH_SHISS       DVMAEL---------GMAE--GFDIGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_PYRKO       KFVMD-----------ITDGAGVEVFLEFSGAPKALQGLKAVTPGGRVSLLGLFPREVTIDFNNLIIFKA
TDH_ECO24       DVMAEL---------GMTE--GFDVGLEMPGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWTFK
TDH_BURS3       DVMSDLH-----------MTEGFDVGLEMSGPSAFTSMLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
DHSO_BOMMO      EIVKLLGDRPDACGYGSAQR--VALLVTKTAG--------------------------------------
TDH_PROMH       DVMKEL---------GMTE--GFDVGLEMSGAPPAFRTLSTMNHGGRIALLGI-----PPSDMAIDWIFK
TDH_ENTS8       DVMNEL---------GMTE--GFDVGLEMSGAPPAFRTLDTMNHGGRIAMLGI-----PPSDMSIDWNFK
TDH_BURCJ       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURCH       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURCC       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_BURCA       DVMADLH-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TDH_ALTMD       DVMDEL---------GMSE--GFDVGLEMSGVPVAFRDLNKMNHGGKIAMLGI-----PPQDVAVDWNFK
ADHP_RABIT      ---PRELNKPVQDVIVEMTNGGVDFAIDCAGGSEVMKACATVGWG----SC-TFVGVNLADKGLTISPIE
TDH_PSEA6       DVMNDL---------GMSE--GFDVGLEMSGVPAAFRDLDKMNHGGKVAMLGIPSG-DVAVDWNKVIFKG
IDND_VITVI      QDLDEEVAKIQ-----STMVTGVDVSFDCVGNKTMSTALNATRAGGKVCLVG------------------
ADHA_RHIME      EEVQRRTG------------GLHGALVTAVSPKAMEQAYSMLRSKGTM----ALVGLPPGQICLPVFDTV
ADH1_KLULA      ---------PEEV--IEATKGGAHGVINVSVSEFAIQSTNYVRSNGTVVLVGLPRDAKCKSDVFNQVVKS
XYL2_YEAST      HGVTVDSVIKKAIG-----KKGADVVFECSGAEPCVRAIEVCKAGGTIVQVG--MGQEEIQPISIIPTKE
TDH_ERWCT       DVM---------IELGMTE--GFDIGLEMSGAPSAFRALKAMNHGGRIAMLGI-----PHEPMSIDWIFK
TDH_AERHH       GVMSE-----------------------------------------------------------------
PTGR1_MOUSE     EALR------------TASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNPAPEVVIYQQLR
ADHQ_RABIT      ---PRELNKPVQDVIVEMTNGGVDFAIDCAGGSEVMKATCTTVGWGSCTFVGVNVNDKGLTISPVELILG
YMN1_YEAST      QKLIEAAG---------GEN-TVDYFIDNVGSNVLEAGVLLLKQRAMLIACGAISAYDPSKGYSFILTKR
TDH_BURVG       DVMAELR-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
Y053_HAEIN      KRIKE-----------ITSGRMAEVVMEASGANISIKTLHYASFAGRIALTGWPKTETPL-PTNLITFKE
TDH_BURM1       DVMADLR-----------MTEGFDVGLEMSGPSAFTSLLEAMNHGGKVALLGIPPAQTAIDWNQVIFK-G
TOXD_COCCA      ----------------------------------------------------------------------
TDH_AERS4       DVM-------------------------------------------------------------------
MTDH_PETCR      Q---------------------------------------------------------------------
YFMJ_BACSU      QKALQ-----------NACPDGVDVYFDNVGGPISDAVMNLLNEFARIPVCGAISSYN------------
TDH_SILPO       DVVHEL-GLKQ----------GFDVGLEMSGSQAALQMVEALVMGGKIALLGIPPGKSPVDWSRIVFK-A
TDH_EDWI9       EVMQAL---------GMSE--GFDVGLEMSGAPAFHTMLDTMNHGGKIAMLGIPPG-DMAIDWNQVIFKG
QOR_SCHPO       KVVADY-----------TNGKGVDAAYDSVGIDTLSSSLDALRNGGTMVSFGNASGAIDAIPLKFLSARC
ADHA_BACSU      TALA----------------GRFDVILNTVSANLDVDALSMLRIDGTLVSVGAPAKPD------------
ADH3_EMENI      XXXXXXXXXXXXTPGGL---GAHAVILLAVAEKPFQQATEYVRSHGSVVAIGLPANAFLKAPVFTTVVRM
CADH_POPDE      Q---------------------------------------------------------------------
PKS5_DICDI      YVSQIKN---KLIEQGSNDNG-VDLILNTLPSDFMDSNFQLLAINGRII---------------------
CADH_SACOF      ----------------------------------------------------------------------
YNN4_YEAST      EQIKKKY---------------------------------------------------------------
YHDH_ECOLI      ----------------------------------------------------------------------
MECR_DICDI      RTPAFRK--------LISDLPSPKLALNAVGGQSATELSRILADNGTLVTYGGMSREPVTIPTSQLIFRN
YBJB_SCHPO      RV----HELVEK----------VDVVIDTVGDPLLMKSLNQLGIGGRLISAPKQGSIEFSYDMKQIYRKN
RT4I1_DICDI     ----------------------------------------------------------------------
PKS22_DICDI     YLIKEKL---IELKAPSQEYGGVDLIINTLSADYMDANFNCLSQGGRIIDLSITXXFYKFKNHIGYMTYE
MTDH_APIGR      KGAR------------------------------------------------------------------
YCZ2_YEAST      EQIKHKY---------------------------------------------------------------
PTGR1_BOVIN     EALKE--AAPE----------GYDCYFDNVGGEFSNVAITQMKKFGRIAICGAISVYNPGPSPEIIIFKE
MECR_DROME      DIFKSGKLKKPR------------LAFNCVGGKSATEVSRHLDNGGVLVTYGVTVATGPLKDIRGFWMTR
CADH3_ARATH     K---------------------------------------------------------------------
YNCB_ECOLI      EQLAKACPK------------GIDIYYENVGGKVFDAVLPLLNTSARIPVCGLVSSYNATE---------
CADH1_ORYSJ     ETLKSSLNFIIDTASGDHKVGGVMALLSF---PSEIKHPANLNLGGRSLSGSVTGGTKDIQEM-------
CADH1_EUCGU     K---------------------------------------------------------------------
TDH_STRAW       RALGLREGFDIGLEMSGRPEAMRDMIANMTH-------------GGRIAMLGLPSQEFPVDWARIV-TSM
TDH_LEGPA       DVANEL---------GMLE--GFDVGLEMSGNPMALNDMKAMNHGGHVALLGIPPQETPIDWNQVIFK-G
CADH2_ARATH     K---------------------------------------------------------------------
YL460_YEAST     EQIKHKY---------------------------------------------------------------
PKS23_DICDI     YLIKEKL---IELKAPSQEYGSVDLIINTLSADYMDANFNCLSQGGRIIDLSITXXFYKFRNHIGYMTYE
YPHC_ECOLI      QIIAE------------LTHGGADVALDCSGNAAGLLALQSTADWGRVVYIGET-GKVEFEVSADLMHHQ
TDH_LEGPH       DVANEL---------GMLE--GFDVGLEMSGNPMALNDMKAMNHGGHVALLGIPPQETPIDWNQVIFK-G
PKS14_DICDI     EEIKLKLKQLK------SDKHGVDLILNTLSSDYMDSNFKCLNIGGRIVDLSIT----------------
ETR1_YARLI      DKLFSKQIK-------SWTGGKIKLALNCIGGKSATSIMRQLGAGGSIVTYG------------------
ADH_SULSO       -----------------TESKGVDAVIDLNNSEKTLSVYKALAKQGKYVMVGLF-GADLHYHAPLITLSE
ADH_STAEQ       EEVNR-----------LTNNKGLDATVITAVAKTPFNQXXXXXXXXXXXXXXGLPVDKMDLDIPRLVLDG
YJGB_ECOLI      KALA----------------GQFDLIINTVNVSDWQPYFEALTYGGNFHTVGAVLTPLSVPAFTLI-AGD
YGCW_ECOLI      QVGITAEGAPQKIIAACCERGTVDILVNNAG---------ICKL-NKVLDFG-RADWDPMIDVNLTAAFE
TDH_LEGPL       DVANEL---------GMLE--GFDVGLEMSGNPMALNDMKAMNHGGHVALLGIPPQETPIDWNQVIFK-G
TDH_LEGPC       DVANEL---------GMLE--GFDVGLEMSGNPMALNDMKAMNHGGHVALLGIPPQETPIDWNQVIFK-G
DOIAD_STRSD     ----------------------------------------------------------------------
ADH_STAES       EEVNR-----------LTNNKGLDATVITAVAKTPFNQXXXXXXXXXXXXXXGLPVDKMDLDIPRLVLDG
PTGR1_RAT       EALR------------TASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAICGAISQYNPGPSPEVIIYQQ
CADH5_ARATH     ----------------------------------------------------------------------
CADH1_TOBAC     Q---------------------------------------------------------------------
TDH_STRCO       ------NVSDATIADGQRELGGFDIGLEMSGRPEAMRDIANMTHGGRIAMLGLPAEEFPVDWARVV-TSM
CADH_EUCGL      K---------------------------------------------------------------------
CADH2_EUCGU     K---------------------------------------------------------------------
DHSO_SCHPO      PDYAQRYKQ-----AIIEKYGEFDFAVDATGGICIHTAVLALKRGGTFVQAG---NGKPVIDFPIIINYE
CADH4_ORYSJ     ESLK------------------------------------------------------------------
XYLD_MORMO      ----------------------------------------------------------------------
PTGR1_HUMAN     EETLKK-----------ASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYN------------
ADH2_EMENI      ------HGSKEELVKASGAEHFVD-ITKFPTGDKFVKSLTTKGLGAHVIVCTAS----------------
FABG_VIBCH      EAV---------LKAITDEFGGVDILVNNAG---------------------------------------
ETR1_SCHPO      DRKTMKQKVPEWIQGGEVKLG-------------------------------------------------
CADH1_OCIBA     Q---------------------------------------------------------------------
CADH1_ARATH     KALEK-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LQVRGSNGWERDDIEKLFALLASGKLRAQVDKAFPLEQAADALRMLEDRTVFGKVVVTP
VAT1_DANRE      LGYLDSETELIDQMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILT-
QORL_ARATH      -----SNG---DVLKKLNPYIESGKVKPVVDPPFPFSRVADAFSYLETNHATGKVVVYP
QOR_PONAB       SSIIGVTVFSKEEFQQYAAALQAGMLKPVIGSQYPLEKVAEA-----------------
QOR_HUMAN       SSIIGVTLFSKEEFQQYAAALQAGMLKPVIGSQYPLEKVAEA-----------------
YOGA_BACSU      VNVLGTSMGSGEEFQAMLAFIDKHKLRPVIDRIYPLEKACEAYKRMQEGRQFGNI----
QOR_BOVIN       -----------------------------------------------------------
QOR_LAMGU       SSIKGVTLFSSTKEEXXXXXMEIGWLRPVIGSQYPLEKVAQAHEDLTHSSAAGKVVL--
QOR_CAVPO       STISGVSLFSKEEFQQFASTIQAGMVKPVIGSQYPLEKASQA-----------------
QORX_HUMAN      ---RGSNKYKQEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVL--
VAT1_MOUSE      LQLLQANGYLDGEVERLVALYNQGHIKPRIDSVWPFEKVADAMKQMQEKKNIGKVLLVP
QOR_PIG         SSIKGVALYSSTKEEFXXXXMEVGWLRPVIGPVYPLEKAAQAHEIIHSRGATGKMIL--
VAT1_HUMAN      LQLLQANGYLDGEVERLLALYNQGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVP
QOR_MOUSE       -----------------------------------------------------------
QOR_RAT         -----------------------------------------------------------
QORL2_BOVIN     VSAMGLY-WGRRSLSSALQYCQEGRIQPHIGEVFELEEVNDAFLHVTQRKSTGKVLLS-
QORL2_MOUSE     ISAMGLY-WGRKSMSTAMQYCQQGLIHPHTGAVFKLEKINDAFLHVMQRKSTGKVLLS-
QOR_YEAST       PQLYGPEEWKYYS-DEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIESRKTVGKLVL--
QOR_SALTY       LNQKGSLYATRPSLQELFSLIASGVIKVDVNQRYALKDARRAHEVLESRATQGSSLLIP
ADH2_BACST      VSVKGSIVGTRKDMQEALDFAARGKVRPIVETA-ELEEINEVFERMEKGKINGRIVL--
QORL2_RAT       ISAMGLY-WGRKSMSTALQYCQQGLIHPHTGAVFKLEKVNDAFLHVMQRKSTGKVLLS-
ADH3_BACST      IKIIGSIVGTRKDLQEALQFAAEGKVKTIIE-VQPLEKINEVFDRMLKGQINGRVVLT-
QORL2_NEMVE     CSAVGLY-WGRESVDKTLEYFKNGKLKGYISASFGLDKVNEAFQMILQRKSTGKVVI--
VAT1_TORCA      LQLINSNGFHRTDIRKLISLYKEGKIKPKVDSVWSFEQVGDAMRHMRNTRTLEK-----
QOR_ECOLI       LNQKGSLYVTRPSLQELFSLIASGVIKVDVQQKYPLKDAQRAHEILESRATQGSSLLIP
ADH1_BACST      VKIIGSIVGTRKDLQEALQFAAEGKVKTIVE-VQPLENINDVFDRMLKGQINGRVVL--
MCAS_MYCBO      LDLALMSVTQPDRVRELFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLVL--
RT4I1_DANRE     WGFFAPSGSALDEVSE---MVDAGKVRPVVEEVFSFAQVPEAFQKVEQGHARGKTVVS-
RT4I1_MOUSE     M----ASGPYLDEIAE---LVDAGKIRPVIERTFPFSEVPEAFLKVERGHARGKTVV--
ADH_SCHPO       LKICGSHVGNRIDSIEALEYVSRGLVKPYY-KVQPFSTLPDVYRLMHENKIAGRIVL--
QOR_PSEAE       LYVRPTLGSYADTPEKLFGLIERGDIRIEINQRF-------------------------
RT4I1_HUMAN     WAFFMASGPCLDDIAE---LVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGKTVI--
RT4I1_BOVIN     WAFFMASGPCLDDIAE---LVEAGKIQPVIEKTFPFSKVPEAFLKVERGHARGKTVI--
VAT1L_MOUSE     LLKQGRSGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEVKEAMQRIHDRGNIGKLIL--
VAT1L_HUMAN     LLKQGRAGLIRGVVEKLIGLYNQKKIKPVVDSLWALEEVKEAMQRIHDRGNIGKLIL--
YGD6_SCHPO      ANIRGIFVGSVSMFRDMVACIEAKDIHPVVDKVFPFDQLKEAYEYQWSQAHIGKVVL--
ADH1_KLUMA      ISIVGSYVGNRADTREALDFFSRGLVKAPI-KILGLSELASVYDKMVKGQIVGRIVV--
ZADH2_BOVIN     -----------------------------------------------------------
ADH_SULTO       VQFIGSLVGNQSDFLGIMSLAEAGKVKPMVTKTMKLEEANEAIDNLENFKAVGRQVLVP
YKM8_SCHPO      LTIQGLPQYQEQYFEEMPKLIAEGKIKYKCDVYDGLESAPEAIGMLQGKN-SGKTIV--
PKS16_DICDI     YHVTYSSKIVRDILTEVFDAISDGSLENIPVKVFPATQVKTAIEYINERVHIGKIVV--
ADH_SULAC       WQFIGTLTGNRKDFLEVLELAENGKIKPMITKVLSLEEANDALDNLEKGKVSGRQVL--
ADH1_NEUCR      ITIKGSYVGNRQDTQEALDFFARGLIKVPI-KTVGLSKLQEVYDLMEEGKIVGRYVV--
ZADH2_HUMAN     -----------------------------------------------------------
PKS17_DICDI     RATKYNSKIIRDILTEVFDAISDGSLENIPVKVFPAIQVKTAIEYINERVHIGKIVV--
MECR_DANRE      VRVRGVTQWKRDNLDELCILIRAGKLSAPICTQVQLQDFRKAL----------------
ZADH2_MOUSE     -----------------------------------------------------------
QORH_ARATH      VKKITMSKKQAENLEFMVNLVKEGKVKTVIDSKHPLSKAEDAWAKSIDGHATGKIIVEP
MECR_HUMAN      LKLRGLSQWKKDHILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILT-
FAS_RAT         LKFEGANDSWREVAELLKAGIRDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLV--
ADH1_CANAL      IEIKGSYVGNRKDTAEAIDFFSRGLIKCPI-KIVGLSDLPEVFKLMEEGKILGRYVL--
PKS2_DICDI      YCISYSNGFERNKLQEVMDMFVNENLALLPIKEYSVKDIKEAIEFIAERKHIGKIVV--
YDJL_ECOLI      KSIIGHMAYDSTSWRNAIRLLASGKVKPMITHRIGLSQWREGFDAMVDKTAI-KVIMT-
PKS3_DICDI      -----------------------------------------------------------
FAS_MOUSE       LFEEANDSW-REVAALLKAGIRDGVVKPLKCTVFPKAQVEDAFRYMAQGKHIGKVLV--
TDH_SYMTH       QGITGRRMWQTYQVRSLYRAGLAERLRPLVTHRMPLEQ-IDAAMELMGSGQSGKIVLVP
FAS_BOVIN       LKNVTFHGILLDSLQEVSTLLKAGIRKGVVQTVFPRTQAEDAFRYMAQGKHIGKVVI--
PKS37_DICDI     -----------------------------------------------------------
FAS_HUMAN       -----------------------------------------------------------
ERYA2_SACER     L---GEAGDDREILREVVGLLGAGELDRLPVSAWELGSAPAALQHMSRGRHVGKLVLT-
DHSO_MOUSE      VDIKGCNTW-----PMAISMLASKTLNVKVTHRFPLEKAVEA-----------------
DHSO_HUMAN      -----------------------------------------------------------
ADH2_KLULA      VSIVGSYVGNRADTREALDFFARGLVHAPI-KIVGLSELADVYDKMVKGEIVGRYVV--
QORH_SPIOL      QLVPLLLIPKIPNFEYVVNLVKEKKLKTVIDSKHPLSKGEDAWSRIMGGHATGKIIIEP
DHSO_RAT        VDIKGCNTW-----PMAVSMLASKTLNVKVTHRFPLEKAVEA-----------------
ADH3_KLULA      INIKGSYVGNRADTREAINFFANGHVHSPI-KVVGLSELPKVYELMEQGKILGRYVV--
PKS45_DICDI     IFY---NGFEKSKLQLIIDMIKNKELPLIPIKEYPINQIKDAIEFIGQRKHIGKIVI--
DHSO_PONAB      -----------------------------------------------------------
MECR_RAT        LKLRGLSQWKKDEFKELILILCNGQLTAPAWSGIPLQDYQQAL----------------
TDH_YERPP       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPN       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPG       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPE       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPA       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
PKS44_DICDI     IFY---NGFEKSKLQLITDMIKNKELPLIPIKEYPINQIKDAIDFIGQRKHIGKIVI--
ADH2_CANAL      IQIKGSYVGNRKDTAEAVDFFTRGLIKCPI-KIVGLSELPEVYKLMEEGKILGRYVL--
TDH_YERPY       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPS       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERPB       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
TDH_YERP3       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFPIQQGFDAMRSGKS----GKVVLS-
MECR_BOVIN      LKLRGLSQWKKDHILTLCDLIRRGQLTAPACSEVPLQDYLCALEASTQPFVSSKQILT-
INC11_TRIAT     -----------------------------------------------------------
ADH1_ZYMMO      IEVLGSLVGTREDLKEAFQFAAEGKVKPKVTKR-KVEEINQIFDEMEHGKFTGRMVV--
P1_ARATH        IRIQGSDFYDKYSLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
DHSO_MACFA      -----------------------------------------------------------
PKS41_DICDI     -----------------------------------------------------------
PKS40_DICDI     -----------------------------------------------------------
MECR_MOUSE      LKLRGLSQWKKDEFKELILLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILT-
ADH1_PICST      ISIRGSYVGNRADSAEAIDFFTRGLIKCPI-KVVGLSELPKVYELMEAGKVIGRYVV--
DHSO_BOVIN      -----------------------------------------------------------
PKS18_DICDI     IQ---------KSLKKIKIGIESGELKLIPITAYSNSNAKEAIEFINQRKHIGKIVL--
DHSO_SHEEP      -----------------------------------------------------------
YBI2_SCHPO      -----------------------------------------------------------
PKS25_DICDI     YHNIELYYCEKPTIKKLLQSISKSIENNTLNYLIPITEFSNAIEYINERKHVGKIVIS-
ZDH1_STAES      -----------------------------------------------------------
TDH_YERE8       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFSIQQGFDAMR---------------
MECR_ARATH      WLSMGKVKECREMIDYLLGLARDGKLKYETE-LVPFEEFPVAL----------------
PKS1_DICDI      RLIDEKPKLLQSILQRITNSIVNGSLEKIPITIFPSTETKDAIELLSKRSHIGKVVV--
ZDH1_STAEQ      -----------------------------------------------------------
PKS33_DICDI     -----------------------------------------------------------
TDH_SERP5       LFIKGIYGREMETWYKMAALIQSGDLTPIITHRFTIQQGFDAMRSGQS----GKVVLS-
PKS15_DICDI     -----------------------------------------------------------
P2_ARATH        IRIQGFVVADFYDLELVLPRIKEGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV--
ADH5_YEAST      ISIVGSCVGNRADTREALDFFARGLIKSPIHLA-GLSDVPEIFAKMEKGEIVGRYVV--
ADH5_SACPS      ISIVGSCVGNRADTREALDFFARGLIKSPIHLA-GLSDVPEIFAKMEKGEIVGRYVV--
ADH1_ASPFN      INIKGSYVGNRQDGVEAVDFFARGLIKAPF-KTAPLQDLPKIFELMEQGKIAGRYVL--
YHFP_BACSU      L--RGVSLLGIDSVERMSSDLKPDQLLTIVDREVSLEETPGALKDILQNRIQGRVIV--
ADH_RALEU       -----------------------------------------------------------
ZDH1_STAAC      -----------------------------------------------------------
TDH_PHOLL       -----------------------------------------------------------
TDH_CHRVO       LEIKGIYGREMETWYKMVALIQSG-----------------------------------
PKS38_DICDI     -----------------------------------------------------------
TDH_PSEHT       LVIKGIYGREMETWYKMASLIQSG-----------------------------------
PKS34_DICDI     -----------------------------------------------------------
PKS32_DICDI     FNM-GYNNVEVVDLKKIIKMANSNKLELSVPIEYSNNQFKDAIEYINQRKHIGKIIV--
PKS28_DICDI     VEMIDFNGMVRSYLKKIIKMINSNKLELSIPIEYSNNQFKDAIEYINQRKHIGKIIV--
ZDH1_STAAN      -----------------------------------------------------------
ZDH1_STAAM      -----------------------------------------------------------
YJMD_BACSU      VTITGSR-LQTNQFPKVVELLNGGRLNGLVTHTFSVDDVHHAFQFIKE-----------
TDH_SALTY       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALSV       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALPK       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALPC       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALPB       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALPA       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALNS       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALHS       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALEP       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALDC       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALCH       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALA4       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
MECR1_CAEEL     -----------------------------------------------------------
ADH2_PICST      IQIKGSYVGNRADSAEAIDFFTRGLIKCPI-KIVGLSELASVYELMEQGKILGRYVV--
ZDH1_STAAR      -----------------------------------------------------------
TDH_SALTI       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SALAR       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
DHSO2_YEAST     MKLIGCFRYSFGDYRDAVNLVATGKVNVKITHKFKFEDAAKA-----------------
BDHA_BACSU      -----------------------------------------------------------
ZDH1_STAAW      -----------------------------------------------------------
ZDH1_STAAS      -----------------------------------------------------------
YDJJ_ECOLI      -----------------------------------------------------------
TDH_PYRFU       LTVYGITGWE--TWYTVSRLLQSGKL---------------------------------
QOR_LEIAM       VKSASLNGFFHDVIPKLLQYLKAGQVKLFVDKKHGLSSVADAVDHLYSGANYGKVLV--
DHSO1_YEAST     MKLIGCFRYSFGDYRDAVNLVATGKVNVKITHKFKFEDAAKA-----------------
FAS_CHICK       -----------------------------------------------------------
PKS31_DICDI     -----------------------------------------------------------
PKS26_DICDI     LFVKG------DIISKLLKNITSAIENGSLSTGIPIIEFNDAIEFINKRQHIGKIVV--
ADH1_YEAST      ISIVGSYVGNRADTREALDFFARGLVKSPI-KVVGLSTLPEIYEKMEKGQIVGRYVV--
TDH_THEON       LEVHGITGWE--TWYTVSSLIQSGKL---------------------------------
TDH_PYRHO       LTIYGITGWE--TWYTVSRLLQSGKL---------------------------------
TDH_KLEP7       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_KLEP3       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
PKS21_DICDI     -----------------------------------------------------------
PKS39_DICDI     MGYNNVNVEDKSYLKKIIEMINSNELELSVPIEYSNNQFKDAIEYINQRKHIGKIIV--
ADH_STAAW       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAAS       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAAR       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAAC       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAAB       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAA8       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADH_STAA3       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMENGTITGRMVI--
ADHP_ECOLI      -----------------------------------------------------------
TDH_THETN       ITIQGITGRRMDTWYTVKGLLKSGDLKPIITHTFPLTEYQKGMELM-IKGQCGKVVLYP
TDH_ENT38       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOLI       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECODH       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOBW       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_BURPS       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURP6       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURP1       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURP0       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURMS       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURMA       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURM9       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURM7       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
PKS30_DICDI     -----------------------------------------------------------
TDH_SHESH       LILKGIYGREMETWYKMASLIQSG-----------------------------------
TDH_CITK8       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
QORL1_HUMAN     LAFLNDEVWNLSNVQQVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVV--
QORL1_BOVIN     AAVAFLNDWNLSNVQQVMEKLSTGVFRPQLDEPIPLYEAKVTMEVVQKNQGRKKQVV--
PKS29_DICDI     -----------------------------------------------------------
PKS19_DICDI     -----------------------------------------------------------
ADH_STAAN       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMEKGTITGRMVI--
ADH_STAAM       IEVVGSLVGTRQDLREAFEFAAENKVTPKV-QLRKLEEINDIFEEMEKGTITGRMVI--
ADH2_KLUMA      IHIVGSYVGNRADTREALDFFCRGLVNAPI-KVVGLSTLPEIYEKMEQGKVLGRYVV--
ADH1_EMENI      ITIKGSYVGNRQDGVEALDFFARGLIKAPF-KTAPLKDLPKIYELMEQGRIAGRYVL--
TDH_ECOLU       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
PTGR1_RABIT     IRMEGFNRWKGEVGQKALKELLTWVLEGKIQREFVIEMPAAFMRMLKGENV--------
PTGR1_CAVPO     LRIEGVYRWQGDVREKLMKWVLEGKIQEHVTKGFENMPAA-FIEMLNGANL-GKAVVT-
DHSO_BACSU      IDIYGIFRY-ANTYPKGIEFLASGIVDTKVTDQYSLEQTQDAMRALQFKNECLKVMVYP
TDH_SHIFL       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SHIF8       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SHIBS       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_SHIB3       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_PYRAB       LTVYGITGWE--TWYTVSRLLQSGKL---------------------------------
TDH_ESCF3       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOUT       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOSM       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOSE       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOLC       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOL6       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOL5       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOK1       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECOHS       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO8A       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO81       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO7I       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO5E       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO57       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO55       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO45       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_ECO27       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_BURTA       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
QORL1_MOUSE     -----------------------------------------------------------
ADH_SULSR       IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAVGRQVLIP
TDH_SHISS       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_PYRKO       LEVHGITGWE--TWYTVSSLIQSGKL---------------------------------
TDH_ECO24       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_BURS3       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
DHSO_BOMMO      -----------------------------------------------------------
TDH_PROMH       LFIKGIYGREMETWYKMAALIQSGDLSPIITHQFPIDE---------------------
TDH_ENTS8       LFIKGIYGREMETWYKMAALIQSG-----------------------------------
TDH_BURCJ       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURCH       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURCC       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_BURCA       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TDH_ALTMD       LVIKGIYGREMETWYKMASLLQSG-----------------------------------
ADHP_RABIT      LTLKGTNGWDAETVPKLVSDYKNGKLDALVTHTLPFDKINEALNLLD------------
TDH_PSEA6       LVIKGIYGREMFETWYKMASLIQGGL---------------------------------
IDND_VITVI      -----------------------------------------------------------
ADHA_RHIME      LKVRGSIVGTRQDLEEALEFAGEGKVAAHFDK---IENINAIFERMEEGKIDGRIVL--
ADH1_KLULA      ISIVGSYVGNRADTREAIDFFSRGLVKAPI-HVVGLSELPSIYEKMEKGAIVGRYVV--
XYL2_YEAST      LTFQGCFRYCQGDYSDSIELVSSRKL---------------------------------
TDH_ERWCT       LFIKGIYGREMETWYKMSALIQSG-----------------------------------
TDH_AERHH       -----------------------------------------------------------
PTGR1_MOUSE     MEGFIVNRWQGEVRQKLMNWVSEGKVQCHVTEGFEKMPAA-FMGMLKGENL-GKTIV--
ADHQ_RABIT      RTLRGSSGWDVDTVPKLVSDYKNGKLEALVTHTLPFEKINEALDLLK------------
YMN1_YEAST      LVVKGVLVTDNIDLDKLGSLVKHGKI---------------------------------
TDH_BURVG       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
Y053_HAEIN      LNIYGSR-TSKGEFEEALDMLATNKINASITKCIKFEEIPSFISDLSD-----------
TDH_BURM1       LEIKGIYGREMETWYKMVAMLQSG-----------------------------------
TOXD_COCCA      -----------------------------------------------------------
TDH_AERS4       -----------------------------------------------------------
MTDH_PETCR      -----------------------------------------------------------
YFMJ_BACSU      -----------------------------------------------------------
TDH_SILPO       ITIKGVYGREMETWYKMIAMLQNG-----------------------------------
TDH_EDWI9       LLIKGIYGREMETWYKMAALIQSG-----------------------------------
QOR_SCHPO       LKVRPSHAVFEGYVSRLWKEILDNNLNIAIHHIFKLSEAKEAHDAIESRATTGKLLL--
ADHA_BACSU      -----------------------------------------------------------
ADH3_EMENI      INIKGSYVGNRQDGVEALDFFARGLIKAPFKKA-PLQDLPQIFELMGQGKIAGRYVL--
CADH_POPDE      -----------------------------------------------------------
PKS5_DICDI      -----------------------------------------------------------
CADH_SACOF      -----------------------------------------------------------
YNN4_YEAST      -----------------------------------------------------------
YHDH_ECOLI      -----------------------------------------------------------
MECR_DICDI      IQIRGLNKWQHTDSEKIFDLIRKKQFKLLIEK---------------------------
YBJB_SCHPO      LKIIGCN----------------------------------------------------
RT4I1_DICDI     -----------------------------------------------------------
PKS22_DICDI     SVIAGFRK-HKHVLKIIVDLLASGKLKTIPFNVYPVTKIKEAIESLGDRKHIGKNIV--
MTDH_APIGR      -----------------------------------------------------------
YCZ2_YEAST      -----------------------------------------------------------
PTGR1_BOVIN     LHLQG------------------------------------------------------
MECR_DROME      WSKENYSSPERSKMKEIFELMEQGKFVAPNHEMVPLAKFKD------------------
CADH3_ARATH     -----------------------------------------------------------
YNCB_ECOLI      -----------------------------------------------------------
CADH1_ORYSJ     -----------------------------------------------------------
CADH1_EUCGU     -----------------------------------------------------------
TDH_STRAW       ITIKGIYGREMFETWYAMSVLLEGGL---------------------------------
TDH_LEGPA       LVIKGIYGREMETWYKMIAMLQSGNISPVITHNFPVDEYQHAFQIMASGQ-SGKVIL--
CADH2_ARATH     -----------------------------------------------------------
YL460_YEAST     -----------------------------------------------------------
PKS23_DICDI     SVIAGFRK-HKHVLKIIVDLLASGKLKTIPFNVYPVTKIKEAIESLGDRKHIGKNIV--
YPHC_ECOLI      RRIIGSWVTSLFHMEKCAHDLTDWKLRNAITHRFSLEQAGDAYALMASGKC-GKVVI--
TDH_LEGPH       LVIKGIYGREMETWYKMIAMLQSGNISPVITHNFPVDEYQHAFQIMASGQ-SGKVIL--
PKS14_DICDI     -----------------------------------------------------------
ETR1_YARLI      -----------------------------------------------------------
ADH_SULSO       IQFVGSLVGNQSDFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
ADH_STAEQ       IEVVGSLVGTRQDLREAFQFAAENKVIPKV-QLRQLSEINDIFDEMEKGTITGRMVI--
YJGB_ECOLI      RSVSGSATGTPYELRKLMRFAARSKV-APTTELFPMSKINDAIQHVRDGKARYRVVL--
YGCW_ECOLI      L----------------------------------------------------------
TDH_LEGPL       LVIKGIYGREMETWYKMIAMLQSGNISPVITHNFPVDEYQHAFQIMASGQ-SGKVIL--
TDH_LEGPC       LVIKGIYGREMETWYKMIAMLQSGNISPVITHNFPVDEYQHAFQIMASGQ-SGKVIL--
DOIAD_STRSD     -----------------------------------------------------------
ADH_STAES       IEVVGSLVGTRQDLREAFQFAAENKVIPKI-QLRQLSEINDIFDEMEKGTITGRMVI--
PTGR1_RAT       LRMEGVTRWQGEVRQKLMNWVSEGKIR--------------------------------
CADH5_ARATH     -----------------------------------------------------------
CADH1_TOBAC     -----------------------------------------------------------
TDH_STRCO       ITVKGIYGREMFETWYAMSVLLEGGL---------------------------------
CADH_EUCGL      -----------------------------------------------------------
CADH2_EUCGU     -----------------------------------------------------------
DHSO_SCHPO      INVLGSFRYAHGCYKQSLFLVSNG-----------------------------------
CADH4_ORYSJ     -----------------------------------------------------------
XYLD_MORMO      -----------------------------------------------------------
PTGR1_HUMAN     -----------------------------------------------------------
ADH2_EMENI      -----------------------------------------------------------
FABG_VIBCH      -----------------------------------------------------------
ETR1_SCHPO      -----------------------------------------------------------
CADH1_OCIBA     -----------------------------------------------------------
CADH1_ARATH     -----------------------------------------------------------