[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38511.1

[Show Plain Result]


## Summary of Sequence Search
    1::795
    3::228     1e-54  47%  229 aa  Y321_RICBR RecName: Full=Uncharacterized RNA pseudouridine synthase
    3::229     5e-54  47%  229 aa  Y544_RICFE RecName: Full=Uncharacterized RNA pseudouridine synthase
    3::227     9e-53  47%  230 aa  Y807_RICCN RecName: Full=Uncharacterized RNA pseudouridine synthase
    3::231     1e-51  45%  235 aa  Y544_RICPR RecName: Full=Uncharacterized RNA pseudouridine synthase
    3::221     6e-49  46%  242 aa  Y532_RICTY RecName: Full=Uncharacterized RNA pseudouridine synthase
   13::299     2e-43  41%  386 aa  RLUB_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
    5::306     5e-41  37%  345 aa  RLUB_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   75::318     9e-40  41%  357 aa  RLUB_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
    2::220     3e-39  43%  318 aa  RLUB_YERPE RecName: Full=Ribosomal large subunit pseudouridine
    3::220     8e-38  43%  290 aa  RLUB_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    3::220     8e-38  43%  291 aa  RLUB_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    3::220     8e-38  43%  290 aa  RLUB_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    3::220     1e-37  43%  291 aa  RLUB_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    3::220     2e-37  42%  291 aa  RLUB_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    3::220     2e-37  42%  291 aa  RLUB_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    3::219     9e-34  40%  249 aa  Y361_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine synthase
    3::271     2e-33  38%  312 aa  RLUB_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
    3::256     2e-33  39%  321 aa  RLUB_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
    5::227     4e-33  38%  249 aa  Y1464_AQUAE RecName: Full=Uncharacterized RNA pseudouridine
    3::219     5e-33  42%  320 aa  RLUB_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
    4::229     1e-30  38%  257 aa  RLUB_BUCAP RecName: Full=Ribosomal large subunit pseudouridine
   27::279     1e-29  40%  476 aa  RLUB_XYLFT RecName: Full=Ribosomal large subunit pseudouridine
   27::279     1e-29  40%  476 aa  RLUB_XYLFA RecName: Full=Ribosomal large subunit pseudouridine
   28::285     5e-29  39%  492 aa  RLUB_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   28::285     7e-29  40%  550 aa  RLUB_XANAC RecName: Full=Ribosomal large subunit pseudouridine
    3::217     2e-27  36%  250 aa  RLUB_BUCAI RecName: Full=Ribosomal large subunit pseudouridine
   13::242     6e-25  34%  254 aa  Y1738_MYCBO RecName: Full=Uncharacterized RNA pseudouridine
   13::242     6e-25  34%  254 aa  Y1711_MYCTU RecName: Full=Uncharacterized RNA pseudouridine
    3::220     2e-24  36%  247 aa  RLUB_BUCBP RecName: Full=Ribosomal large subunit pseudouridine
    2::225     1e-23  35%  244 aa  RLUB_BACSU RecName: Full=Ribosomal large subunit pseudouridine
   49::237     3e-23  38%  241 aa  RLUE_PASMU RecName: Full=Ribosomal large subunit pseudouridine
   48::230     4e-22  36%  234 aa  RLUE_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
   17::231     5e-22  33%  256 aa  Y1370_MYCLE RecName: Full=Uncharacterized RNA pseudouridine
    2::206     5e-22  33%  230 aa  RSUA_PSEAE RecName: Full=Ribosomal small subunit pseudouridine
   10::188     5e-22  39%  189 aa  RLUE_PSEAE RecName: Full=Ribosomal large subunit pseudouridine
   57::239     4e-21  38%  241 aa  RLUE_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   54::237     1e-20  35%  238 aa  RLUE_VIBPA RecName: Full=Ribosomal large subunit pseudouridine
   49::221     1e-20  40%  240 aa  RLUE_HAEIN RecName: Full=Ribosomal large subunit pseudouridine
   34::215     1e-20  37%  217 aa  RLUE_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
   34::214     3e-20  36%  217 aa  RLUE_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
   34::211     6e-20  36%  217 aa  RLUE_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
   35::215     8e-20  36%  217 aa  RLUE_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    8::205     4e-19  32%  290 aa  RLUF_ECOLI RecName: Full=Ribosomal large subunit pseudouridine
    8::205     9e-19  32%  290 aa  RLUF_ECOL6 RecName: Full=Ribosomal large subunit pseudouridine
    8::205     9e-19  32%  290 aa  RLUF_ECO57 RecName: Full=Ribosomal large subunit pseudouridine
    7::244     1e-18  33%  262 aa  YE59_HELPJ RecName: Full=Uncharacterized RNA pseudouridine synthase
    8::205     1e-18  32%  290 aa  RLUF_SHIFL RecName: Full=Ribosomal large subunit pseudouridine
    8::205     1e-18  32%  289 aa  RLUF_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   31::215     1e-18  35%  221 aa  RLUE_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    8::205     1e-18  31%  289 aa  RLUF_SALTY RecName: Full=Ribosomal large subunit pseudouridine
    7::238     2e-18  31%  262 aa  Y1459_HELPY RecName: Full=Uncharacterized RNA pseudouridine
    2::174     7e-18  41%  187 aa  RLUE_XANCP RecName: Full=Ribosomal large subunit pseudouridine
   31::215     1e-17  35%  221 aa  RLUE_SALTI RecName: Full=Ribosomal large subunit pseudouridine
    2::212     2e-17  32%  231 aa  RSUA_SALTY RecName: Full=Ribosomal small subunit pseudouridine
    2::212     2e-17  32%  231 aa  RSUA_SALTI RecName: Full=Ribosomal small subunit pseudouridine
    2::210     3e-17  31%  231 aa  RSUA_SHIFL RecName: Full=Ribosomal small subunit pseudouridine
    2::210     3e-17  31%  231 aa  RSUA_ECOLI RecName: Full=Ribosomal small subunit pseudouridine
    2::210     3e-17  31%  231 aa  RSUA_ECOL6 RecName: Full=Ribosomal small subunit pseudouridine
    2::210     3e-17  31%  231 aa  RSUA_ECO57 RecName: Full=Ribosomal small subunit pseudouridine
   26::210     1e-16  32%  235 aa  RSUA_YERPE RecName: Full=Ribosomal small subunit pseudouridine
   31::205     1e-16  36%  208 aa  RLUE_YERPE RecName: Full=Ribosomal large subunit pseudouridine
    2::219     2e-16  31%  233 aa  RSUA_VIBVU RecName: Full=Ribosomal small subunit pseudouridine
    2::174     3e-16  37%  190 aa  RLUE_XANAC RecName: Full=Ribosomal large subunit pseudouridine
  198::292     9e-16  55%  985 aa  IF2_DESRM RecName: Full=Translation initiation factor IF-2;
    8::229     1e-15  30%  249 aa  Y129_BORBU RecName: Full=Uncharacterized RNA pseudouridine synthase
    2::211     2e-15  30%  233 aa  RSUA_VIBPA RecName: Full=Ribosomal small subunit pseudouridine
  708::923     1e-14  33% 2798 aa  NIPBL_MOUSE RecName: Full=Nipped-B-like protein;AltName:
   43::198     3e-14  36%  261 aa  Y612_SYNY3 RecName: Full=Uncharacterized RNA pseudouridine synthase
   18::132     1e-13  36%  157 aa  YTZF_BACSU RecName: Full=Uncharacterized RNA pseudouridine synthase
    2::217     1e-13  30%  231 aa  RSUA_VIBCH RecName: Full=Ribosomal small subunit pseudouridine
  697::902     1e-13  29% 2804 aa  NIPBL_HUMAN RecName: Full=Nipped-B-like protein;AltName:
    2::210     2e-13  29%  238 aa  Y554_AQUAE RecName: Full=Uncharacterized RNA pseudouridine synthase
  146::399     4e-10  30% 1131 aa  IF2_CLOPH RecName: Full=Translation initiation factor IF-2;
   94::306     2e-09  35%  971 aa  IF2_DESHY RecName: Full=Translation initiation factor IF-2;
    2::232     3e-09  27%  232 aa  RSUA_HAEIN RecName: Full=Ribosomal small subunit pseudouridine
    2::229     1e-08  27%  232 aa  RSUA_PASMU RecName: Full=Ribosomal small subunit pseudouridine
   32::180     3e-06  35%  325 aa  RLUD_YERPE RecName: Full=Ribosomal large subunit pseudouridine
   17::180     4e-06  32%  324 aa  RLUD_VIBCH RecName: Full=Ribosomal large subunit pseudouridine
   92::181     4e-05  36%  202 aa  RS4_NOCSJ RecName: Full=30S ribosomal protein S4;
   32::180     5e-05  33%  326 aa  RLUD_SALTY RecName: Full=Ribosomal large subunit pseudouridine
   32::180     5e-05  33%  326 aa  RLUD_SALTI RecName: Full=Ribosomal large subunit pseudouridine
   32::180     9e-05  33%  325 aa  RLUD_VIBVU RecName: Full=Ribosomal large subunit pseudouridine
  227::449     2e-04  26%  640 aa  SANT_PLAFW RecName: Full=S-antigen protein;Flags: Precursor;
   92::143     2e-04  43%  201 aa  RS4_CORGL RecName: Full=30S ribosomal protein S4;
   92::143     2e-04  43%  201 aa  RS4_CORGB RecName: Full=30S ribosomal protein S4;
   17::73      3e-04  47%  384 aa  Y955_SYNY3 RecName: Full=Uncharacterized tRNA/rRNA
   99::183     3e-04  31%  208 aa  RS4_HALOH RecName: Full=30S ribosomal protein S4;
   99::169     3e-04  37%  208 aa  RS4_CLOTH RecName: Full=30S ribosomal protein S4;
   92::143     3e-04  41%  201 aa  RS4_COREF RecName: Full=30S ribosomal protein S4;
   92::145     6e-04  40%  201 aa  RS4_RHOSR RecName: Full=30S ribosomal protein S4;
   92::145     6e-04  40%  201 aa  RS4_RHOOB RecName: Full=30S ribosomal protein S4;
   92::145     6e-04  40%  201 aa  RS4_RHOE4 RecName: Full=30S ribosomal protein S4;
  853::943     6e-04  27% 1209 aa  FA83H_MOUSE RecName: Full=Protein FAM83H;
   99::147     8e-04  44%  206 aa  RS4_GLOVI RecName: Full=30S ribosomal protein S4;
   92::149     8e-04  40%  201 aa  RS4_CORJK RecName: Full=30S ribosomal protein S4;
   99::150     8e-04  41%  207 aa  RS4_CLOD6 RecName: Full=30S ribosomal protein S4;
    1::795

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      ----------------------------------------------------------------------
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      ----------------------------------------------------------------------
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      ----------------------------------------------------------------------
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xEKRPYTPREGGDKRPYTPREGGEKRPYTPREGGEKRPYAAREGGEKRPYTPRDGGEKRSYAPREGGDKR
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      ----------------------------------------------------------------------
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ---RPYGDRQGGQGRPYGDRQGGQGRPYGDRQGGQGRPYGDRQGGQGRPYGDRQGGQSRPYGDRQGGQGR
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     -ESRPETPKQKSEGRPETPKQKGDGRPETPKQKSEGRPETPKQKGEGRPETPKHRHENRRDSGKPSTEKK
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     -KSRPETPKQKGESRPETPKQKSDGHPETPKQKGDGRPETPKQKGESRPETPKQKNEGRPETPKHRHDNR
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       ----PQTSTNSGDRRPQGQGSYGDRRP-QGQNSGDRRPYQGQNSGDRRPY----NGDRPQ--GQNSGDRR
IF2_DESHY       --------RVEGEGRPQGQRPMGD-RPQGQRPMGD-RPQGQRPMGD-RPQGQRPMGD-RPQGQRPMGD-R
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      -------PNSDGDKGPNSPNSDGDKGPNSPNSDGDKGP---NSDGDKGPNSDGDKG------PNSDGDKG
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----PYSEPKGNPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTPAYPERKGSPTQAYPERKGSPTS
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PYTPRGEGFRKDGERSRPTGDRPFGARPSXXXXXXXXXXXXXXAPDRGPRKDFGSXXXXXXXXXXAKPWQ
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      ----------------------------------------------------------------------
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       PY-----GDRPQGGQSRPYGDRPQGGQ-------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     PDVSKSDSPRLKSERAEALKQRPDGRWESL-------------------RRDHDSK-------------Q
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     ---------RDSGKPS--TEKKPEVSKHKQDTKSDSPRLKSERAEALKQRPDGRSVSESLRRDHDNK--Q
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       PYNPQGQGNYGDGDRRPYNGDRPQGQGNYGDRRPQGQGSYGDRRPNSGDRPQGQGNYGDRRPQGQGSYGD
IF2_DESHY       PQGQRPMGDRPQGQRDRPQGQRPMGDRPQGQRPMGDRPQGQRPMGDRPQQRPMGDRPQGQRPMGDRPQGQ
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      PNSDGDKGPNSDGDKG-PNSDGDKGPNSDGDKGPNSDGDKGPNSDDKGPNSDGDKGPNSDGDKGPNSDGD
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     GF-PNRRGSPTTGQKGSPTSTYP-----------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KRDGDSAERGRSFDKPRFDKPREERGGDRPRFSRDDRPKFERRERTGDWHEHPRNEGPSSDRPRSRDNGE
Y321_RICBR      ----------------------------------------------------------------------
Y544_RICFE      ----------------------------------------------------------------------
Y807_RICCN      ----------------------------------------------------------------------
Y544_RICPR      ----------------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      ----------------------------------------------------------------------
RLUB_PASMU      -------------------------------------------------------------KPNSRQNKP
RLUB_HAEIN      ----------------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      ----------------------------------------------------------------------
RLUB_VIBCH      ----------------------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      ----------------------------------------------------------------------
RLUB_XYLFA      ----------------------------------------------------------------------
RLUB_XANCP      ----------------------------------------------------------------------
RLUB_XANAC      ----------------------------------------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      ----------------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     KSDDRGESERHRGDQSRVRRPETLRSSSRNDHSKSDGSKTEKLER-----KHRHESGDSRDRPSGEQKSR
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     KSDDRGESERHRGDQSRVRRPETLRSSSRNEHGKSDSSKTDKLER-----KHRHESGDSRERPSSGEQKS
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       RRPQGQGSYG--------DRPQGQGSGDRPQGQGDRRPQGQRPQGQGSYGDRPQGQGSYGDR-RPQGQGS
IF2_DESHY       RPMGDRPQGQR----PMGDRPQGQRPGDRPQGQRPDRPQGQRP--MGD---RPQGQRPMGDRPQ----GQ
RSUA_HAEIN      ----------------------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      KGPNSDGDKGPNSDG---DKGPNSDGDKGPNSDGDKGPNSDDKGPNSDGDKGPNSDGPNSDGDKGNSDGD
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      -------------DKPRYQKPKLKRSGDKPRFN-DDQPQ-GFKEKSDRFQDKP--------RPRTND---
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RGFDRPRRENEDESKIFAKRPAFGGRGAYRERPKTDRSKTERRXXXXXXXXXXXGDRIAKVVARAGLCSR
Y321_RICBR      --------------------------------------------------------RLAKLISNAGICSR
Y544_RICFE      --------------------------------------------------------RLAKIISNAGICSR
Y807_RICCN      --------------------------------------------------------RLAKIISNAGVCSR
Y544_RICPR      --------------------------------------------------------RLAKIISNAGVCSR
Y532_RICTY      --------------------------------------------------------RLAKIISNAGVCSR
RLUB_PSEAE      ------------------------------------------------------GEKLQKVLARLGVGSR
RLUB_PASMU      HVEQKTSRRSTNANAVASKNV----KKVTEAQPKSVKASTHS-VKPTVKNPLVEGEKLQKVLARAGQGSR
RLUB_HAEIN      ------------------------------------------------------GEKLQKVLARAGQGSR
RLUB_YERPE      ------------------------------------------------------GEKLQKILARAGHGSR
RLUB_SHIFL      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_ECOLI      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_ECO57      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_ECOL6      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_SALTY      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_SALTI      -------------------------------------------------------EKLQKVLARAGHGSR
Y361_SYNY3      -------------------------------------------------------ERIQKLLSQWGIASR
RLUB_VIBPA      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_VIBCH      -------------------------------------------------------EKLQKVLARAGHGSR
Y1464_AQUAE     --------------------------------------------------------RINKFLSEAGVASR
RLUB_VIBVU      -------------------------------------------------------EKLQKVLARAGHGSR
RLUB_BUCAP      --------------------------------------------------------KIQKILSDLGYGSR
RLUB_XYLFT      -------------------------------------------------------ERLHKVLAQAGLGSR
RLUB_XYLFA      -------------------------------------------------------ERLHKVLAQAGLGSR
RLUB_XANCP      -------------------------------------------------------ERLHKVLAQAGLGSR
RLUB_XANAC      -------------------------------------------------------ERLHKVLAQAGLGSR
RLUB_BUCAI      -------------------------------------------------------EKIQKILSHLGYGSR
Y1738_MYCBO     ------------------------------------------------------GIRLQKVLSQAGIASR
Y1711_MYCTU     ------------------------------------------------------GIRLQKVLSQAGIASR
RLUB_BUCBP      -------------------------------------------------------EKIQKILARHGYGSR
RLUB_BACSU      -------------------------------------------------------ERLQKVIAHAGVASR
RLUE_PASMU      ----------------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     --------------------------------------------------------RLQKILSRAGIASR
RSUA_PSEAE      --------------------------------------------------------RLDRFLANLPELSR
RLUE_PSEAE      ----------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      --------------------------------------------------------RLNKYISESGICSR
RLUF_ECOL6      --------------------------------------------------------RLNKYISESGICSR
RLUF_ECO57      --------------------------------------------------------RLNKYISESGICSR
YE59_HELPJ      --------------------------------------------------------RINQFLAHYTKHSR
RLUF_SHIFL      --------------------------------------------------------RLNKYISESGICSR
RLUF_SALTI      --------------------------------------------------------RLNKYISESGICSR
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      --------------------------------------------------------RLNKYISESGICSR
Y1459_HELPY     --------------------------------------------------------RINQFLAHYTKHSR
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_SALTI      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_SHIFL      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_ECOLI      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_ECOL6      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_ECO57      --------------------------------------------------------RLDKFIAQQLGVSR
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      --------------------------------------------------------RLDKFLCDALGATR
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      --------------------------------------------------------RVHVFLAEKGVGSR
RSUA_VIBPA      --------------------------------------------------------RLDKYLCDALGATR
NIPBL_MOUSE     P--DSPRVKQGDTNK---SRPGFKSPNSKDDRTEGNRSKVD-----------------------------
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      --------------------------------------------------------RLDKFLCDALGTTR
NIPBL_HUMAN     RP-DSPRVKQGDSNK-------------------------------------------------------
Y554_AQUAE      --------------------------------------------------------RLDKYLSKSLHISR
IF2_CLOPH       YG-DRPQGQGNYGDRRPGGQGSYGGQGSYGDRPQ------------------------------------
IF2_DESHY       RPMDRPQGQRPMGDRPQGQRP-------------------------------------------------
RSUA_HAEIN      --------------------------------------------------------RLDKFIAENVGLTR
RSUA_PASMU      --------------------------------------------------------RLDKFLAENTGLTR
RLUD_YERPE      --------------------------------------------------------------------SR
RLUD_VIBCH      ------------------------------------------------------GQRLDQAVAELFTFSR
RS4_NOCSJ       --------------------------------------------------------RLDNVVYRAGFATR
RLUD_SALTY      --------------------------------------------------------------------SR
RLUD_SALTI      --------------------------------------------------------------------SR
RLUD_VIBVU      --------------------------------------------------------------------SR
SANT_PLAFW      KGSDGDKGPNSDGDK-------------------------------------------------------
RS4_CORGL       --------------------------------------------------------RLDNVVYRAGLANR
RS4_CORGB       --------------------------------------------------------RLDNVVYRAGLANR
Y955_SYNY3      ---DKPRRAGDKPS--------------------------------------------------------
RS4_HALOH       --------------------------------------------------------RLDNVVYRLGLASR
RS4_CLOTH       --------------------------------------------------------RLDNVVYRMGLASR
RS4_COREF       --------------------------------------------------------RLDNVVYRAGLATR
RS4_RHOSR       --------------------------------------------------------RLDNVVYRAGLATR
RS4_RHOOB       --------------------------------------------------------RLDNVVYRAGLATR
RS4_RHOE4       --------------------------------------------------------RLDNVVYRAGLATR
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       --------------------------------------------------------RLDNVVYRLGFASR
RS4_CORJK       --------------------------------------------------------RLDNVVYRAGLATR
RS4_CLOD6       --------------------------------------------------------RLDNVVYRMGLASR


                         *         .         .         .         .         +         .:560
query           RDAEAWIVEGRVAVNGRVIDSPALDVTYSDVITVDGKPLPERERTRLFLYHKPRGLMTTHADPEGRPTVF
Y321_RICBR      RDAEKLILDGQVKVNGIIVTSPATNVDTDNQVEVSGSLITSSQKSRLWIYYKPVGLITTHKDPLSRKTVF
Y544_RICFE      RDAEKLILEGQVKVDGITILSPATNVDISNQIEVSGILINQSQKPRLWIYYKPVGLITTHKDPLSRKTVF
Y807_RICCN      RDAEKLIVAGQVKVDGITILSPTTNVDISNQIEVSGTLINNIHKPRLWIYYKPVGLITTHKDPLSRKTVF
Y544_RICPR      RNAEKLIVGGKVKIDGITILSPATNVDMSNQIEVSGRLINNTQKPRLWIYYKPVGLITTHKDPLSRKTVF
Y532_RICTY      RNAEKLIVGGKVKIDGITILSPATNVDISNQIEVSGRLINNIQKPRLWIYYKPIGLITTHKDPLSRKTVF
RLUB_PSEAE      RDVEVWIAEGRVNVNGSVA-SLGQRVDSHDAITVDGHLIXXXXXXXXLIYNKPEGEVCTRDDPEGRPTIF
RLUB_PASMU      REIEAMIAENRVSVDGKIATGDRIDVHAGVKIRIDGHLIAQKEVCRVLMYYKPEGELCTRHDPEGRPTVF
RLUB_HAEIN      REIETMIAAGRVSVEGKIATGDRIDVHSGVKVRIDGQIITQKEICRVLMYYKPEGELCTRSDPEGRATVF
RLUB_YERPE      REIEAIIQQGRVSVDGKVSKGDRVEVTQSTKIRLDGHLLSIKESERVLAYYKPEGELCTRNDPEGRPTVF
RLUB_SHIFL      REIESIIEAGRVSVDGKIAKGDRVEVTPGLKIRIDGHLISVRESARVLAYYKPEGELCTRNDPEGRPTVF
RLUB_ECOLI      REIESIIEAGRVSVDGKIAKGDRVEVTPGLKIRIDGHLISVRESARVLAYYKPEGELCTRNDPEGRPTVF
RLUB_ECO57      REIESIIEAGRVSVDGKIAKGDRVEVTPGLKIRIDGHLISVRESARVLAYYKPEGELCTRNDPEGRPTVF
RLUB_ECOL6      REIESIIEAGRVSVDGKIAKGDRVEITPGLKIRIDGHLISVRESARVLAYYKPEGELCTRNDPEGRPTVF
RLUB_SALTY      REIESIIEAGRVSVDGKIATGDRVEVTPGLKIRIDGHLISVKESARVLAYYKPEGELCTRNDPEGRPTVF
RLUB_SALTI      REIESIIEAGRVSVDGKIATGDRVEVTPGLKIRIDGHLISVKESARVLAYYKPEGELCTRNDPEGRPTVF
Y361_SYNY3      RHAEEMILAGRVSVNGKVANLGDKADPQQDFLSVDGKQIKADNRPRYLLVNKPRDVLSTCDDPRGRKTVL
RLUB_VIBPA      REIESLIKSGRVSVNGVVAKLGERLEDESSVVRIDGHKVQEEVICRVLAYYKPEGELCTRHDPEGRRTVF
RLUB_VIBCH      RELEALIRAGRVSVNGKVAVLGERLEDDNAVVRIDGHVVSVKAQERVLAYYKPEGELCTRHDPEGRRTVF
Y1464_AQUAE     RKAEKLILEGRVKVNGEVVRSLGVKVNPEDIVEVDGKPV-KPQRKRYIILNKPCCYLTQLGSPDGRKTI-
RLUB_VIBVU      RELEALIKSGRVSVNGIVAKLGERLEDEQAVVRIDGHVVSVKAQERVLAYYKPEGELCTRHDPEGRRTVF
RLUB_BUCAP      RFIECMIKCGKISINGKAIIGQYLNKKNPGEILIDKKKIIVKRNKNLLIYNKPIGEVCTRDDFQKRLTVF
RLUB_XYLFT      RALEQRISNGLIKVNGDIAQL-GMSVKSGDKIELDGRSFVASEPARVLIYNKPEGEVTTREDPEGRPTVF
RLUB_XYLFA      RALEQRISNGLIKVNGDIAQL-GMSVKSGDKIELDGRSFVASEPARVLIYNKPEGEVTTREDPEGRPTVF
RLUB_XANCP      RALEQRIADGLIKVNGAVAQT-GMSVRSGDKIELDGRSFVASESSRVLVYNKPEGEVTTREDPEGRPTVF
RLUB_XANAC      RALEQRIADGLIKVNGAVAQT-GMSVRSGDKIELDGRSFVASEPSRVLIYNKPEGEVTTREDPEGRPTVF
RLUB_BUCAI      RNIENMIKFGDISINGKIVIGQRLNNKNIEVITIKGETVSXXXXXXXXXYNKPEGEICTRNDYKKRPIVF
Y1738_MYCBO     RAAEKMIVDGRVEVDGHVVTELGTRVDPQXXXXXXXXXXXXXXXSLVYLLNKPRGMHSTMSDDRGRPCIG
Y1711_MYCTU     RAAEKMIVDGRVEVDGHVVTELGTRVDPQXXXXXXXXXXXXXXXSLVYLLNKPRGMHSTMSDDRGRPCIG
RLUB_BUCBP      RYIESLIKSHSVKINDEVVKXXXXXXXXXXXXXXXXXXXXXXXSLKVLLYNKPEGEICTRKDQRNRRTIF
RLUB_BACSU      RKAEELIXXXXXXXXXXXXTELGVKVTGSDQIEVNGLKV-EREEPVYFLLYKPRGVISAAQDDKGRKVVF
RLUE_PASMU      --------------------------------------------TQVILFNKPYDVLTQFSDEEGRATLK
RLUE_VIBVU      ------------------------------------KSLSLAER-KIIIFNKPYDTLSQFTDGEGRKTLA
Y1370_MYCLE     RAAEKLIIEGRVEVDGQLVRELGTRXXXXXXXXXXXXXXXXXXXXXXYLLNKPRGMYSTMSDDRGRPCVG
RSUA_PSEAE      RDAQMLIAGGHLRVDGQVVRDGTHEVRVFSRVELDERLLQAGKPARYYMLHKPMGCVSATRDPQ-HPTVL
RLUE_PSEAE      ---------------------------------------------KLLLFNKPFDVLTQFNDEQGRSTLK
RLUE_VIBCH      ------------------------------------RPLSPAER-KVILFNKPYDTLSQFTDGDGRKTLA
RLUE_VIBPA      -------------------------------------PRVDLQNRKVIIFNKPYDTLSQFTDGDGRKTLA
RLUE_HAEIN      ------------------------------------------DETKVVLFNKPFDVLTQFTDEQGRATLK
RLUE_ECOLI      ---------------------------------------PENQPTRVILFNKPYDVLPQFTDEAGRKTLK
RLUE_ECO57      ---------------------------------------PENQPTRVILFNKPYDVLPQFTDEAGRKTLK
RLUE_ECOL6      ---------------------------------------PENQPTRVILFNKPYDVLPQFTDEAGRKTLK
RLUE_SHIFL      ----------------------------------------ENQPTRVILFNKPYDVLPQFTDETGRKTLK
RLUF_ECOLI      READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPREAEDLVLINKPVGIVSTTEDGE-RDNIV
RLUF_ECOL6      READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPRESEDLVLLNKPVGIVSTTEDGE-RDNIV
RLUF_ECO57      READRYIEQGNVFLNGKRA-TIGDQVKPGDVVKVNGQLIEPREAEDLVLLNKPVGIVSTTEDGE-RDNIV
YE59_HELPJ      REAEKLVLEGRVKINHEHAKLASV-VKENDKVFLDKKPL-KNKKFSVLVYHKPKGELVSKADPLKRHVIY
RLUF_SHIFL      READRYIEQGNVFLNGKRA-TIGDQVKPGDIVKVNGQLIEPREAEDLVLLNKPVGIVSTTEDGE-RDNIV
RLUF_SALTI      READRFIEQGNVFINGKRA-AIGDQVVAGDVVKVNGRLIEPREADDLVLLNKPVGIVSTTEDGE-RDNIV
RLUE_SALTY      ------------------------------------KSRKENQPKRVVLFNKPYDVLPQFTDEAGRRTLK
RLUF_SALTY      READRFIEQGNVFINGKRA-AIGDQVVAGDIVKVNGRLIEPREADDLVLLNKPVGIVSTTEDGE-RDNIV
Y1459_HELPY     REAEKLVLEGRVKINHEHAKLASV-VKENDRVFLDKKPL-KNKKFSVLVYHKPKGELVSKADPLKRRVIY
RLUE_XANCP      ----------------------------------------------LVLLNKPYGVLSQFSDPPKRTLAE
RLUE_SALTI      ------------------------------------KSRKENQPKRVVLFNKPYDVLPQFTDEAGRRTLK
RSUA_SALTY      AIAGREIRGNRVTVDGDIIKNAAFKLLPEHAVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_SALTI      AIAGREIRGNRVTVDGDIIKNAAFKLLPEHAVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_SHIFL      AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_ECOLI      AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_ECOL6      AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_ECO57      AIAGREIRGNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPD-HPTVL
RSUA_YERPE      ----------RVTIDGEVVKSGAIKLTPEQDVRFDGNPLQQMVGPRYFMLNKPQGYVCSTEDPD-HPTVL
RLUE_YERPE      ----------------------------------------------VLLFNKPFDVLPQFTDESGRTTLQ
RSUA_VIBVU      KEATKILKSGEVTVNEQVQKSGAVKVTEECVVEWQGRELAMQGPRYIMLY-KPEGFVCSHEDGFNH-TAF
RLUE_XANAC      ----------------------------------------------LVLLNKPYGVLSQFSDPPKRTLAE
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      RFCEELIRKKLVRVNNTI-------AKLGDKVTLGDRIIYKKQNNRIYLLNKPRNYLCSNFDVDGRKLAI
RSUA_VIBPA      KQATKIIKSGEVLVDGEVQKSGSFKVPEGGVVEWDGREVGAPGPRYIMLY-KPADFVCSHEDGYN-PTAF
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      ------------------------------------------------VFYKPYGVLCQFTDNSARPTLK
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      KEATQLLKSGEVTVDDVVQKSGAFKLKETSCVEWQGREIT-LHGPRYIMMHKPDGVVCSHEDGFNQTTLL
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      KEAKELIREGRVKVSGKVVKQAEYRXXXXXXXXXXXXXXXXXXNVYLMLY-KPKGYLSTTEEDKKYPSFL
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      SQATKAIRQSAVKINGEIVKSGSVQISQEDEIYFEDELLTWIEEGQYFMLNKPQGCVCSNDDGD-YPTIY
RSUA_PASMU      SQANKVLKQSAVTVNGHVEKNGAQKVSQTDEICLEGEHLPWVSAGQYLMLYKPQGYVCSHEDGD-YPTIY
RLUD_YERPE      SRIKEWILDSRVTVNGKKINKPKEKVLGGELVAIDAQPLDVYEDNDILVINKPRGLVVHPGAGNPDGTVL
RLUD_VIBCH      SRLKEWLLEGKIAVNGDVITKPRTKVMGGEVITVQAELEDEQEDDDIIVINKPRDFVVHPGAGQADKTVL
RS4_NOCSJ       RHARQLVTHGHFKVNGKKVDIPSFQVTAHDVIDVREKSL---EMTPFIVARETHGERVVPAWLEAIPSRM
RLUD_SALTY      SRIKEWILNQRVLVNGQLCDKPAIDAEIDEEIRFEAQDIPVYEDDDILVINKPRDLVVHPGAGNPDGTVL
RLUD_SALTI      SRIKEWILNQRVLVNGQLCDKPAIDAEIDEEIRFEAQDIPVYEDDDILVINKPRDLVVHPGAGNPDGTVL
RLUD_VIBVU      SRLKEWLLDGKVTVDGNVVTKPRTKVMGGEVITVEAQDIPVYEDDDILVINKPRDFVVHPGAGTPDGTVL
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       RQARQLVSHGHFTVNGKAIDVPSFRVSQYDIINVREK---------------------------------
RS4_CORGB       RQARQLVSHGHFTVNGKAIDVPSFRVSQYDIINVREK---------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       NEARQFVLHGHILVNGRKVNIPSYLVDEGDVISVKDSSRKSKRFKEVFEFNEPKWLSVNLEKAEGK----
RS4_CLOTH       REARQLVRHGHFTVNGKRVDIPSYLVKVGDVIAVKSKSSPKMQSNKEYAAGRPR----------------
RS4_COREF       RQARQLVSHGHFVVNGKAVDVPSFRVSQYDIIDVREK---------------------------------
RS4_RHOSR       RQARQLVTHGHLLVNNKKVDIPSYRVSQYDIIDVKEKSL-------------------------------
RS4_RHOOB       RQARQLVTHGHLLVNNKKVDIPSYRVSQYDIIDVKEKSL-------------------------------
RS4_RHOE4       RQARQLVTHGHLLVNNKKVDIPSYRVSQYDIIDVKEKSL-------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       AQARQWVNHGHFAVNGRRVSIPSYRVRPGDAITV------------------------------------
RS4_CORJK       RQARQLVSHGHFTVNGKKVNVPSFKVSQYDIIDV-------REKSRSMLW--------------------
RS4_CLOD6       KEARQLVTHGHFTLNGNKVDIPSLIVKVGDVIEVKEK---------------------------------


                         .         .         .         *         .         .         .:630
query           DNLPEDLPRLISIGRLDFNTEGLLLLTNDGGLARALELPETGWLRRYRVRAHGEVTQAQLDQLASGVEVD
Y321_RICBR      EQL-TGLPRVISIGRLDLNSEGLLLLTNNGDLARQFELPSSKLKRVYHVRAYGN-PDPLLKSNYKNLEID
Y544_RICFE      EQL-TGLPRVISIGRLDLNSEGLLLLTNSGDLARQFELPSNRLKRVYHVRAYGK-SDILLKSDYKNLEID
Y807_RICCN      EQL-TGLPRVISIGRLDLNSEGLLLLTNSGDLARQFELPSSRLKRVYHVRAYGK-SDILLKSNYKNLEID
Y544_RICPR      EQL-IGLPRVISIGRLDLNSEGLLLLTNSGDLAHQFEMPASKLKRVYNVRAYG-XXXXXXXXXXXXXXID
Y532_RICTY      EQL-IGLPRVISIGRLDLNSEGLLLLTNSGDLAHQFEMPSSKLKRVYNVRAYG-XXXXXXXXXXXXXKID
RLUB_PSEAE      DRLPRRTGRWINVGRLDINTTGLLLFTTDGELANRLMHPSYEMDREYAVRVRGEVTEEMIERLLNGVMLE
RLUB_PASMU      DRLPRLTSRWIAVGRLDINTSGLLLFTTDGELANRLMHPSREVEREYSVRVFGQVDEAMLHRLKKGVQLE
RLUB_HAEIN      DRLPRLTSRWIAVGRLDINTSGLLLFTTDGELANRLMHPSREVEREYSVRVFGQVDDAMLARLRKGVQLE
RLUB_YERPE      DRLPKLRSRWVAVGRLDVNTSGLLLFTTDGELANRLMHPSREVEREYAVRVFGQIDDDKIKQLSRGVQLE
RLUB_SHIFL      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLE
RLUB_ECOLI      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLE
RLUB_ECO57      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLE
RLUB_ECOL6      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLE
RLUB_SALTY      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDESKLRDLSRGVQLE
RLUB_SALTI      DRLPKLRARWIAVGRLDVNTCGLLLFTTDGELANRLMHPSREVEREYAVRVFGQVDESKLRDLSRGVQLE
Y361_SYNY3      DLLPQDLQRLHPVGRLDRNSTGALLLTNDGELTLRLTHPRYHLPKTYDVWLEGNPSDEDLEKWRSGMMLD
RLUB_VIBPA      DRLPKIRSRWISVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGEVTEQKVRNLVKGVELE
RLUB_VIBCH      DRLPKIRSRWISVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGDVTEEKVRNLVRGVQLE
Y1464_AQUAE     EELIKDIPRVFPVGRLDYNTEGLLILTNDGELANRILHPRYKLPKVYLALVEGKVDQKTLKRMKQGIELE
RLUB_VIBVU      DRLPKIRSRWISVGRLDANTSGLLLFTTDGELANRLMHPSRQVEREYLVRVFGEVNEHKVRNLVNGVELD
RLUB_BUCAP      DKLPKNLNRWVSVGRLDINTKGLLLFTNDGTLANKLMHPRSQIEREYNIRIFGEMNKNKINILRKGVKIG
RLUB_XYLFT      ETLPVKGARWIAIGRLDINXXXXXXXXXDGELANAMMHPSSEIEREYVVRVRSHVQDELLEQLTRGVMLE
RLUB_XYLFA      ETLPVKGARWIAIGRLDINXXXXXXXXXDGELANAMMHPSSEIEREYVVRVRSHVQDELLEQLTRGVMLE
RLUB_XANCP      ESLPAKGSRWIAIGRLDINXXXXXXXXXDGELANAMMHPSXXXXXXXXXEGEEKVPDSMIERLSRGVEDG
RLUB_XANAC      ESLPVKGSRWIAIGRLDINXXXXXXXXXDGELANAMMHPSXXXXXXXXXEGEEKVSDAIIERLSRGVEDG
RLUB_BUCAI      DKLPLNIHRWISIGRLDINTRGLLLFTNNGNLANELMHPSNKIEREYYIRVFGKINKNTMNILKNGVKID
Y1738_MYCBO     DLIERKVKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGSVPRGLGRTLRAGIELD
Y1711_MYCTU     DLIERKVKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYLATVTGSVPRGLGRTLRAGIELD
RLUB_BUCBP      EKLPKSNARWINIGRLDLNSSGLLLFTTDGELAYRLTHPSFNIERIYKVRVFGQFTENILKQLNVRVKLD
RLUB_BACSU      KNIPQ---RIYPIGRLDYDTSGLLLLTNDGEFANKLMHPKYEIDKTYVAKVKGIPPKELLRKLERGIRLE
RLUE_PASMU      AFIP--IPHVYPAGRLDRDSEGLVLLTNNGEIQHRLAVPKFNTEKTYFAQVEGIPQETDLAQLRQGVVLN
RLUE_VIBVU      DFIP--VKEVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSKSPKTYWVQVEGAPTEAQLEPLRRGVELK
Y1370_MYCLE     DLIERRVKKLFHVGRLDADTEGLILLTNDGELAHRLMHPSHEVSKTYLATVKGAVPRGLGKKLSVGLELD
RSUA_PSEAE      DLFPEDLRDDLHIGRLDYNTTGLMLLTNDGQWSRRLTLPGSRRDKVYYVETEAPIDQRYVDAFAAGLHFR
RLUE_PSEAE      DFIP--VPGVYPAGRLDRDSEGLLLLTNDGRLQARIADPRHKLPKTYWVQVEGTPDEEQLRRLREGVTLN
RLUE_VIBCH      DYIP--IKDVYAAGRLDRDSEGLLILTNDGILQARLTQPQSKAPKTYWVQVEGSPQESDLEALRHGVTL-
RLUE_VIBPA      DYIP--VKDVYAAGRLDRDSEGLMVLTNDGILQAKLTQPKSKSPKTYWVQVDGAPQEQDLEKLRKGVELD
RLUE_HAEIN      DFI--SIPNVYAAGRLDRDSEGLLILTNNGELQHRLADPKFKTEKTYWVQVEGIPEETDLAQLRKGVELD
RLUE_ECOLI      EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
RLUE_ECO57      EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
RLUE_ECOL6      EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
RLUE_SHIFL      EFIP--VQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQDALEALRNGVTLN
RLUF_ECOLI      DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPIL
RLUF_ECOL6      DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPIL
RLUF_ECO57      DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPIL
YE59_HELPJ      ESLEKKYAHFAPVGRLDFASEGVLLLSDSKAVVSA--LMHANLEKEYLVKIQGFVTREMENAMQEGLKLE
RLUF_SHIFL      DFVNHS-KRVFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPIL
RLUF_SALTI      DFVNHS-KRIFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPIL
RLUE_SALTY      DFIP--VQGVYAAGRLDRDSEGLLVLTNDGALQARLTQPGKRTGKIYYVQVEGIPDNAALQALRTGVTLN
RLUF_SALTY      DFVNHS-KRIFPIGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYLVTVDKPITDEFIRGMGAGVPIL
Y1459_HELPY     ESLEKKYAHFAPVGRLDFASEGVLLLSDSKAVVSALMHADLE--KEYLIKIQGFVTREMENAMQEGLKLE
RLUE_XANCP      FGLP---PQVYAAGRLDHDSEGLLLLTDDGPLAHRLTDPRHKQPKTYWVQVEGDPDTSQLQALCDGVLLD
RLUE_SALTI      DFIP--VQGVYAAGRLDRDSEGLLVLTNDGALQARLTQPGKRTGKIYYVQVEGIPDNAALQALRTGVTLN
RSUA_SALTY      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAAQFAKGVQLH
RSUA_SALTI      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAAQFAKGVQLH
RSUA_SHIFL      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
RSUA_ECOLI      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
RSUA_ECOL6      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
RSUA_ECO57      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLH
RSUA_YERPE      YFLDEPVAKLHAAGRLDIDTTGLVLMTDDGQWSHRVTSPRHHCEKTYLVTLEHPLSDDTAQQFADGVQLY
RLUE_YERPE      GFIP--FKDVYAAGRLDRDSEGLLVLTNDGKLQARLTQPAQKTGKVYFVQVEGVPDNDALTQLKRGVTLK
RSUA_VIBVU      VLLDEKMDELHFAGRLDVDTTGLVLITDDGKWSHRITSPKHKCDKTYRVWLADPIGSDYAEKLAEGVQLR
RLUE_XANAC      FGLPPDV---YAAGRLDHDSEGLLVLTDDGALAHRLTDPRHKQPKTYWVQVEGAPQAEHLQALRDGVALN
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      SLVPLFKERVFSIGRLDFKSSGLLLFTNDGKFANDIIHPRQKVEREYIIESKKDIDENLLISFKSGIKVK
RSUA_VIBPA      VLLDEPVENLHFAGRLDVDTTGLVLITDDGQWSHRITSPKHKCKKTYRVWLADAIQPDYVEKFAQGIELR
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      DYI--NLPDLYPVGRLDQDSEGLLLLTSNGKLQHRLAHREFAHQRTYFAQVEGSPTDEDLEPLRRGITFA
YTZF_BACSU      -------------GRLDKDTEGFLLLTNDGQLAHRLLSPKKHVPKTYEVHLKSQISREDISDLETGVYIE
RSUA_VIBCH      DEV--NIQDLHFAGRLDVDTTGLLLITDDGQWSHRVTSPKHKCEKTYRVWLADPIQADYAEQFNRGIELR
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      ELIREHFPKLFSAGRLDVDAEGLLLITDDGELAHRLTHPKWKVEKEYIVRLDRDIG----DXXXXXXXXX
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      QFFDYPLAKLHSAGRXXXXXXXXXXXXXXXQWSHRITSPKHHCEKTYLVTLADPVEENYSAACAEGILLR
RSUA_PASMU      QFFDYPLAKLHSAGRXXXXXXXXXXXXXXXKWSHRITSPKHHCEKTYLVTLADPVESHYQQACAEGMLLR
RLUD_YERPE      NALPEDVPRAGIVHRLDKDTTGLMVVAKQTRLVEALQAREI--TREYEAVAIGNMT--------------
RLUD_VIBCH      NALIAEVPRAGIVHRLDKDTTGLMVVAKQTRLVRALQKRDV--TREYEAIVIGTMT--------------
RS4_NOCSJ       RVLVHQLP--------------------------------------------------------------
RLUD_SALTY      NALLHDVPRAGIVHRLDKDTTGLMVVAKQTRLVESLQLREI--TREYEAVAIGHMT--------------
RLUD_SALTI      NALLHDVPRAGIVHRLDKDTTGLMVVAKQTRLVESLQLREI--TREYEAVAIGHMT--------------
RLUD_VIBVU      NALPEEVPRAGIVHRLDKDTTGLMVVAKQTRLVRALQ--KRNITREYEAIAIGRMT--------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GVKYGPIEAKLERDQGANVWLVFAIREGKNREVRNVLAHLGLEVNRLIRVSYGPFQLLEIEEGQVEEVKT
Y321_RICBR      GIFYNPQSIKLLRKNSTNSWLEVILFEGKNREIRRIFEHFGLKVNKLIRTEYGDFKLDNLKPNEYREVTK
Y544_RICFE      GIFYNPHSIKLFKQNKSNSWFEVVLFEGKNREIRRIFEYFGLKVNKLIRIQYGSFTIDNLKPGAYKEINN
Y807_RICCN      GIFYNPHSIKLLKQNKTNCWFEVVLFEGKNREIRRIFEYCGLKVNKLIRIQYGSFTIDNLKPGDYKEINN
Y544_RICPR      GIFYNPHSIKLLRQNKSNSWFEVVLFEGKNREIRRIFEYFGLQVNKLIRIQYGALKIGNLKPGNYQEISN
Y532_RICTY      GIFYNPYSIKLLRQNKNNSWFEVVLFEGKNREIRRIFEYFGLKVNKLIRVQYGALKIGNLKPGDYKE---
RLUB_PSEAE      DAKFSDIQ-QAPGGEGFNHWYHCVVMEGRNREVRRLWESQGLVVSRLKRVRFGPFLTSELTMGRYREMDQ
RLUB_PASMU      DGPANFKEIKFAGGVGMNQWFDVTLMEGRNREVRRLWESQGVQVSRLIRTRYGNISLMKLPRGGWEEMNV
RLUB_HAEIN      DGLANFKEIKFTGGVGINQWYDVTLMEGRNREVRRLWESQGIQVSRLIRIRYGNIKLMKLPRGGWEEMNV
RLUB_YERPE      DGPAAFRTISYQGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDINL-------------
RLUB_SHIFL      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
RLUB_ECOLI      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
RLUB_ECO57      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
RLUB_ECOL6      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
RLUB_SALTY      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
RLUB_SALTI      DGPAAFKTIKFSGGEGINQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPL-------------
Y361_SYNY3      GKKTLPATLEVISENKDQIHLLVTLTEGRNRQIRRLAEELGLTVLKLHRRTIGPLQL-------------
RLUB_VIBPA      DGLARFEDVVYAGGEGMNHTFYVVINEGRNREVRRLWESQECTVSRLKRVRYGDIFLKKLPRGELDLKEV
RLUB_VIBCH      DGMARFEDVMYAGGEGINHTFYVVINEGRNREVRRLWESQGTTVSRLKRVRYGDIFLMELDLKQVNYLRE
Y1464_AQUAE     DGFAKPDNIRIVRYEGKNTLLEITFHEGRKHLVKRFLGAFGHKVKRLKRIAIGPIKLGKLSPGKWREL--
RLUB_VIBVU      DGLARFEDVVYTGGEGMNHTFYVVINEGRNREVRRLWESQDCTVSRLKRVRYGDIYL-------------
RLUB_BUCAP      YVSFKEIVPLYDKKEGKNKWFKGILCEGKNREIRLMFKSIQCQVNQLIRVRYGNIILKNLKEGQ------
RLUB_XYLFT      DAKFDTIERIGNTD--SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRYGPRELLRGQSTELPKTQV
RLUB_XYLFA      DAKFDTIERIGNTD--SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRYGPRELLRGQSTELPKTQV
RLUB_XANCP      GAKFDEIERIGGTD--SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRTRYGPRELLRGQSVELAQEKV
RLUB_XANAC      GAKFDEIERIGGTD--SHDWFRVVVKEGRNREVRRLWESQGCQVSRLKRSRYGPRELLRGHSVEVAQDKV
RLUB_BUCAI      GAAFKSIQTIDHACSKKNKWFKGVLCEGRNREIRSMWQAVQCQVSRLIRIRYG-----------------
Y1738_MYCBO     GPAFVDDFAVVDAIPGKTLVRV-TLHEGRNRIVRRLLAAAGFPVEALVRTDIGAVSLGKQRPGSVRALRS
Y1711_MYCTU     GPAFVDDFAVVDAIPGKTLVRV-TLHEGRNRIVRRLLAAAGFPVEALVRTDIGAVSLGKQRPGSVRALRS
RLUB_BUCBP      GANFKSIQFKY--GEGKNKWFNVSLCEGRHRIVRRIWEKLGFQVNKLVRISYAHLTL-------------
RLUB_BACSU      EGKXXXXXXXXXXXXXQTSIIQLTIHEGRNRQVRRMFEAIGHEVIKLKREEYAFLNLRGLHTGDAREL--
RLUE_PASMU      DGKTLPAKVRLERKQIPTSWLEIKIHEGRNRQVRRMTAHIGFPTLRLIRYQMALFNLANLEQGQLSEVEL
RLUE_VIBVU      DGLTLPAQVEIIQDPQPTTWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSMGGMTLQDLQPGEWKEI--
Y1370_MYCLE     GPAHVDDFAVVDAIPGKTL-VRLTLHEGRKRIVRRLLTAAGFPVEMLVRTDIGAVSL-------------
RSUA_PSEAE      FEDLVTLPAQLEPIGPRCARL--TLHEGRYHQVKRMFGHFDNKVLRLHRERMG-----------------
RLUE_PSEAE      DGPTLPAEARLFRKSVPTHWLELVIREGRNRQVRRMTAAVGLPTLRLVRVRIGPWSLDGLGLGEWREVPA
RLUE_VIBCH      --KDGPLPAKVDRAAIPTTWLAITLMEGRNRQVRRMTAHIGFPTLRLIRYSMGDWNLGDLQPGEWREV--
RLUE_VIBPA      GMT---LPAKVERANIPTTWLAITIIEGRNRQVRRMTAHIGFPTLRLVRYSMGDITLGDLQPGQWKEIQ-
RLUE_HAEIN      GVRNPPIR---ERKNIPTSWLEIKISEGRNRQVRRMTAHIGFPTLRLVRVSMGLLSINGLENG-------
RLUE_ECOLI      DGPTLPAGAELERKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREV--
RLUE_ECO57      DGPTLPAGAELERKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWRE---
RLUE_ECOL6      DGPTLPAGAELERKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGE------
RLUE_SHIFL      DGPTLPAGAELERKSIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRYAMGDYSLDNLANGEWREV--
RLUF_ECOLI      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
RLUF_ECOL6      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
RLUF_ECO57      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
YE59_HELPJ      NATKGPIKSEIIKNHAKYSKLRVIINEGKNRELRRFFAFFNAGVLDLRRVRYGFVNLNALPVG-----KA
RLUF_SHIFL      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEHFGYEVKKLER---------------------
RLUF_SALTI      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEYFGYEVTKLER---------------------
RLUE_SALTY      DGPTLPAGIEIERKNIPTSWLKVTLYEGRNRQVRRMTAHVGHPTLRLIRYSMGDYTLNGLDNGQWREI--
RLUF_SALTY      GTVTKKCKVKKEAPFVFRITLV----QGLNRQIRRMCEYFGYEVTKLER---------------------
Y1459_HELPY     NATKGPIKSEIIKNHAKYSKLRVIINEGKNRELRRFFAFFNAGVLDLRRVRYGFVNLNALPVGKM-----
RLUE_XANCP      GPTRPANVRRLERDPPVRVWLEVQITEGRNRQVRRMTASVGLPTLRLVRVAIGAWSLASLQPGQ------
RLUE_SALTI      DGPTLPAGIEIERKNIPTSWLKVTLYEGRNHQVRRMTAHVGHPTLRLIRYSMGDYTLNGLDNGQWCEI--
RSUA_SALTY      NEKDLTKPATLEVITPVQVRL--TISEGRYHQVKRMFAAVGNRVVELHRERIGAITLDE-----------
RSUA_SALTI      NEKDLTKPATLEVITPVQVRL--TISEGRYHQVKRMFAAVGNRVVELHRERIGAITLDE-----------
RSUA_SHIFL      NEKDLTKPAVLEVITPTQVRL--TISEGRYHQVKRMFAAVGNHVVELHRERIGGITL-------------
RSUA_ECOLI      NEKDLTKPAVLEVITPTQVRL--TISEGRYHQVKRMFAAVGNHVVELHRERIGGITL-------------
RSUA_ECOL6      NEKDLTKPAVLEVITPTQVRL--TISEGRYHQVKRMFAAVGNHVVELHRERIGGITL-------------
RSUA_ECO57      NEKDLTKPAVLEVITPTQVRL--TISEGRYHQVKRMFAAVGNHVVELHRERIGGITL-------------
RSUA_YERPE      NEKSLTKPAQLDVIEPQRVRL--TISEGRYHQVKRMFAAVGNRVIELHRERIGDITL-------------
RLUE_YERPE      DGLTLPAGAELERKTIPTSWLKITLYEGRNRQVRRMTAHVGFPTLRLIRFSMGNLSLGNLQPGEWKEI--
RSUA_VIBVU      NEKELTLPAQMTIVNADENEVLLTIHEGKYHQVKRMFAALGNKVEQLHRERIGAIELDELEPGE------
RLUE_XANAC      DGPTRPAQVRMPRDPPVRVWLELQITEGRNRQVRRMTAAVGLPTLRLVRVAIGDWRLDALAPGQ------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      KEFFKLKSYEILNKNSARL----ILDEGKNREIRKVFLSKNIFLKKIHRIRIGNINLDSLKEGQVKIV--
RSUA_VIBPA      NEREATLPAHLEIVNEAENEVLLTIVEGKYHQVKRMFAALGNKVELLHRERIGDIVL-------------
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      DYPTRPAIAKIYRASIPTSWLSITLTEGRNRQVRRMTAAVGFPTLRLVRV--------------------
YTZF_BACSU      GYKTKPAKAEIKTNDSGNTVIYLTITEGKYHQVKQMAKAVGNEVVYLKRLSMGRVSL-------------
RSUA_VIBCH      GERELTLPAQLEVISETEVLL--TIHEGKYHQVKRMFAALGNKVIGLHRERIGQITLDELEPGE------
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      XXXXXPVQVKAEKLSGDTVKAI--LTEGRHHVVKRLFKAVGHNVVYLKRTRVGNLRLDE-----------
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      GEKEPTKPAKLEILDDYNVNL--TISEGRYHQVKRMFAALGNKVVGLHRWKIGDVVLDE----SLEEGEY
RSUA_PASMU      GEKTPTKPATLEILDDYNVNL--TISEGRYHQVKRMFAALGNKVVGLHRWKIGQIELDDLAEGEAEEIAT
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           RVLREQLGEKIIKLAEADFGGPSPSETRPKPRPGKPVAAEDGPAPKKKAVVKRxxxxxxxxxxxxxxxxx
Y321_RICBR      KLYK------------------------------------------------------------------
Y544_RICFE      KILEK-----------------------------------------------------------------
Y807_RICCN      KIL-------------------------------------------------------------------
Y544_RICPR      KILEKQL---------------------------------------------------------------
Y532_RICTY      ----------------------------------------------------------------------
RLUB_PSEAE      RILSEEVGLKPVALPGMTTKAREKAE-RQQRKQARPLARSERPEAGRKRAPRR-----------------
RLUB_PASMU      NYLRELVG--------------------------------------------------------------
RLUB_HAEIN      NYLRELVG--------------------------------------------------------------
RLUB_YERPE      ----------------------------------------------------------------------
RLUB_SHIFL      ----------------------------------------------------------------------
RLUB_ECOLI      ----------------------------------------------------------------------
RLUB_ECO57      ----------------------------------------------------------------------
RLUB_ECOL6      ----------------------------------------------------------------------
RLUB_SALTY      ----------------------------------------------------------------------
RLUB_SALTI      ----------------------------------------------------------------------
Y361_SYNY3      ----------------------------------------------------------------------
RLUB_VIBPA      NYLRELVELRPEKETMLDLSKDNTSRKRERARSQK-----------------------------------
RLUB_VIBCH      LVELRPEKETVLNMA-------------------------------------------------------
Y1464_AQUAE     ----------------------------------------------------------------------
RLUB_VIBVU      ----------------------------------------------------------------------
RLUB_BUCAP      ----------------------------------------------------------------------
RLUB_XYLFT      EALRTQLKEKDMPLA-------------------------------------------------------
RLUB_XYLFA      EALRTQLKEKDMPLA-------------------------------------------------------
RLUB_XANCP      DALRAEL-----KLEE---GAPSALTLQP-----------------------------------------
RLUB_XANAC      DALRAEL-----KLEE---GAPSALTLQP-----------------------------------------
RLUB_BUCAI      ----------------------------------------------------------------------
Y1738_MYCBO     ----------------------------------------------------------------------
Y1711_MYCTU     ----------------------------------------------------------------------
RLUB_BUCBP      ----------------------------------------------------------------------
RLUB_BACSU      ----------------------------------------------------------------------
RLUE_PASMU      TALYQQL---------------------------------------------------------------
RLUE_VIBVU      ----------------------------------------------------------------------
Y1370_MYCLE     ----------------------------------------------------------------------
RSUA_PSEAE      ----------------------------------------------------------------------
RLUE_PSEAE      RL--------------------------------------------------------------------
RLUE_VIBCH      ----------------------------------------------------------------------
RLUE_VIBPA      ----------------------------------------------------------------------
RLUE_HAEIN      ----------------------------------------------------------------------
RLUE_ECOLI      ----------------------------------------------------------------------
RLUE_ECO57      ----------------------------------------------------------------------
RLUE_ECOL6      ----------------------------------------------------------------------
RLUE_SHIFL      ----------------------------------------------------------------------
RLUF_ECOLI      ----------------------------------------------------------------------
RLUF_ECOL6      ----------------------------------------------------------------------
RLUF_ECO57      ----------------------------------------------------------------------
YE59_HELPJ      RFLNRQ----------------------------------------------------------------
RLUF_SHIFL      ----------------------------------------------------------------------
RLUF_SALTI      ----------------------------------------------------------------------
RLUE_SALTY      ----------------------------------------------------------------------
RLUF_SALTY      ----------------------------------------------------------------------
Y1459_HELPY     ----------------------------------------------------------------------
RLUE_XANCP      ----------------------------------------------------------------------
RLUE_SALTI      ----------------------------------------------------------------------
RSUA_SALTY      ----------------------------------------------------------------------
RSUA_SALTI      ----------------------------------------------------------------------
RSUA_SHIFL      ----------------------------------------------------------------------
RSUA_ECOLI      ----------------------------------------------------------------------
RSUA_ECOL6      ----------------------------------------------------------------------
RSUA_ECO57      ----------------------------------------------------------------------
RSUA_YERPE      ----------------------------------------------------------------------
RLUE_YERPE      ----------------------------------------------------------------------
RSUA_VIBVU      ----------------------------------------------------------------------
RLUE_XANAC      ----------------------------------------------------------------------
IF2_DESRM       ----------------------------------------------------------------------
Y129_BORBU      ----------------------------------------------------------------------
RSUA_VIBPA      ----------------------------------------------------------------------
NIPBL_MOUSE     ----------------------------------------------------------------------
Y612_SYNY3      ----------------------------------------------------------------------
YTZF_BACSU      ----------------------------------------------------------------------
RSUA_VIBCH      ----------------------------------------------------------------------
NIPBL_HUMAN     ----------------------------------------------------------------------
Y554_AQUAE      ----------------------------------------------------------------------
IF2_CLOPH       ----------------------------------------------------------------------
IF2_DESHY       ----------------------------------------------------------------------
RSUA_HAEIN      RPLTQSEIEKLVK---------------------------------------------------------
RSUA_PASMU      ----------------------------------------------------------------------
RLUD_YERPE      ----------------------------------------------------------------------
RLUD_VIBCH      ----------------------------------------------------------------------
RS4_NOCSJ       ----------------------------------------------------------------------
RLUD_SALTY      ----------------------------------------------------------------------
RLUD_SALTI      ----------------------------------------------------------------------
RLUD_VIBVU      ----------------------------------------------------------------------
SANT_PLAFW      ----------------------------------------------------------------------
RS4_CORGL       ----------------------------------------------------------------------
RS4_CORGB       ----------------------------------------------------------------------
Y955_SYNY3      ----------------------------------------------------------------------
RS4_HALOH       ----------------------------------------------------------------------
RS4_CLOTH       ----------------------------------------------------------------------
RS4_COREF       ----------------------------------------------------------------------
RS4_RHOSR       ----------------------------------------------------------------------
RS4_RHOOB       ----------------------------------------------------------------------
RS4_RHOE4       ----------------------------------------------------------------------
FA83H_MOUSE     ----------------------------------------------------------------------
RS4_GLOVI       ----------------------------------------------------------------------
RS4_CORJK       ----------------------------------------------------------------------
RS4_CLOD6       ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxx
Y321_RICBR      -------------------------
Y544_RICFE      -------------------------
Y807_RICCN      -------------------------
Y544_RICPR      -------------------------
Y532_RICTY      -------------------------
RLUB_PSEAE      -------------------------
RLUB_PASMU      -------------------------
RLUB_HAEIN      -------------------------
RLUB_YERPE      -------------------------
RLUB_SHIFL      -------------------------
RLUB_ECOLI      -------------------------
RLUB_ECO57      -------------------------
RLUB_ECOL6      -------------------------
RLUB_SALTY      -------------------------
RLUB_SALTI      -------------------------
Y361_SYNY3      -------------------------
RLUB_VIBPA      -------------------------
RLUB_VIBCH      -------------------------
Y1464_AQUAE     -------------------------
RLUB_VIBVU      -------------------------
RLUB_BUCAP      -------------------------
RLUB_XYLFT      -------------------------
RLUB_XYLFA      -------------------------
RLUB_XANCP      -------------------------
RLUB_XANAC      -------------------------
RLUB_BUCAI      -------------------------
Y1738_MYCBO     -------------------------
Y1711_MYCTU     -------------------------
RLUB_BUCBP      -------------------------
RLUB_BACSU      -------------------------
RLUE_PASMU      -------------------------
RLUE_VIBVU      -------------------------
Y1370_MYCLE     -------------------------
RSUA_PSEAE      -------------------------
RLUE_PSEAE      -------------------------
RLUE_VIBCH      -------------------------
RLUE_VIBPA      -------------------------
RLUE_HAEIN      -------------------------
RLUE_ECOLI      -------------------------
RLUE_ECO57      -------------------------
RLUE_ECOL6      -------------------------
RLUE_SHIFL      -------------------------
RLUF_ECOLI      -------------------------
RLUF_ECOL6      -------------------------
RLUF_ECO57      -------------------------
YE59_HELPJ      -------------------------
RLUF_SHIFL      -------------------------
RLUF_SALTI      -------------------------
RLUE_SALTY      -------------------------
RLUF_SALTY      -------------------------
Y1459_HELPY     -------------------------
RLUE_XANCP      -------------------------
RLUE_SALTI      -------------------------
RSUA_SALTY      -------------------------
RSUA_SALTI      -------------------------
RSUA_SHIFL      -------------------------
RSUA_ECOLI      -------------------------
RSUA_ECOL6      -------------------------
RSUA_ECO57      -------------------------
RSUA_YERPE      -------------------------
RLUE_YERPE      -------------------------
RSUA_VIBVU      -------------------------
RLUE_XANAC      -------------------------
IF2_DESRM       -------------------------
Y129_BORBU      -------------------------
RSUA_VIBPA      -------------------------
NIPBL_MOUSE     -------------------------
Y612_SYNY3      -------------------------
YTZF_BACSU      -------------------------
RSUA_VIBCH      -------------------------
NIPBL_HUMAN     -------------------------
Y554_AQUAE      -------------------------
IF2_CLOPH       -------------------------
IF2_DESHY       -------------------------
RSUA_HAEIN      -------------------------
RSUA_PASMU      -------------------------
RLUD_YERPE      -------------------------
RLUD_VIBCH      -------------------------
RS4_NOCSJ       -------------------------
RLUD_SALTY      -------------------------
RLUD_SALTI      -------------------------
RLUD_VIBVU      -------------------------
SANT_PLAFW      -------------------------
RS4_CORGL       -------------------------
RS4_CORGB       -------------------------
Y955_SYNY3      -------------------------
RS4_HALOH       -------------------------
RS4_CLOTH       -------------------------
RS4_COREF       -------------------------
RS4_RHOSR       -------------------------
RS4_RHOOB       -------------------------
RS4_RHOE4       -------------------------
FA83H_MOUSE     -------------------------
RS4_GLOVI       -------------------------
RS4_CORJK       -------------------------
RS4_CLOD6       -------------------------