[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38555.1

[Show Plain Result]


## Summary of Sequence Search
    1::467
   55::534     4e-54  34%  546 aa  CCD_CROSA RecName: Full=Carotenoid cleavage dioxygenase;       
   54::532     6e-54  33%  543 aa  CCD1_PHAVU RecName: Full=Carotenoid cleavage dioxygenase 1;        
   51::527     8e-54  34%  538 aa  CCD1_ARATH RecName: Full=Carotenoid cleavage dioxygenase 1;        
   51::530     2e-51  34%  541 aa  CCD1_PEA RecName: Full=Carotenoid cleavage dioxygenase 1;       
  112::594     1e-46  36%  604 aa  NCED1_MAIZE RecName: Full=9-cis-epoxycarotenoid dioxygenase 1,
  113::587     1e-45  35%  595 aa  CCD4_ARATH RecName: Full=Probable carotenoid cleavage dioxygenase
  145::606     2e-45  31%  615 aa  NCED1_PHAVU RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED1,
  186::647     5e-42  30%  657 aa  NCED9_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED9,
  104::568     1e-40  32%  577 aa  NCED6_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED6,
  116::580     7e-40  30%  589 aa  NCED5_ARATH RecName: Full=Probable 9-cis-epoxycarotenoid
  126::591     9e-40  30%  599 aa  NCED3_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED3,
  109::574     4e-37  29%  583 aa  NCED2_ARATH RecName: Full=9-cis-epoxycarotenoid dioxygenase NCED2,
   11::360     7e-26  31%  369 aa  ZCD_CROSA RecName: Full=Zeaxanthin cleavage dioxygenase,
   24::530     2e-18  29%  532 aa  BCDO2_MOUSE RecName: Full=Beta,beta-carotene 9',10'-oxygenase;     
   24::349     9e-18  31%  557 aa  BCDO2_PONAB RecName: Full=Beta,beta-carotene 9',10'-oxygenase;     
   47::577     4e-17  28%  579 aa  BCDO2_HUMAN RecName: Full=Beta,beta-carotene 9',10'-oxygenase;     
   24::554     2e-16  28%  556 aa  BCDO2_MACFA RecName: Full=Beta,beta-carotene 9',10'-oxygenase;     
   95::567     1e-14  30%  570 aa  CCD8_ARATH RecName: Full=Carotenoid cleavage dioxygenase 8,
   20::332     1e-14  30%  547 aa  BCDO1_HUMAN RecName: Full=Beta,beta-carotene 15,15'-monooxygenase; 
   20::332     3e-13  29%  566 aa  BCDO1_RAT RecName: Full=Beta,beta-carotene 15,15'-monooxygenase;   
   20::332     5e-13  27%  566 aa  BCDO1_MOUSE RecName: Full=Beta,beta-carotene 15,15'-monooxygenase; 
   20::331     8e-12  25%  526 aa  BCDO1_CHICK RecName: Full=Beta,beta-carotene 15,15'-monooxygenase; 
   80::617     1e-08  30%  618 aa  CCD7_ARATH RecName: Full=Carotenoid cleavage dioxygenase 7,
   30::328     4e-08  30%  533 aa  RPE65_CHICK RecName: Full=Retinal pigment epithelium-specific 65
   30::328     5e-08  30%  533 aa  RPE65_AMBTI RecName: Full=Retinal pigment epithelium-specific 65
   30::328     9e-08  31%  533 aa  RPE65_CYNPY RecName: Full=Retinal pigment epithelium-specific 65
   30::328     1e-06  27%  533 aa  RPE65_MOUSE RecName: Full=Retinal pigment epithelium-specific 65
   30::328     2e-06  28%  533 aa  RPE65_RAT RecName: Full=Retinal pigment epithelium-specific 65 kDa
   30::328     3e-06  27%  533 aa  RPE65_CANFA RecName: Full=Retinal pigment epithelium-specific 65
   30::263     4e-06  29%  533 aa  RPE65_HUMAN RecName: Full=Retinal pigment epithelium-specific 65
   30::263     4e-06  29%  533 aa  RPE65_CERAE RecName: Full=Retinal pigment epithelium-specific 65
   30::263     4e-06  29%  533 aa  RPE65_BOVIN RecName: Full=Retinal pigment epithelium-specific 65
    1::467

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxQVTGIPDACDNLAPIPMECDAPSLPIKGELPRELNGTLYRNGANPQFASPNAHWFFGDGMLHAFRLEN
CCD_CROSA       ------------NFAPVVDETPCPDLPVRGHLPECLNGEFVRVGPNPKFMPAGYHWFDGDGMIHGMRIKD
CCD1_PHAVU      ------------NFGPVTETPPTKDLPVKGHLPDCLNGEFVRVGPNPKFAPAGYHWFDGDGMIHGLRIKD
CCD1_ARATH      ------------NFAPIRDETPVKDLPVHGFLPECLNGEFVRVGPNPKFAVAGYHWFDGDGMIHGVRIKD
CCD1_PEA        ------------NFAPVKDETPVKDLTVQGHLPDCLNGEFVRVGPNPKF-SPVAHWFDGDGMIHGLRIKD
NCED1_MAIZE     -----GLPSTADNFAPVGERPPVHELPVSGRIPPFIDGVYARNGANPCFDPVAGHHLFGDGMVHALRIRN
CCD4_ARATH      -----------DNFAPVPTDCEI----IHGTLPLSLNGAYIRNGPNPQFLPRGPHLFDGDGMLHAIKIHN
NCED1_PHAVU     ------------NFAPVPEHAADQALPVVGKIPKCIDGVYVRNGANPLYEPVAGHHFFGDGMVHAVKFTN
NCED9_ARATH     ------------NFFPVPEKPVVHNLPVTGTVPECIQGVYVRNGANPLHKPVSGHHLFGDGMVHAVRFDN
NCED6_ARATH     ------------NFAPVN-ECPVQNLEVVGQIPSCLKGVYIRNGANPMFPPLAGHHLFGDGMIHAVSIGD
NCED5_ARATH     ------------NYAPVPEQSVKSSLSVDGKIPDCIDGVYLRNGANPLFEPVSGHHLFGDGMVHAVKITN
NCED3_ARATH     ------------NFAPVNEQPVRRNLPVVGKLPDSIKGVYVRNGANPLHEPVTGHHFFGDGMVHAVKFEH
NCED2_ARATH     ------------NYSPVPESSVRRNLTVEGTIPDCIDGVYIRNGANPMFEPTAGHHLFGDGMVHAVKITN
ZCD_CROSA       ----------------------------------------------------------------------
BCDO2_MOUSE     ----------------------AVSARVRGHIPEWLNGYLLRVGPGKEFGKDRYHWFDGMALLHQFRMER
BCDO2_PONAB     --QCRGLPCVAPLLTTVEEAPRGISARVRGHFPKWLNGSLLRTGPGKEFGKDKYHWFDGMALLHQFRMAK
BCDO2_HUMAN     --QCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKEFGKDKYHWFDGMALLHQFRMAK
BCDO2_MACFA     --QCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGPGKEFGKDKYHWFDGMALLHQFRMAK
CCD8_ARATH      -------------------------LTVQGKIPTWLNGTYLRNGPGLWNIGDHRHLFDGYSTLVKLQFDG
BCDO1_HUMAN     ---------------------------VTGKIPAWLQGTLLRNGPGMHTVGESRHWFDGLALLHSFTIRD
BCDO1_RAT       ---------------------------VTGSIPAWLQGTLLRNGPGMHTVGDSKHWFDGLALLHSFSIRD
BCDO1_MOUSE     ---------------------------VTGSIPAWLQGTLLRNGPGMHTVGESKHWFDGLALLHSFSIRD
BCDO1_CHICK     ---------------------------VQGQLPTWLQGVLLRNGPGMHTIGDTKHWFDGLALLHSFTFKN
CCD7_ARATH      --------------------------PIEGSIPVNFSGTYYLAGPGTDDHGSTVHPLDGHGYLRAFHIDG
RPE65_CHICK     ---------------------------VTGRIPTWLRGSLLRCGPGEVGAEPFYHLFDGQALLHKFDFKE
RPE65_AMBTI     ---------------------------VTGRIPVWLSGSLLRCGGSEQFY----HLFDGQALLHKFEFKG
RPE65_CYNPY     ---------------------------VTGRIPVWLTGSLLRCGGSEQFY----HLFDGQALLHKFDFKE
RPE65_MOUSE     ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE
RPE65_RAT       ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE
RPE65_CANFA     ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE
RPE65_HUMAN     ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE
RPE65_CERAE     ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE
RPE65_BOVIN     ---------------------------VTGRIPLWLTGSLLRCGPGEVGSEPFYHLFDGQALLHKFDFKE


                         .         .         *         .         .         .         .:140
query           GRASYRNRWVRTPKWLAEHAAGRPLYGEFNLKLPDAPRSAPDDGNVANTNIVFHAGRLLALEEAHLPIEI
CCD_CROSA       GKATYASRYVKTSRLKQEEYFEGPLKGFFGLQLLRAKLKVIDVSGTGNTALIYHHGKLLALSEADKPYVV
CCD1_PHAVU      GKATYVSRFVETSRLKQEEYFGRSLKGLFGLLMVNIHMLRTKGGGTTNTALVYHHGKLLALSEADKPYAI
CCD1_ARATH      GKATYVSRYVKTSRLKQEEFFGAALKGFFGLLMVNVQQLRTKGNGTANTALVYHHGKLLALQEADKPYVI
CCD1_PEA        GKASYVSRFVKTSRFKQEEYFNKGLFGLLNMQMLRAKLKILDVSGTANTALVYHHQKLLALSEGDKPYAI
NCED1_MAIZE     GAASYACRFTETARLRQERAIGRPVFGIARLALFYARAACPSAGGVANAGLVYFNGRLLAMSEDDLPYHV
CCD4_ARATH      GKATLCSRYVKTYKYNVEKQTGAPVFSGFNGVTASVARGAPVNGGLANTSLAFFSNRLFALGESDLPYAV
NCED1_PHAVU     GAASYACRFTETQRLAQEKSLGRPVFGELHFQLVDGSHGM----GVANAGLVYFNNHLLAMSEDDLPYHV
NCED9_ARATH     GSVSYACRFTETNRLVQERECGRPVFGELHGHLGIAKLMLPTGGGVANAGLVYFNGHLLAMSEDDLPYHV
NCED6_ARATH     NQVSYSCRYTKTNRLVQETALGRSVFGELHIGLVDGTRGM----GVANAGVVFFNGRLLAMSEDDLPYQV
NCED5_ARATH     GDASYSCRFTETERLVQEKQLGSPIFPKAIGELHGHSGIAKNGTGVANAGLVYFHDRLLAMSEDDLPYQV
NCED3_ARATH     GSASYACRFTQTNRFVQERQLGRPVFGIARLMLFYARAAAPAHGGVANAGLVYFNGRLLAMSEDDLPYQV
NCED2_ARATH     GSASYACRFTKTERLVQEKRLGRPVF-------PKAIGELHGHSGIARLMLFYARGRLLAMSEDDLPYQL
ZCD_CROSA       ---------------------------------------------LANTSLQFSNGRLHALCEYDLPYVV
BCDO2_MOUSE     GTVTYKSKFLQSDTYKANSAGGRIVISEFTLALPDPCKSPPTMTDNTNVNFVQYKGDYYMSTETNFMNKV
BCDO2_PONAB     GTVTYRSKFLQSDTYKANSAKNRIVISEFTLALPDLPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKV
BCDO2_HUMAN     GTVTYRSKFLQSDTYKANSAKNRIVISEFTLALPDLPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKV
BCDO2_MACFA     GTVTYRSKFLQSDTYKANSAKNRIVMSEFTLATPDLPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKV
CCD8_ARATH      GRIFAAHRLLESDAYKAAKKHNRLCYREFS----ETPKSVIINKNPANTGVILGDGRVMCLTETQKSILV
BCDO1_HUMAN     GEVYYRSKYLRSDTYNTNIEANRIVVSEFTMAYPDLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKI
BCDO1_RAT       GEVFYRSKYLQSDTYNANIEANRIVVSEFTMAYPDLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKI
BCDO1_MOUSE     GEVFYRSKYLQSDTYIANIEANRIVVSEFTMAYPDLSHTIPDFTDNCLINIMKCGEDFYATTETNYIRKI
BCDO1_CHICK     GEVYYRSKYLRSDTYNCNIEANRIVVSEFTMAYPDLSHTIPEFTDNCLINIMKTGDDYYATSETNFIRKI
CCD7_ARATH      NKATFTAKYVKTEAKKEEHDPVTDTWGPFSLKGGKRFGNTKVMKNVANTSVLKWAGRLLCLWEGGEPYEI
RPE65_CHICK     GHVTYHRRFVRTDAYVRAMTEKRIVITEFTYAYPDPCKNGVEVTDNALVNVYPVGEDYYACTETNFITKI
RPE65_AMBTI     GHVIYHRRFIRTDTYVRAMTEKRIVITEFTFAFPDPCKNGLEVTDNALVNVYPVGEDYYACTETNYITKI
RPE65_CYNPY     GHVTYHRRFIRTDTYVRAMTEKRIVITEFTFAFPDPCKNEVTDNTLVN---VYPVGEYYACTETNYITKV
RPE65_MOUSE     GHVTYHRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNIYPVGEDYYACTETNFITKI
RPE65_RAT       GHVTYYRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNIYPVGEDYYACTETNFITKI
RPE65_CANFA     GHVTYHRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNVYPVGEDYYACTETNFITKI
RPE65_HUMAN     GHVTYHRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNVYPVGEDYYACTETNFITKI
RPE65_CERAE     GHVTYHRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNVYPVGEDYYACTETNFITKI
RPE65_BOVIN     GHVTYHRRFIRTDAYVRAMTEKRIVITEFTCAFPDPCKNGVEVTDNALVNIYPVGEDYYACTETNFITKV


                         +         .         .         .         .         *         .:210
query           ERDTLATRGYCDYGGALKGPFTAHPKIDPVTGEMLFFGYNAAGPLKRTMSFGAIDASGHVTRFEYFKAPY
CCD_CROSA       EDGDLQTLGLLDYDKRLSHSFTAHPKVDPFTDEMFTFGYAHTPPY---VTYRVISKDGVMRDPVPITIPA
CCD1_PHAVU      EDGDLQTLGMLDYDKRLGHSFTAHPKVDPFTGEMFSFGYAHTPPY---ITYRVISKDGYMHDPVPITISD
CCD1_ARATH      EDGDLQTLGIIDYDKRLTHSFTAHPKVDPVTGEMFTFGYSHTPPY---LTYRVISKDGIMHDPVPITISE
CCD1_PEA        EDGDLQTLGMLDYDKRLGHNFTAHPKVDPFTGEMFTFGYSHTAPY---VTYRVISKDGFMQDPVPITISD
NCED1_MAIZE     DDGDLETVGRYDFDGQLGCAMIAHPKLDPATGELHALSYDV---IKRPLKYFYFRPDGTKSDDVEIPLEQ
CCD4_ARATH      ESGDIETIGRYDFDGKLAMSMTAHPKTDPITGETFAFRY---GPVPPFLTYFRFDSAGKKQRVPIFSMTS
NCED1_PHAVU     SNGDLTTVGRYDFNGQLNSTMIAHPKLDPVNGDLHALSYDVV--QKPYLKYFRFSADGVKSPDVEIPLKE
NCED9_ARATH     QTGDLETSGRYDFDGQLKSTMIAHPKIDPETRELFALSYDVVS--KPYLKYFRFTSDGEKSPDVEIPLDQ
NCED6_ARATH     KIDDLETIGRFGFDDQIDSSVIAHPKVDATTGDLHTLSYNVLK--KPHLRYLKFNTCGKKTRDVEITLPE
NCED5_ARATH     DNGDLETIGRFDFDGQLSSAMIAHPKIDPVTKELFALSYDVV--KKPYLKYFKFSPEGEKSPDVEIPLAS
NCED3_ARATH     QNGDLKTVGRFDFDGQLESTMIAHPKVDPESGELFALSYDVVS--KPYLKYFRFSPDGTKSPDVEIQLDQ
NCED2_ARATH     QTGDLQTVGRYDFDGQLKSAMIAHPKLDPVTKELHALSYDVVK--KPYLKYFRFSPDGVKSPELEIPLET
ZCD_CROSA       EDGDISTVGRIENNVSTKST-TAHPKTDPVTGETFSFSY---GPIQPYVTYSRYDCDGKKSGPDVFKEP-
BCDO2_MOUSE     DIEMLERTEKVDWSKAVNGA-TAHPHYDPGTAYNMGNSYGPRGPPKKKEPGETIHGAQVLCSIASTEKMK
BCDO2_PONAB     DIETLEKTEKVDWSKAVNGA-TAHPHYDP-DGTAYNMG-NSFGPLGETIHGAQVICS--IASTEKGKPSY
BCDO2_HUMAN     DIETLEKTEKVDWSKAVNGA-TAHPHYDP-DGTAYNMG-NSFGPVDLGETIHGVQVICSIASTEKGKPSY
BCDO2_MACFA     DIETLEKTEKVDWSKAVNGA-TAHPHYDP-DGTAYNMG-NSFGPLEETTHGAQVICS--IAPTEKGKPSY
CCD8_ARATH      DHETLETIGKFEYDDVLSDHMSAHPIVTELIPDLVKPGYRVAGSNKR-------EVVGRVRCRSGSWGP-
BCDO1_HUMAN     NPQTLETLEKVDYRKYVANLATSHPHYDE-AGNVLNMGTSGKSPWKHTEVFCSIPSRSLLSPSYY-----
BCDO1_RAT       DPQTLETLEKVDYRKYVANLATSHPHYDE-AGNVLNMGTSIANPLKHSEVFCSIPSRSLLSPSYY-----
BCDO1_MOUSE     DPQTLETLEKVDYRKYVANLATSHPHYDE-AGNVLNMGTSVVDKIPATVPDSKKKGKSPVKHAEVFXXXX
BCDO1_CHICK     DPQTLETLDKVDYSKYVANLATSHPHYDS-AGNILNMGTSIVDKGRTKYVLFKIPSSXXXSCFKHLEVPS
CCD7_ARATH      ESGSLDTVGRCEXXGVFKMPFLSHYKVDGRRKRLLTVTCNAEDMLRSNFTFCEYDSEFKLIQTKEFKIDD
RPE65_CHICK     NPDTLETCKYVSVNGA-----TAHPHVENCFGKNFSLAYNIIRPPLQADKEDPMNKSEVVVQFDRFKPSY
RPE65_AMBTI     NPETLETVDLCNY-VSING-VTAHPHIENCFGKHFAFAYNIVKPPLQADKEDPINKAKVVVQFERFKPSY
RPE65_CYNPY     NPETLETVDLCNY-VSING-VTAHPLIENCFGKHFSFAYNIVPPLQEDKE-DPINKAKVVVQFERFKPSY
RPE65_MOUSE     NPETLETIKQVDLCNYISNGATAHPHIESCFGKNFTVAYNKIPPLKADKE-DPINKSEVVVQFDRFKPSY
RPE65_RAT       NPETLETCNYVSVNGA-----TAHPHIESCFGKNFTVAYNKIPPLKADKE-DPINKSEVVVQFDRFKPSY
RPE65_CANFA     NPETLETCNYVSVNGA-----TAHPHIENCFGKNFSIAYNIVKPPLQADKEDPISKSEVVVQFDRFKPSY
RPE65_HUMAN     NPETLETCNYVSVNGA-----TAHPHIENCFGKNFSIAYNIVKPPLQADKEDPISKSEIVVQFDRFKPSY
RPE65_CERAE     NPETLETCNYVSVNGA-----TAHPHIENCFGKNFSIAYNIVKPPLQADKEDPISKSEIVVQFDRFKPSY
RPE65_BOVIN     NPETLETCNYVSVNGA-----TAHPHIENCFGKNFSIAYNIVKPPLQADKEDPISKSEIVVQFDRFKPSY


                         .         .         .         +         .         .         .:280
query           AAMVHDFIVTENYVLFPILPLTGSIWRAMRGRPPYAWDPGKGSYVGVMKRTGTTRDIRWFRGDACFVFHV
CCD_CROSA       SVMMHDFAITENYSIFMDLPLYFQPKEMVKGKLIFSFDATKKARFGVLPRYAKDDSIRWFELPNCFIFHN
CCD1_PHAVU      PIMMHDFAITENYAVFMDLPLIFRPKEMVKNKTIFSFDSTKKARFGVLPRAKDEQHIRWFELPNCFIFHN
CCD1_ARATH      PIMMHDFAITETYAIFMDLPMHFRPKEMVKEKKMYSFDPTKKARFGVLPRYAKDEMIRWFELPNCFIFHN
CCD1_PEA        PVMMHDFAITENYSIFMDLPLYFRPKEMVKNKTIFSFDSTKKARFGVLPRAKDDKHIRWFELPNCFIFHN
NCED1_MAIZE     PTMIHDFAITENLVVVPDHQVVFKLQEMLRGGSPVVLDKEKTSRFGVLKHAADASEMAWVDVPDCFCFHL
CCD4_ARATH      PSFLHDFAITKRHAIFAEIQLMNMLDLVLEGGSPVGTDNGKTPRLGVIKYAGDESEMKWFEVPGFNIIHA
NCED1_PHAVU     PTMMHDFAITENFVVVPDQQVVFKLTEMITGGSPVVYDKNKTSRFGILKNAKDANAMRWIDAPECFCFHL
NCED9_ARATH     PTMIHDFAITENFVVIPDQQVVFRLPEMIRGGSPVVYDEKKKSRFGILKNAKDASSIQWIEVPDCFCFHL
NCED6_ARATH     PTMIHDFAITENFVVIPDQQMVFKLSEMIRGGSPVIYVKEKMARFGVLKQDLTGSDINWVDVPDCFCFHL
NCED5_ARATH     PTMMHDFAITENFVVIPDQQVVFKLSDMFLGKSPVKYDGEKISRFGILPRNADASEMVWVESPETFCFHL
NCED3_ARATH     PTMMHDFAITENFVVVPDQQVVFKLPEMIRGGSPVVYDKNKVARFGILKYAEDSSNIKWIDAPDCFCFHL
NCED2_ARATH     PTMIHDFAITENFVVIPDQQVVFKLGEMISGKSPVVFDGEKVSRLGIMPKDATASQIIWVNSPETFCFHL
ZCD_CROSA       -SFVHDFAITEHYAVFPDIQIVMKPAEIVRGRRMIGPDLEKVPRLGLLPRYATSSEMRWFDVPGFNMVHV
BCDO2_MOUSE     PSYYHSFGMTKNYIIFVEQPVKMKLWKKIRGKPGISWEPQYNTRFHVVKHTGQLLPGMYY-SMPFLTYHQ
BCDO2_PONAB     ---YHSFGMTRNYIIFIEQPLKMNLWKKIRGKDGISWEPQCNTWFHVVKRTGQLLPGRYY-SKPFVTFHQ
BCDO2_HUMAN     ---YHSFGMTRNYIIFIEQPLKMNLWKKIRGKDGISWEPQCNTRFHVVKRTGQLLPGRYY-SKPFVTFHQ
BCDO2_MACFA     ---YHSFGMTRNYIIFIEQPLKMNLWKKIRGKDGISWEPQCNTRFHVVKHTGQLLPGRYY-SKPFVAFHH
CCD8_ARATH      -GWVHSFAVTENYVVIPEMPLRYSVKNLLRAEPKFEWCPQDGAFIHVMSKL-TGEVVASVEVPAYVTFHF
BCDO1_HUMAN     ----HSFGVTENYVIFDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFYTDAMVVFHH
BCDO1_RAT       ----HSFGVTENYVVFDILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFYTDPMVVFHH
BCDO1_MOUSE     XXXXXXFGVTENYVVFDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFYTDPMVVFHH
BCDO1_CHICK     RSLLHSFGITENYIVFDIVKLATAYIRGVNWASCLSFHKEDKTWFHFVDRKTKKEVSTKFYTDALVLYHH
CCD7_ARATH      HMMIHDWAFTDHYILFAKLNPIGSI-AAMCGMSPLSLNPNESSPIYILPRFSDSRGGRDWRSSQLWLIHS
RPE65_CHICK     ---VHSFGLTPNYIVFVETPVSWSLWGA-NYMDCFESNETMGVWLHVAKKKGRLLNIK-YRTSAFNLFHH
RPE65_AMBTI     ---VHSFGLTPNYIVFVEQPVKINLFKFLS-----SWSIWGANYMDCFKHTGEYLNIK-YRTSAFNLFHH
RPE65_CYNPY     ---VHSFGLTPNYIVFVEQPVKINLFKFLS-----SWSIWGANYMDCFKLTGEYLNIK-YRTSAFNLFHH
RPE65_MOUSE     ---VHSFGLTPNYIVFVETPVSWSLWGA-NYMDCFESNESMGVWLHVADXXXXXXXXXXXXTSPFNLFHH
RPE65_RAT       ---VHSFGLTPNYIVFVETPVSWSLWGA-NYMDCFESNESMGVWLHVADXXXXXXXXXXXXTSPFNLFHH
RPE65_CANFA     ---VHSFGLTPNYIVFVETPVSWSLWGA-NYMDCFESNETMGVWLHIADXXXXXXXXXXXXTSSFNLFHH
RPE65_HUMAN     ---VHSFGLTPNYIVFVETPVKINLFK-------------------------------------------
RPE65_CERAE     ---VHSFGLTPNYIVFVETPVKINLFK-------------------------------------------
RPE65_BOVIN     ---VHSFGLTPNYIVFVETPVKINLFK-------------------------------------------


                         .         *         .         .         .         .         +:350
query           MNAWEDGTKIVADVMQSEEAPLFTHPDGRRTDPEKGRARLCRWSFDLAGNTNAFKRSYLDDISGEFPRID
CCD_CROSA       ANAWEEGDEVVLITCRLENPDLDMVNGAVKEKLENFKNELYEMRFNM--KTGAASQKQLSVSAVDFPRIN
CCD1_PHAVU      ANAWEEEDEVVLITCRLQNPKLDNVGGTVQEKLENFSNELYEMRFNM--KTGEASQKKLSASTVDFPRVN
CCD1_ARATH      ANAWEEEDEVVLITCRLENPDLDMVSGKVKEKLENFGNELYEMRFNM--KTGSASQKKLSASAVDFPRIN
CCD1_PEA        ANAWEEEDEIVLITCRLENPNLDVVGGAVKEKLDNFSNELYEMRFNM--KTGEASQKKLSASTVDFPRVN
NCED1_MAIZE     WNAWEDGEVVVIGSCMTPADSIFNESDERRLDARTGRST---------------RRAVLQQVNLEVGMVN
CCD4_ARATH      INAWDDGNSVVL------IAPNIMSIEHTLERMDLVHALVEKVKIDLV--TGIVRRHPISARNLDFAVIN
NCED1_PHAVU     WNAWEDEIVVIGSCMTPADS-IFNECD----ESLKSVLSEIRLNLRTGKSTRRPIISDAEQVNLEAGMVN
NCED9_ARATH     WNSWEEPETDEVVVIGS----CMTPPDSIFNEDETLQSVLSEIRLNLKTGESTRRPVISEQVNLEAGMVN
NCED6_ARATH     WNAWEERTEVVIGSCMSPPDTIFSE-SGEPTRVELSEIRL------NMRTKESNRKVIVTGVNLEAGHIN
NCED5_ARATH     WNAWEDEVVVIGSCMTPADS-IFNECD------EQLNSVLSEIRLNLKTGKST-RRTIIPQMNLEAGMVN
NCED3_ARATH     WNAWEEPETDEVVVIGS----CMTPPDSIFNESDENLKSVIRLNLKTGESTRRPIISNEDQVNLEAGMVN
NCED2_ARATH     WNAWESPETVVIGSCMSPADSIFNERD------ESLRSVLSEIRINXXXXXXXXXXXXVEDVNLEIGMVN
ZCD_CROSA       VNAWXXXXXXXXXXXAPNVSPIENAID---------RFDLLHVSVEMARKSGSVSRTLLSAENLDFGVIH
BCDO2_MOUSE     INAFEDQGCIVIDLCCQDDGDLYQLQNLRKAGEGKAKSFPRRFSVDAAEGKNLSPLSYLEEEGGEFPQIN
BCDO2_PONAB     INAFEDQGCVIIDL--------------------------------------------------------
BCDO2_HUMAN     INAFEDQGCVIIDLCCQDNGRTLVHNSAAKSFPRRFVLPL-NVSLNAPEGDNLSPLSYTEDLEKEFPQIY
BCDO2_MACFA     INAFEDQGCVIIDLCCQDNGRILLRKAGEELDQSAGRSFPRRFVLPLNVSLNAPEGDNLSPLSSAVKQAD
CCD8_ARATH      INAYEEATVIIADILDMLRLDTLRSSHGHDVLPD---ARIGRFRIPLDGSVEAEKHGRAMDMCSINP---
BCDO1_HUMAN     VNAYEEDGCIVFDVIAYEDNSLY-----------------------------------------------
BCDO1_RAT       VNAYEEDGCVLFDVIAYEDNSLY-----------------------------------------------
BCDO1_MOUSE     VNAYEEDGCVLFDVIAYEDSSLY-----------------------------------------------
BCDO1_CHICK     INAYEEDGHVVFDIVAYRDNSLY-----------------------------------------------
CCD7_ARATH      GNAYEDNGDLKIQIQASDFQKMFGYDQSNKLDPNRGDDKLVSMTLDSTGNCNSCDVEPLNNKPSDFPVIN
RPE65_CHICK     INTFEDNGFLIVDL--------------------------------------------------------
RPE65_AMBTI     INTYEDHGFLIVDL--------------------------------------------------------
RPE65_CYNPY     INTYEDHGFLIVDL--------------------------------------------------------
RPE65_MOUSE     INTYEDNGFLIVDL--------------------------------------------------------
RPE65_RAT       INTYEDNGFLIVDL--------------------------------------------------------
RPE65_CANFA     INTYEDNEFLIVDL--------------------------------------------------------
RPE65_HUMAN     ----------------------------------------------------------------------
RPE65_CERAE     ----------------------------------------------------------------------
RPE65_BOVIN     ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ERRAGLRSGHGWYACASPETPMLGMLTGLVHVDGNGHRRARYLLPTGDTIGEPVFVPRKPDSAEADGWLL
CCD_CROSA       ESYTTRKQRYVYGTILDNITKVKGIIAGKKKLEVGGNVQGIFDLGPGRYGSEAVFVPRERKSEEDDGYLI
CCD1_PHAVU      ENYTGRKQRYVYGTTLDSIAKVTGIIKFDLHAEPDGNVQGLYDLGPGKFGSEAVYIPRVPESEEDDGYLV
CCD1_ARATH      ECYTGKKQRYVYGTILDSIAKVTGIITGKRMLEVGGNIKGIYDLGEGRYGSEAIYVPRE-TAEEDDGYLI
CCD1_PEA        ESYTGRKQRYVYGTTLDSIAKVTGIISGKTKLEVGGNVQGLYDLGPGRFGSEAVYVPRVPDSEEDDGYLI
NCED1_MAIZE     RNLLGRETRYAYLAVAEP----WPKVSGFAKVDLSTGELTKFEYGEGRFGGEPCFVPMDPAAAEDDGYVL
CCD4_ARATH      PAFLGRCSRYVYAAIGDP----MPKISGVVKLDVSKGDRARRMYGSGCYGGEPFFVARDPGNPEADGYVV
NCED1_PHAVU     RNKLGRKTQFAYLALAEP----WPKVSGFAKVDLFSGEVQKYMYGEEKFGGEPLFLPNGEE--EGDGYIL
NCED9_ARATH     RNLLGRKTRYAYLALTEP----WPKVSGFAKVDLSTGEIRXXXXXXXXXXXXPLFLP-SGDGEEDGGYIM
NCED6_ARATH     RSYVGRKSQFVYIAIADP----WPKCSGIAKVDIQNGTVSEFNYGPSRFGGEPCFVP-EGEGEEDKGYVM
NCED5_ARATH     RNLLGRKTRYAYLAIAEP----WPKVSGFAKVDLSTGEVKNHFYGGKKYGGEPFFLPRGLESGEDDGYIM
NCED3_ARATH     RNMLGRKTKFAYLALAEP----WPKVSGFAKVDLTTGEVKKHLY--GDNYXXXXXXXXXXXXXXXXXYIL
NCED2_ARATH     RNRLGRKTRFAFLAIAYP----WPKVSGFAKVDLCTXXXXXXXXXXXXXXXXPFFLPGNSGNGEEDGYIF
ZCD_CROSA       RGYSGRKSRYAYLGVGDPMPKIRGVVKVDFELAGRGEVVARREFGVGCFGGEPFFVPKKSGGEEDDGYVV
BCDO2_MOUSE     YGRFNGKKYSFFYGCGFRH--LVG--DSLIKVDVT-NKTLRVWREEGFYPSEPVFVPVPGADEEDSGVIL
BCDO2_PONAB     ----------------------------------------------------------------------
BCDO2_HUMAN     YDRFSGKKYHFFYGCGFRH--LVG--DSLIKVD-VVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVIL
BCDO2_MACFA     EKEGGIEFPQIYYGQFSGKKYRFFYGCGFRHLVGDSNKTLKVWREDGFYPSEPVFVPVPGTNEEDGGVIL
CCD8_ARATH      -----LYLGQKYYACGAQRP--CNFPNALSKVD-IVEKKVKNWHEHGMIPSEPFFVPRPGATHEDDGVVI
BCDO1_HUMAN     ----------------------------------------------------------------------
BCDO1_RAT       ----------------------------------------------------------------------
BCDO1_MOUSE     ----------------------------------------------------------------------
BCDO1_CHICK     ----------------------------------------------------------------------
CCD7_ARATH      SSWSGKKNKYMYSAASSPHFPFFDLDSNLVRTWSTGARR---------FVGEPMFVPKEEGEEEDDGYIV
RPE65_CHICK     ----------------------------------------------------------------------
RPE65_AMBTI     ----------------------------------------------------------------------
RPE65_CYNPY     ----------------------------------------------------------------------
RPE65_MOUSE     ----------------------------------------------------------------------
RPE65_RAT       ----------------------------------------------------------------------
RPE65_CANFA     ----------------------------------------------------------------------
RPE65_HUMAN     ----------------------------------------------------------------------
RPE65_CERAE     ----------------------------------------------------------------------
RPE65_BOVIN     ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVIWRSCENRSDLAVFNAADIAGGPIALVQLGHRVPDGFHGNWVAAx
CCD_CROSA       FFVHDENTGKSEVNVIDAKTMSAEPVAVVELPNRVPYGFHAFFV---
CCD1_PHAVU      LFVHDENAGKSFVHVIDAKTMSADPVAVVELPNRVPYGFHAFFV---
CCD1_ARATH      FFVHDENTGKSCVTVIDAKTMSAEPVAVVELPHRVPYGFHALFV---
CCD1_PEA        FFVHDENTGKSFVHVIDAKRMSAEPVAVVELPQRVPYGFHAFFV---
NCED1_MAIZE     TFVHDERAGTSELLVVNAADMR--LEATVQLPSRVPFGFHGTFI---
CCD4_ARATH      TYVHDEVTGESKFLVMDAKSPELEIVAAVRLPRRVPYGFHGLFV---
NCED1_PHAVU     AFVHDEKEWKSELQIVNAQNLK--LEASIKLPSRVPYGFHGTFI---
NCED9_ARATH     VFVHDEEKVKSELQLINAVNMK--LEATVTLPSRVPYGFHGTFIS--
NCED6_ARATH     GFVRDEEKDESEFVVVDATDMK--QVAAVRLPERVPYGFHGTFVS--
NCED5_ARATH     SFVHDEESWESELHIVNAVTLE--LEATVKLPSRVPYGFHGTFV---
NCED3_ARATH     CFVHDEKTWKSELQIVNAVSLE--VEATVKLPSRVPYGFHGTFIGA-
NCED2_ARATH     CHVHDEETKTSELQIINAVNLK--LEATIKLPSRVPYGFHGTFV---
ZCD_CROSA       SYLHDEGKGESSFVVMDARSPELEILAEVVLPRRVPYGFHGLFV---
BCDO2_MOUSE     SVVITPNQSESNLLVLDAKSFT--ELGRAEVPVQMPYGFHGTFV---
BCDO2_PONAB     -----------------------------------------------
BCDO2_HUMAN     SVVITPNQNESNLLVLDAKNFE--ELGRAEVPVQMPYGFHGTFI---
BCDO2_MACFA     SVVITPNQNESNLLVLDAKNFE--ELGRAEVPVQMPYGFHGTFI---
CCD8_ARATH      SIV--SEENGGSFAILLDGS-SFEEIARAKFPYGLPYGLHGCWI---
BCDO1_HUMAN     -----------------------------------------------
BCDO1_RAT       -----------------------------------------------
BCDO1_MOUSE     -----------------------------------------------
BCDO1_CHICK     -----------------------------------------------
CCD7_ARATH      VVEYAVSVERCYLVILDAKKIGESDAVVSRLNLTFPMGFHGLWAS--
RPE65_CHICK     -----------------------------------------------
RPE65_AMBTI     -----------------------------------------------
RPE65_CYNPY     -----------------------------------------------
RPE65_MOUSE     -----------------------------------------------
RPE65_RAT       -----------------------------------------------
RPE65_CANFA     -----------------------------------------------
RPE65_HUMAN     -----------------------------------------------
RPE65_CERAE     -----------------------------------------------
RPE65_BOVIN     -----------------------------------------------