[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38586.1

[Show Plain Result]


## Summary of Sequence Search
    1::586
   94::579     e-114  43%  583 aa  PHBC_AZOC5 RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
  109::601     e-113  43%  605 aa  PHAC_METEX RecName: Full=Poly(3-hydroxyalkanoate) polymerase;      
  139::634     4e-99  37%  636 aa  PHBC_RHIET RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
  121::607     4e-98  37%  611 aa  PHBC_RHIME RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
   69::556     2e-91  37%  568 aa  PHAC_CHRVO RecName: Full=Poly(3-hydroxyalkanoate) polymerase;      
   99::551     7e-84  38%  589 aa  PHBC_RALEH RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
   70::558     7e-74  34%  560 aa  PHAC_PSEOL RecName: Full=Poly(3-hydroxyalkanoate) polymerase 2;    
   68::556     2e-70  33%  559 aa  PHAA_PSEOL RecName: Full=Poly(3-hydroxyalkanoate) polymerase 1;    
   36::342     8e-16  25%  355 aa  PHBC_CHRVI RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
   36::305     9e-15  24%  355 aa  PHBC_THIVI RecName: Full=Poly-beta-hydroxybutyrate polymerase;     
  199::333     2e-04  32%  492 aa  GATB_DEHE1 RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln)
    1::586

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PHBC_AZOC5      ----------------------------------------------------------------------
PHAC_METEX      ----------------------------------------------------------------------
PHBC_RHIET      ----------------------------------------------------------------------
PHBC_RHIME      ----------------------------------------------------------------------
PHAC_CHRVO      ----------------------------------------------------------------------
PHBC_RALEH      ----------------------------------------------------------------------
PHAC_PSEOL      ----------------------------------------------------------------------
PHAA_PSEOL      ----------------------------------------------------------------------
PHBC_CHRVI      ----------------------------------------------------------------------
PHBC_THIVI      ----------------------------------------------------------------------
GATB_DEHE1      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxSLITPQPQDRRFAGPEWRQPPFNLMAQSFLLAEEWWRDATTGIRGVSQQNAK
PHBC_AZOC5      ------------------------PKDGRFKDPEWESPFFDALKQTYLVTSNWAESMVKEAEGLDPHTKH
PHAC_METEX      -------------------VVQPPPTDKRFAHADWSNPVFDLIKQSYLLLGRWAEEMVETAEGIDEHTRH
PHBC_RHIET      --------------------LPPEPKDKRFSDEDWQKNPFDFLRQVYFVTSDWVDKLVSETDGLDEHTKH
PHBC_RHIME      -----------------------QRNDKRFADEDWKNPFFDFIRQAYFVTSDWAERMVRDAEGLDDHTRH
PHAC_CHRVO      -----------------------KPADRRFASPEWNEHPFNFLKQSYLQTSKWMMELVDKTQLDEDAKDK
PHBC_RALEH      --------------------------DRRFAGDAWRTNPYRFAAAFYLLNARALTELADAVEADAKTRQR
PHAC_PSEOL      --------------------LQPNPRDPRFSDPTWSQNPFYRRGLQAYLA--WQKQTRLWIEELDDDDRA
PHAA_PSEOL      ------------------SSLAPESDDRRFNDPAWSNNPYRRYLQTYLAWRKELQD-WIGNSDLSPQDIS
PHBC_CHRVI      ----------------------------------------------------------------------
PHBC_THIVI      ----------------------------------------------------------------------
GATB_DEHE1      -------------------------------------------------------DANISIRGSPELGAK


                         +         .         .         .         .         *         .:210
query           IVEFAMRQMLDVFAPSNFALTNPEVIRRTLTSEGGNVTAGLRNWWEDLLQTMSHDTDLKHDFEVGRDVAV
PHBC_AZOC5      KAEFLVRQLSNAVAPSNFLMTNPELIRETLSSSGENLVRGMKNLAEDLVEGKGRQTDMSA-FEVGRNLAL
PHAC_METEX      KAEFYLRQLLSAYSPSNFVMTNPELLRQTLEEGGANLMRGMKMLQEDLEQLRVRQTDLSA-FTFGKDVAV
PHBC_RHIET      KAGFYVKQITAALSPSNFIATNPQLYRETIASNGENLVRGMKMLAEDIAELRLRQTDMTK-FAVGRDMAL
PHBC_RHIME      KAAFYVRQIASALSPTNFITTNPQLYRETVASSGANLVKGMQMLAEDILRLRQTDTS---KFAIGENIAI
PHAC_CHRVO      LA-FATRQYLDAMSPSNFMLTNPDVVKRAIETKGESLVEGMKNMLDDFQKGHISMSD-ESKFEIGKNLVV
PHBC_RALEH      I-RFAISQWVDAMSPANFLATNPEAQRLLIESGGESLRAGVRNMMEDLTRGKISQTD-ESAFEVGRNVAV
PHAC_PSEOL      RAHFLFNLINDALAPSN-SLLNPLAVKELFNSGGQSLVRGVAHLLDDLRHNLPRQVD-ERAFEVGGNLAA
PHAA_PSEOL      RGQFVINLMTEAMAPTN-TLSNPAAVKRFFETGGKSLLDGLSNLAKDLVNNGGMPSQVNMDFEVGKNLGT
PHBC_CHRVI      ------------------------------------------------------------------DTGV
PHBC_THIVI      ------------------------------------------------------------------DTGV
GATB_DEHE1      VEVKNMNSFKAVFS----ALEYEEVRQRKMADEGKKISQETRGWQDDKCQTVSRSKEFAHDYRYFPEPDL


                         .         .         .         +         .         .         .:280
query           TPGKVVYSNDLIELIQYAPATGEVRPEPILIVPAWIMKYYILDLSPHNSLVKYLTEQGFTVFMVSWRNPT
PHBC_AZOC5      SPGKVIFETELMQLIQYAPSTPSVKKTPVLIVPPWINKFYILDLTPEKSLIKWMVDQGLTVFVISWVNPD
PHAC_METEX      TPGEVIFRNDLMELIQYAPTTETVLKRPLLIVPPWINKFYILDLNPQKSLIGWMVSQGITVFVISWVNPD
PHBC_RHIET      TPGKVIAQNDICQIIQYEASTETVLKRPLLICPPWINKFYILDLNPQKSFIKWCVDQGQTVFVISWVNPD
PHBC_RHIME      TPGKVIAQNDVCQVLQYEASTETVLKRPLLICPPWINKFYVLDLNPEKSFIKWAVDQGQTVFVISWVNPD
PHAC_CHRVO      TPGQVVFRNELIELIQYTPTTDKVYEKPLLFVPPCINKYYLMDLQPDNSMVRHFVAQGYRVFLISWRSAV
PHBC_RALEH      TEGAVVFENEYFQLLQYKPLTDKVHARPLLMVPPCINKYYILDLQPESSLVRHVVEQGHTVFLVSWRNPD
PHAC_PSEOL      TAGAVVFRNELLELIQYKPMSEKQHARPLLVVPPQINKFYIFDLSSTNSFVQYMLKNGLQVFMVSWRNPD
PHAA_PSEOL      SEGAVVYRNDVLELIQYKPITEQVHARPLLVVPPQINKFYVFDLSPEKSLARYCLRSQQQTFIISWRNPT
PHBC_CHRVI      SPKQAVYSEDKLVLYRYDRPEGEAQPVPLLIVYALVNRPYMTDIQEDRSTIKGLLATGQDVYLIDWGYPD
PHBC_THIVI      SPKEAVYSEDKLVLYRYTPAGVTPQKTPLLIVYALVNRPYMTDIQEDRSTIKGLLATGQDVYLIDWGYPD
GATB_DEHE1      PPLHI--SCDWIEAIRKLPELPEVRKER-FIQGYWLSEYDASLLTASRELADY-----------------


                         .         *         .         .         .         .         +:350
query           AKHRDLTLEDYRRLGVMAAIETIRAIVPHQPIHAVGYCLGGTLLSIAAAAMSRDGDDRLRSITLFAAQTD
PHBC_AZOC5      ARLADKGFDDYMRDGIFAALDAVEKATGEHQAHTIGYCVGGTLLAVTLAYMAATGDDRVASSTFLTTQID
PHAC_METEX      ERHRDKDFESYMREGIETAIDMIGVATGETDVAAAGYCVGGTLLAVTLAYQAATGNRRIKSATFLTTQVD
PHBC_RHIET      GRHAEKDWAAYAREGIDFALETIEKATGEKEVNAVGYCVGGXXXXXXXXXXXKEKNKRIKTATLFTTQVD
PHBC_RHIME      ERHASKDWEAYAREGIGFALDIIEQATGEREVNSIGYCVGGXXXXXXXXXXXXEGDERIRSATLFTTQVD
PHAC_CHRVO      AEMKHFTWETYIEKGVFAAAEAVQKITKQPTMNVLGFCVGGVILTTALCVAQAKGLKYFDSATFMTSLID
PHBC_RALEH      ASMAGSTWDDYIEHAAIRAIEVARDISGQDKINVLGFCVGGTIVSTALAVLAARGEHPAASVXXXXXXXD
PHAC_PSEOL      PRHREWGLSSYVQ-ALEEALNACRSISGNRDPNLMGACAGGTMAALQGHLQAKHQLRRVRSATYLVSLLD
PHAA_PSEOL      KAQREWGLSTYID-ALKEAVDAVLAITGSKDLNMLGACSGGITCTALVGHYAALGENKVNALTLLVSVLD
PHBC_CHRVI      QGDRALTLDDYINGYIDRCVDYLREAHGVDKVNLLGICQGGA-FSLMYSALH---PDKVRNLVTMVTPVD
PHBC_THIVI      QADSALTLDDYINGYIDSCVDYLCETHEVDQVNILGICQGGA-FSLMYASLH---PDKVKNLVTMVTPVD
GATB_DEHE1      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FTEAGELTLFINESQVAFLEDMMWKRGVLDTTQMAGAFQILRSNDLVWSRMVRDYLMGERSEPNDLMAWN
PHBC_AZOC5      FTHAGDLKVFVDEAQLSVIERRMKEMGYLEGRKMADAFNMLRSNDLIWPYVVNNYLKGKQPFPFDLLFWN
PHAC_METEX      FTHAGDLKVFADEGQIKAIEERMAEHGYLEGARMANAFNMLRPNDLIWSYVVNNYVRGKAPAAFDLLYWN
PHBC_RHIET      FTHAGDLKVFVDEEQLAALEEHMQAAGYLDGSKMSMAFNMLRASELIWPYFVNSYLKGQEPLPFDLLFWN
PHBC_RHIME      FTHAGDLKVFVDDDQIRHLEANMSATGYLEGSKMASAFNMLRASELIWPYFVNNYLKGQDPLPFDLLYWN
PHAC_CHRVO      HAEPGEISFFIDESVVAGREAKMASGGIISGKEIGRTFASLRANDLVWNYVVNNYLLGKTPAPFDLLFWN
PHBC_RALEH      FADTGILDVFVDEGHVQLREXXXXXXXXXXXXELANTFSFLRPNDLVWNYVVDNYLKGNTPVPFDLLFWN
PHAC_PSEOL      SKFESPASLFADEQTIEAAKRRSYQRGVLDGAEVARIFAWMRPNDLIWNYWVNNYLLGKTPPAFDILYWN
PHAA_PSEOL      TTMDNQVALFVDEQTLEAAKRHSYQAGVLEGSEMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILFWN
PHBC_CHRVI      FTPDNLLSAWVQNVDIDLAVDTM---GNIPGELLNWTFLSLKPFSLTGQKYVNDLLDDPDKVKNFLRKWI
PHBC_THIVI      FKTPGNLSAWVQNVDIDLAVDTM---GNIPGELLNWTFLSLKPFSLTGQKYVNDMLDDPDKVKNFLRKWI
GATB_DEHE1      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADATRMPYRMHSEYLRKLFLDNDLAEGRYTVDDRAIALSDIHTPMFVVGTLRDHVAPWRSTFKIHLLADA
PHBC_AZOC5      ADSTRMPAANHSYYLRNCYLQNNIAKGLAEIAGVKIDMGKVTIPVYSLATREDHIAPPNSAYIGAGLLGG
PHAC_METEX      ADATRMPAANHSFYLRNCYLNNTLAKGQMVLGNVRLDLKKVKVPVFNLATREDHIAPALSVFEGSAKFGG
PHBC_RHIET      ADSTRMAAANHAFYLRNCYLRNALTQNEMILDGKRISLKDVKIPIYNLATREDHIAPAKSVFLGSRFFGG
PHBC_RHIME      SDSTRMPAANHSFYLRNCYLENRLSKGEMVLAGRRVSLGDVKIPIYNLATKEDHIAPAKSVFLGSSSFGG
PHAC_CHRVO      NDAVDLPLPMHTFLLRQFYMNNALVRGAITLCGVPIDIAKIDVPVYMFAARDDHIVLWSSAFSKYLQGAP
PHBC_RALEH      GDATNLPGPWYCWYLRHTYLQNELVPGKLTVCGVPVDLASIDVPTYIYGSREDHIVPWTAAYASTALLAN
PHAC_PSEOL      ADSTRLPAALHGDLLDFFKLNPLTHPAGLEVCGTPIDLQKVELDSFTVAGSNDHITPWDAVYRSALLLGG
PHAA_PSEOL      NDTTRLPAAFHGD-LIEMFKSNPLTRDALEVCGTPIDLKQVKCDIYSLAGTNDHITPWQSCYRSAHLFGG
PHBC_CHRVI      FDSPDQAGETFRQFIKDFYQXXXXXXXXXXXXXQEVDLKDITCPVLNIFALQDHLVPPDASRALKLTSSP
PHBC_THIVI      FDSPDQAGETFRQFTKDFYQKNGFINGGVKLGGKEIDLKNVDCPVLNIYALQDHLVP-------------
GATB_DEHE1      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EITFCLTGGGHNAGIVSPPSPKAHGYQVMMKEADGPYIGPDDWIKEAPHAEGSWWTEWVHWLEARSGQPV
PHBC_AZOC5      PVRFVLAGSGHIAGVVNP--PVKHKYQYW---TGGPTGGDDVWLKGAQEHKGSWWPDWAQWFSALHPDEV
PHAC_METEX      KVDYVLAGSGHIAGVVAPPGPKAYGFR-----TGGPARGREDWVAAATEHPGSWWPYWYKWLEEQAPERV
PHBC_RHIET      KVEFVVTGSGHIAGVVNPPDKRKYQFW-----TGGPAKGEETWLEQASETPGSWWPHWQAWIETHDGRRV
PHBC_RHIME      KVTFVLSGSGHIAGVVNPPARSKYQYWT----GGAPKGDIETWMGKAKETAGSWWPHWQGWVERLDKRRV
PHAC_CHRVO      SRRFVLGASGHIAGSINPVTKDKRNYWA----NDTLPLHAEEWLESAESRPGSWWKDWDAWLAPQSGKQV
PHBC_RALEH      KLRFVLGASGHIAGVINPPNKRSHWTNDALPES------PQQWLAGAIEHHGSWWPDW------------
PHAC_PSEOL      DRRFVLANSGHIQSIINPPNPKAYYLANPKLSSD-----PRAWLHDAKRSEGSWWPLWLEWITARSG-PL
PHAA_PSEOL      KIEFVLSNSGHIQSILNPPNPKAR----FMTGADRPG-DPVAWQENATKHADSWWLHWQSWLGERAGEEK
PHBC_CHRVI      DYTELAFPGGHIGIYVSGKAQK------------------------------------------------
PHBC_THIVI      ----------------------------------------------------------------------
GATB_DEHE1      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PPPRIGLPDTNAAELPDAPGHYVLQx
PHBC_AZOC5      PAREPGGSAFNPIE--DAPGRYV---
PHAC_METEX      P---ARIPGTGAPSLAPAPGTYV---
PHBC_RHIET      AARKPGGDALNAIE--EAPGSYVME-
PHBC_RHIME      PARKAGGP-LNSIE--EAPGSYV---
PHAC_CHRVO      AAPK-SLGNKEFPPLLAAPGSYVL--
PHBC_RALEH      --------------------------
PHAC_PSEOL      KAPRSELGNATYPPLGPAPGTYVL--
PHAA_PSEOL      APTRLGNRAYAAGEA--SPGTYV---
PHBC_CHRVI      --------------------------
PHBC_THIVI      --------------------------
GATB_DEHE1      --------------------------