[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38614.1

[Show Plain Result]


## Summary of Sequence Search
    1::287
   19::247     2e-76  55%  291 aa  CYSW_ECOLI RecName: Full=Sulfate transport system permease protein
   19::247     2e-76  55%  291 aa  CYSW_ECOL6 RecName: Full=Sulfate transport system permease protein
   36::280     3e-66  49%  286 aa  CYSW_SYNE7 RecName: Full=Sulfate transport system permease protein
   39::240     3e-58  49%  276 aa  CYSW_SYNY3 RecName: Full=Sulfate transport system permease protein
   34::250     1e-37  38%  284 aa  CYST_NEPOL RecName: Full=Probable sulfate transport system permease
   37::252     2e-34  35%  286 aa  CYST_CHLAT RecName: Full=Probable sulfate transport system permease
   53::241     6e-34  37%  277 aa  CYST_SALTY RecName: Full=Sulfate transport system permease protein
   47::235     7e-32  34%  269 aa  CYST_MESVI RecName: Full=Probable sulfate transport system permease
    8::204     1e-31  37%  255 aa  CYST_PROWI RecName: Full=Probable sulfate transport system permease
   38::235     2e-31  31%  288 aa  CYST_ZYGCR RecName: Full=Probable sulfate transport system permease
   28::235     5e-31  32%  288 aa  CYST_MARPO RecName: Full=Probable sulfate transport system permease
   29::235     5e-31  31%  288 aa  CYST_ANTFO RecName: Full=Probable sulfate transport system permease
   41::236     1e-30  35%  270 aa  CYST_HELSJ RecName: Full=Probable sulfate transport system permease
   41::215     2e-30  38%  266 aa  CYST_CHLVU RecName: Full=Probable sulfate transport system permease
   53::241     1e-29  34%  277 aa  CYST_ECOLI RecName: Full=Sulfate transport system permease protein
   30::255     9e-24  27%  286 aa  NIFC_CLOPA RecName: Full=Probable transport system permease protein
   72::251     3e-23  28%  286 aa  CYST_SYNY3 RecName: Full=Sulfate transport system permease protein
   38::207     4e-23  36%  261 aa  WTPB_ARCFU RecName: Full=Molybdate/tungstate transport system
   57::244     4e-22  29%  278 aa  CYST_SYNE7 RecName: Full=Sulfate transport system permease protein
   42::199     1e-17  34%  249 aa  WTPB_PYRFU RecName: Full=Molybdate/tungstate transport system
   48::223     3e-16  30%  228 aa  MODB_RHOCA RecName: Full=Molybdenum transport system permease
   28::190     4e-16  30%  229 aa  MODB_ECOLI RecName: Full=Molybdenum transport system permease
   28::190     4e-16  30%  229 aa  MODB_ECO57 RecName: Full=Molybdenum transport system permease
   18::199     5e-15  27%  248 aa  WTPB_PYRAB RecName: Full=Molybdate/tungstate transport system
    9::226     5e-15  26%  264 aa  MODB_MYCTU RecName: Full=Molybdenum transport system permease
    9::226     5e-15  26%  264 aa  MODB_MYCBO RecName: Full=Molybdenum transport system permease
    3::178     6e-15  30%  229 aa  MODB_HAEIN RecName: Full=Molybdenum transport system permease
   17::198     9e-14  28%  247 aa  WTPB_PYRKO RecName: Full=Molybdate/tungstate transport system
   22::199     3e-13  26%  248 aa  WTPB_PYRHO RecName: Full=Molybdate/tungstate transport system
   34::254     2e-12  27%  286 aa  PHNU_SALCH RecName: Full=Putative 2-aminoethylphosphonate transport
   37::191     3e-12  32%  227 aa  YVGM_BACSU RecName: Full=Putative molybdenum transport system
   34::254     4e-12  27%  286 aa  PHNU_SALTY RecName: Full=Putative 2-aminoethylphosphonate transport
   34::254     4e-12  27%  289 aa  PHNU_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
   96::185     1e-11  39%  226 aa  MODB_AZOVI RecName: Full=Molybdenum transport system permease
   51::254     4e-11  26%  289 aa  PHNU_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
   27::259     5e-11  25%  309 aa  Y4OQ_RHISN RecName: Full=Probable ABC transporter permease protein
   26::259     2e-10  33%  324 aa  PSTC_XYLFT RecName: Full=Phosphate transport system permease
    1::229     2e-10  24%  275 aa  POTB_SHIFL RecName: Full=Spermidine/putrescine transport system
    1::229     2e-10  24%  275 aa  POTB_ECOLI RecName: Full=Spermidine/putrescine transport system
   33::200     2e-10  24%  249 aa  WTPB_METJA RecName: Full=Molybdate/tungstate transport system
   26::259     2e-10  34%  324 aa  PSTC_XYLFA RecName: Full=Phosphate transport system permease
   11::239     3e-10  24%  287 aa  POTB_SALTY RecName: Full=Spermidine/putrescine transport system
   11::239     3e-10  24%  287 aa  POTB_SALTI RecName: Full=Spermidine/putrescine transport system
   59::239     4e-10  29%  536 aa  THIP_ECOLI RecName: Full=Thiamine transport system permease protein
   33::216     2e-08  30%  293 aa  YCJO_SHIFL RecName: Full=Inner membrane ABC transporter permease
   33::216     2e-08  30%  293 aa  YCJO_ECOLI RecName: Full=Inner membrane ABC transporter permease
   83::264     4e-08  24%  317 aa  POTH_ECOLI RecName: Full=Putrescine transport system permease
   42::214     5e-08  24%  527 aa  FBPB_SERMA RecName: Full=Fe(3+)-transport system permease protein
   80::254     1e-07  33%  320 aa  PSTC_PASMU RecName: Full=Phosphate transport system permease
   80::269     2e-07  29%  327 aa  PSTC_RHILO RecName: Full=Phosphate transport system permease
   79::248     6e-07  29%  315 aa  PSTC_METJA RecName: Full=Probable phosphate transport system
  201::353     6e-07  27%  687 aa  FBPB_ACTPL RecName: Full=Ferric transport system permease protein
   83::250     2e-06  32%  315 aa  PSTC_HAEIN RecName: Full=Phosphate transport system permease
  267::436     3e-06  28%  530 aa  MALF_YERPE RecName: Full=Maltose transport system permease protein
   32::234     5e-06  29%  300 aa  YURM_BACSU RecName: Full=Probable ABC transporter permease protein
   66::246     7e-06  26%  543 aa  THIP_BRUME RecName: Full=Thiamine transport system permease protein
   84::251     7e-06  31%  319 aa  PSTC_SHIFL RecName: Full=Phosphate transport system permease
   84::251     7e-06  31%  319 aa  PSTC_ECOLI RecName: Full=Phosphate transport system permease
   84::251     7e-06  31%  319 aa  PSTC_ECO57 RecName: Full=Phosphate transport system permease
   22::84      1e-05  32%  119 aa  Y1475_HAEIN RecName: Full=Putative uncharacterized protein HI1475;
   55::214     1e-05  25%  506 aa  FBPB2_HAEIN RecName: Full=Fe(3+)-transport system permease protein
  153::305     1e-05  26%  632 aa  FBPB1_HAEIN RecName: Full=Putative ferric transport system permease
    8::225     3e-05  33%  263 aa  PHNV_SALTI RecName: Full=Putative 2-aminoethylphosphonate transport
  293::429     3e-05  29%  523 aa  MALF_VIBVY RecName: Full=Maltose transport system permease protein
  293::429     3e-05  29%  523 aa  MALF_VIBVU RecName: Full=Maltose transport system permease protein
   11::231     3e-05  20%  286 aa  POTB_HAEIN RecName: Full=Spermidine/putrescine transport system
    8::225     3e-05  33%  265 aa  PHNV_SALPA RecName: Full=Putative 2-aminoethylphosphonate transport
   49::204     4e-05  28%  294 aa  YQGI_BACSU RecName: Full=Probable ABC transporter permease protein
   49::244     6e-05  22%  292 aa  YURN_BACSU RecName: Full=Probable ABC transporter permease protein
  143::230     7e-05  35%  281 aa  POTI_ECOLI RecName: Full=Putrescine transport system permease
  143::230     7e-05  35%  281 aa  POTI_ECOL6 RecName: Full=Putrescine transport system permease
   47::128     1e-04  38%  293 aa  UGPA_AGRT5 RecName: Full=sn-glycerol-3-phosphate transport system
  101::234     1e-04  25%  313 aa  Y4TP_RHISN RecName: Full=Probable peptide ABC transporter permease
   18::187     2e-04  28%  569 aa  Y4FN_RHISN RecName: Full=Probable ABC transporter permease protein
  121::246     3e-04  28%  543 aa  THIP_BRUAB RecName: Full=Thiamine transport system permease protein
  121::246     3e-04  28%  543 aa  THIP_BRUA2 RecName: Full=Thiamine transport system permease protein
   73::233     3e-04  19%  284 aa  POTC_MYCGE RecName: Full=Spermidine/putrescine transport system
   81::257     4e-04  34%  324 aa  PSTC2_MYCTU RecName: Full=Phosphate transport system permease
   81::257     4e-04  34%  324 aa  PSTC2_MYCBO RecName: Full=Phosphate transport system permease
  121::246     5e-04  28%  543 aa  THIP_BRUSU RecName: Full=Thiamine transport system permease protein
  156::305     5e-04  28%  376 aa  OPPC_MYCPN RecName: Full=Oligopeptide transport system permease
   72::262     6e-04  25%  309 aa  YESP_BACSU RecName: Full=Probable ABC transporter permease protein
   42::232     6e-04  31%  316 aa  ARAP_BACHD RecName: Full=L-arabinose transport system permease
   75::229     8e-04  21%  286 aa  POTC_MYCPN RecName: Full=Spermidine/putrescine transport system
    1::287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxWMVTPVGAGPVARFIVLSVVAVVTLFILIAPLAVILSSAFAQGVGVFLRNLGDPGTLHAM
CYSW_ECOLI      ----------------------KWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADPDMLHAI
CYSW_ECOL6      ----------------------KWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADPDMLHAI
CYSW_SYNE7      ------------------------------------IIIIPAANVAVQAFSEGLSGFIKNLGDRNLQEAI
CYSW_SYNY3      ------------------------------------------------AFHKGVEPFIQAMGDRNFQSAL
CYST_NEPOL      ----------------------------------LVSLILPIGALLQKSSQESVSEFVSIATAPVAMSAY
CYST_CHLAT      -----------------------------------FMLILPVIALLSRASDELFKDFWQIAAEPVAISTY
CYST_SALTY      --------------------------------------------------------------NPQVVAAY
CYST_MESVI      --------------------------------------------------------------EPAAIYAY
CYST_PROWI      -----------------------------------FIPVLPLFALFSLILKNSWKDILEKAVDPIAICAY
CYST_ZYGCR      ----------------------------------ILILFLPVTALLLRTKEQSWYTIFQAVTEPVVLSAY
CYST_MARPO      ------------------------LVLACALHYGTFILALPIFFLLYKTKQQPWNILLQTALEPVVLSAY
CYST_ANTFO      -------------------------VLALSLHYGILVLALPIFILLYKAKKQPCSILLKVTTEPIILSAY
CYST_HELSJ      -------------------------------------------------------LILEKATDPIAVAAY
CYST_CHLVU      ---------------------------------------------------------LRKATDPIAVSAY
CYST_ECOLI      --------------------------------------------------------------NPQVVAAY
NIFC_CLOPA      ------------------------ILAPLFLALTAIYFVMLIFPIISMIRYSGGSHIIQTLYDQDNIKTI
CYST_SYNY3      ----------------------------------------------------------------------
WTPB_ARCFU      --------------------------------------------------------FLKAASDPAVWKVV
CYST_SYNE7      ---------------------------------------------------------------PVAVAAY
WTPB_PYRFU      ----------------------------------------------------------RTLVDPLVIESI
MODB_RHOCA      ----------------------------------------------------------------------
MODB_ECOLI      ----------------------------------------------------------------------
MODB_ECO57      ----------------------------------------------------------------------
WTPB_PYRAB      ----------------------------------LIVYIALPIIVIFTKQALDFRMLVKTIHDPLVIEAL
MODB_MYCTU      ----------------------RWVYLPAIAGI-VFVAMPLVAIAIRVDWPR----FWALITTPSSQTAL
MODB_MYCBO      ----------------------RWVYLPAIAGI-VFVAMPLVAIAIRVDWPR----FWALITTPSSQTAL
MODB_HAEIN      ------------------------------------------------------------------ISAI
WTPB_PYRKO      -------------------------------------LIAYIAVPIAVIFASDVEMLVKTLHDPYVIEAI
WTPB_PYRHO      -------------------------------------IVLPIVTIFAKQ-ALDFEMLVKTVHDPLVLEAL
PHNU_SALCH      ----------------------------------------PLSLIVEQALRGGLETFRHVVDSKRFVGAL
YVGM_BACSU      ----------------------------------------------------------------------
PHNU_SALTY      ----------------------------------------PLSLIVEQALRGGLETFRQVVDSKRFVGAL
PHNU_SALPA      ----------------------------------------PLSLIVEQALRGGLETFRQVVDSKRFVGAL
MODB_AZOVI      ----------------------------------------------------------------------
PHNU_SALTI      ----------------------------------------------------GLETFRQVVDSKRFVGAL
Y4OQ_RHISN      ----------WFTMPAAA---IMLLVLGVPLVYSFYYSLTGWSLVVPGSDQDFIG--LLNYTDVLRSSEF
PSTC_XYLFT      -----------------------FFKLLLTAAVA-FVLIALVSAALSMLWGQGVSFFYSTEWNPGALTPI
POTB_SHIFL      ------------------------MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKRLLDPLYFEVL
POTB_ECOLI      ------------------------MIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKRLLDPLYFEVL
WTPB_METJA      ---------------------------------------------------------LNQLLDKEVIEAF
PSTC_XYLFA      -----------------------FFKLLLTAAVA-FVLIALVSAALSMLWGQGVSFFYSTEWNPGALTPI
POTB_SALTY      ------------------------VIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKRLLDPLYFEVL
POTB_SALTI      ------------------------VIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKRLLDPLYFEVL
THIP_ECOLI      --------------------------------------------------------------------SF
YCJO_SHIFL      ----------------------------MVSNIEISFLRLPLNPNIESTFV-GVSNYVRILSDPGFWHSL
YCJO_ECOLI      ----------------------------MVSNIEISFLRLPLNPNIESTFV-GVSNYVRILSDPGFWHSL
POTH_ECOLI      -----------------------------------------------------LGNFLQLTDDPLYFDAY
FBPB_SERMA      ----------------------------------------PLGFVIGVAFETGWQTVKALVFRPRVAEXX
PSTC_PASMU      ----------------------------------------------------------------GTLITS
PSTC_RHILO      ----------------------------------------------------------------GALAPI
PSTC_METJA      --------------------------------------------------------------------SI
FBPB_ACTPL      ----------------------------------------------------------------------
PSTC_HAEIN      ----------------------------------------------------------------------
MALF_YERPE      ---------------------------------------------LSPGFTVSIGWFLRVLHDEGIQKPI
YURM_BACSU      ---------------IGETSVWVFLFLYLIAIAY------PLLWMVMSAFKNSDDIFEHSWSLPSSWHPM
THIP_BRUME      ---------------------------------------------------------------------I
PSTC_SHIFL      ----------------------------------------------------------------------
PSTC_ECOLI      ----------------------------------------------------------------------
PSTC_ECO57      ----------------------------------------------------------------------
Y1475_HAEIN     ----------------------------------------------------------------------
FBPB2_HAEIN     ----------------------------------------------------------------------
FBPB1_HAEIN     ----------------------------------------------------------------------
PHNV_SALTI      ------------------GRAAAGVVASVLFIVFFFL---PLAVILMSSLSQGIGFTLNHFVN--ALHAA
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
POTB_HAEIN      ------------------------ITVAIIFSWLIFFVLIPNLLVLAVSFLTRDGSNFTNLFNPLYAQVV
PHNV_SALPA      ------------------GRAAAGVVASVLFIVFFFL---PLAVILMSSLSQGIGFTLNHFVN--ALHAA
YQGI_BACSU      ----------------------------------------------SSAIAAGGGI------RDQLFNSF
YURN_BACSU      ----------------------------------------------------GLKNYVELFHDPVFYQAL
POTI_ECOLI      ----------------------------------------------------------------------
POTI_ECOL6      ----------------------------------------------------------------------
UGPA_AGRT5      ---------------------------------------------LSSNFV-GLANFSAVLSDESYLNSL
Y4TP_RHISN      ----------------------------------------------------------------------
Y4FN_RHISN      --------------------VIAWAVLTFLLVPMLAALQAALFRLGSLAMFDAVSELARSRRVRAALNTV
THIP_BRUAB      ----------------------------------------------------------------------
THIP_BRUA2      ----------------------------------------------------------------------
POTC_MYCGE      ------------------------------------------------------------------INSI
PSTC2_MYCTU     --------------------VRDLFMVTALSSITALVLAVPVAV--------GIAVFLTHYA-PRRLSRP
PSTC2_MYCBO     --------------------VRDLFMVTALSSITALVLAVPVAV--------GIAVFLTHYA-PRRLSRP
THIP_BRUSU      ----------------------------------------------------------------------
OPPC_MYCPN      ----------------------------------------------------GLGVDIWTLLWASMAKSL
YESP_BACSU      -------------------------------------------------------------GDEKYWQSL
ARAP_BACHD      --------------------ILSFIVLSFYPTVQA-IVMSFQRVLPSEVTFVGLWNYSRIL-NPTFFTAL
POTC_MYCPN      ------------------------------------------------------------------LNSV


                         .         .         *         .         .         .         .:140
query           WLTTITALIAVPINILFGVAAAWTVTKFEFPGRTLLIALIELPYSISPIVAGVAYLFVYGSQGLFGPLLD
CYSW_ECOLI      WLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLD
CYSW_ECOL6      WLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLD
CYSW_SYNE7      RLTLLMGVISVPLNTLFGLAAAFAIARKQFPGKSLLLSVIDLPFSISPVVAGLMIVLLYGRNGWLGPLLE
CYSW_SYNY3      QLTVVMALISVPLNTVFGLCAAWVLARNQFPGRALFLSVLDLPFSISPVVAGLMIVLLYGKNGWIGSWFA
CYST_NEPOL      AVTLSSALIAALLNGVFGLLIAWVLVRYEFPGRRLLDAAVDLPFALPTSVAGLTLATVYSDQGWIGTWLS
CYST_CHLAT      VVTLMTALFATLINGFFGVIIAWVLVRYNFPGKRIIDAAIDLPFALPTSVAGLTLATVYSDQGWIGHLFE
CYST_SALTY      KVTLLAAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFSVNGFYGQFLA
CYST_MESVI      SITLSMALIASIVNGIFGIFIAWILVRYNFPGKRIVDAAIDLPFALPTSVAGLTLATVYSEKGWIGHFLQ
CYST_PROWI      GFTIKMALIAALFNSIFGFLITWVITRYEFKGKKFIDAAVDLPFALPTSVAGLTLATVYGNQGWVGRFLK
CYST_ZYGCR      KVTFLTAALAAVINAFLGLILAWILVRYRFPGKNFLDAAVDLPFALPTSVGGLTLMTVYSDKGWMGPICS
CYST_MARPO      GFTFLTALLATIINAIFGLILAWVLVRYEFPGKKLLDATVDLPFALPTSVGGLTLMTVFNDKGWIKPICS
CYST_ANTFO      ATTFSTAFLAITINALFGLIIAWILVKYEFTGKETLDAIVDLPFALPASVGGLTLMTVYSDRGWMGPICS
CYST_HELSJ      TLTIKMALYTAIINTIFGFIIAWVLTRYNFSGKRIMDAIVDLPLALPTSVAGLALSTVFGRNGLFGHILD
CYST_CHLVU      LLTVQMAFYAALVNSIFGFIITWVLTRYQFWGREFLDAAVDLPFALPTSVAGLTLATVYGDQGWIGSLFN
CYST_ECOLI      KVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFSVNGFYGEWLA
NIFC_CLOPA      ILSFVTSLIALIFTFIIGTPTAFCINFVRNKVLSKILDIVEIPVVLPPAVAGIALLLAFGKNGVVGNFLS
CYST_SYNY3      -VTFITALAAGLVNGVMGTLVAWVLVRCQFPGKKIVDAMVDLPFALPTSVAGLVLATLYSQTGWVGRFFA
WTPB_ARCFU      LTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVIPHTVAGIALLVVFGSSGLIGSF--
CYST_SYNE7      EVTFGLSLAAAALNGVFGVIIAWVLTRYDFPGKKLFDSFIDLPFALPTAVAGLTLATVYSDKGWIGQFIA
WTPB_PYRFU      RNSLFTATVSTLLGILFGVPLGYVLARKEFKGKNFVQALIDTPIVIPHSVVGIMLLVTFSDA-----ILD
MODB_RHOCA      --------------------------------KEIVATLVSLPIVLPPTVLGFYLLIAMGPNS---PLTD
MODB_ECOLI      ----------------FGIFFAWLLVRCTFPGKAXXXXXXXXXXXXXXXXXXXXXXXSMGRRGFIGELYD
MODB_ECO57      ----------------FGIFFAWLLVRCTFPGKAXXXXXXXXXXXXXXXXXXXXXXXSMGRRGFIGELYD
WTPB_PYRAB      RNSXXXXXXXXXISLLFGVPLGYVLARKDFRGKSLVQAIIDVPIVIPHSVVGIMLLVTFSN---------
MODB_MYCTU      LLSVKTAAASTVLCVLLGVPMALVLARSRGRXXXXXXXXXXXXXXXXXXXXXXXXXYAFGRLGLIGRYLE
MODB_MYCBO      LLSVKTAAASTVLCVLLGVPMALVLARSRGRXXXXXXXXXXXXXXXXXXXXXXXXXYAFGRLGLIGRYLE
MODB_HAEIN      NLSLSVAVSSMLWSLPLAIFVAWLLARKNFYGKSLITXXXXXXXXXXXXXXXXXXXXAMGRNGFIGKYLY
WTPB_PYRKO      RNSXXXXXXXXXXXXXFGVPLGYVLARKDFPGKSAVQALVDVPIVIPHSVVGIMLLVTFSNS--------
WTPB_PYRHO      RNSXXXXXXXXXISLFFGVPLGYILARKDFRGKNFVQAIIDVPVVIPHSVVGIMLLVTFSNA--------
PHNU_SALCH      LNTLQIAFFATAGCLLLGSAMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGTLM
YVGM_BACSU      ------------------LAGAW-MSRASFFGKTALETCFMLPLVLPPTVVGFILIVIFGKHSFIGQAIE
PHNU_SALTY      LNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGTLM
PHNU_SALPA      LNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGALM
MODB_AZOVI      ----------------------------------------------------------------------
PHNU_SALTI      LNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLITLAFTFIYGSAGLLNGALM
Y4OQ_RHISN      WVTLIYAVVAVSLECALGILFA-VLLNLEFFGRGLFRSLMLIPMVITPAVVGIFWKLLYQDSGVFNYLLG
PSTC_XYLFT      YGTIVTALIAMLIAMPVSLGIAFFLTEVAPRWRTPIGTAIELLAGIPSIIYGMWGLFVLGTLPLIGTLFQ
POTB_SHIFL      LHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLL
POTB_ECOLI      LHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLL
WTPB_METJA      KTTLLAGAVATLIALIFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVXXXXXXXXXXXXXXX----N
PSTC_XYLFA      YGTIVTALIAIAVPVSFGIAFFLTEVAPRWLRRPVGTA-IELLAGIPSIIYGMWGLFVLGTLPLIGTLFQ
POTB_SALTY      LHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLL
POTB_SALTI      LHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLL
THIP_ECOLI      WQAFLSALLSV----IPAIFLARALYRRRFPGRLALLRLCAMTLILPVLVAVFGILSVYGRQGWLATLCQ
YCJO_SHIFL      WMTVWYTALVVAGSTVLGLAVAMFFNR-EFRLRKTARSLVILSYVTPSISLVFAWKYMFNNYGIVNYLVD
YCJO_ECOLI      WMTVWYTALVVAGSTVLGLAVAMFFNR-EFRLRKTARSLVILSYVTPSISLVFAWKYMFNNYGIVNYLVD
POTH_ECOLI      LQSLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLL
FBPB_SERMA      XXXXXXXXXXXPICAVLGVALAWLTERTTLPGRRLWXXXXXXXXXXXXFVQSYAWISLVPS---------
PSTC_PASMU      FLALI---IAVPIS--FGIAIFLTELAPEWLRRPVGTA-IEMLAAIPSIIYGMWGLFIFGDLPVFSYLFS
PSTC_RHILO      YGTVITSAIAILIAVPLGIGIAIFLTELPRPLRRPIGMAVELLAGIPSIIYGIWGLFVLAPQTTVQPLII
PSTC_METJA      YTATIAVLIALPLSICYAIFVNYAPKRLKYPLIVISDIMAGLPFILVPLLRDHIMKFLY-EHFSFIPLFD
FBPB_ACTPL      ------------VSTVFGLAFALYTTRIAH--RTAFIGKIFLPIVTPPFVVGLGVTLMLGRSGYVTEFLD
PSTC_HAEIN      ----IALFIAVPIS--FGIAIFLTELAPNWLKRPISIA-IEMLAAIPSIIYGMWGLFVFVQEHIQPVLID
MALF_YERPE      W-TILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPSFISILIF------KGLFNQSFG
YURM_BACSU      NSVIVTALTCV-ITVFISAWAAYGLSRFEFKGKGFFLVLCLGGLMLTPQVSLVPLYSIIQSLGLYNTILP
THIP_BRUME      WQAVASSLLSV----LFAIPIARALAEARFPGRGLIXXXXXXXXXXXXXXXXXGVTSIYGRNGLIAHISD
PSTC_SHIFL      ----IALLIAVPVS--FGIALFLTELAPGWLKRPLGIA-IELLAAIPSIVYGMWGLFIFAP--LFAVYFQ
PSTC_ECOLI      ----IALLIAVPVS--FGIALFLTELAPGWLKRPLGIA-IELLAAIPSIVYGMWGLFIFAP--LFAVYFQ
PSTC_ECO57      ----IALLIAVPVS--FGIALFLTELAPGWLKRPLGIA-IELLAAIPSIVYGMWGLFIFAP--LFAVYFQ
Y1475_HAEIN     ----------------------------------------------------------------------
FBPB2_HAEIN     ---TMLLMVCVTIGISLGTFCAFLLERYRFFGKAFFEVAMTLPLCIPAFVSGFTWISL------------
FBPB1_HAEIN     ------------VSTVFGLAFALYTTRIA--RRTAFIGKIFLPIVTPPFVVGLGVTLMLGRSGYVTEFLS
PHNV_SALTI      WDALLASLTASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGILVAFSQ----GPL--
MALF_VIBVY      --TVVFSILTVLLTLMIGLVLASVVQWEELKGRAIYRVLLILPYAVP------AFISILIFKGLFNQSFG
MALF_VIBVU      --TVVFSILTVLLTLMIGLVLASVVQWEELKGRAIYRVLLILPYAVP------AFISILIFKGLFNQSFG
POTB_HAEIN      WNSLSMSGIATIICLLIGYPFAFMMSKIHPKYRXXXXXXXXXXXWTNSLIRIYGMKVFLGVKGILNTMLI
PHNV_SALPA      WDALLASLTASLFALLCGVWAALALRQYGVKTQKWLSMVFYLPSAIPSVSVGLGILVAFSQ----GPL--
YQGI_BACSU      YILFITMLITIPLGVGGGVFMAEYAPNNKVTD--FIRTCIEVLSSLPSIVIGMFGLLMFVNLTGWG----
YURN_BACSU      TNNVLYAVISIVCQVFGGILAAVLEDKLVRKWSPFFRTVFFLPVVISMTVIALLFDFIYNPEGLLNQLLQ
POTI_ECOLI      ----------------------------------------------------------------------
POTI_ECOL6      ----------------------------------------------------------------------
UGPA_AGRT5      KVTVITALVSMGLALLLATAADRVVRGKGFY-RTMMI----MPYAVAPAVAGMLWLFMF-----------
Y4TP_RHISN      -LSVLTMILSVTVGVSFGVLAAWRSGGFV---DRALATFSAIGYSVPVFVIGYILIYFFAIQTRWLPVQG
Y4FN_RHISN      WMTAATTL-TVTIVGMFQVAV---LEYFRVPGRGFLKIAFSTPLVFGGVVAAAGYNFTYGPSGALAALFP
THIP_BRUAB      ---------------------------------------------------------IYGRNGLIAHISD
THIP_BRUA2      ---------------------------------------------------------IYGRNGLIAHISD
POTC_MYCGE      IIGVITVLVSVPIAVI----SAFALLRTRNALKKTIFGITNFSLATPDIITAISLVLLFANTWL------
PSTC2_MYCTU     FGAMVDLLAAVP-SIIFGLWGIFVLAKLEPIARFLNRNL------------GWLFLFKQGNVSLAGG---
PSTC2_MYCBO     FGAMVDLLAAVP-SIIFGLWGIFVLAKLEPIARFLNRNL------------GWLFLFKQGNVSLAGG---
THIP_BRUSU      ---------------------------------------------------------IYGRNGLIAHISD
OPPC_MYCPN      WIAIVVALVSMVFGTIYGAIAG------SFVGRNIMSRIIE----IIDLVPSILWIIVLGATFRFGGVKQ
YESP_BACSU      KVTFTYVLAGVPLRLGFALFIA-VILNNAAKGTAIYRTLFYLPSIIGGSVAAIMWRNIFGNDGVINALLF
ARAP_BACHD      QNTTLTVVILVSIPMLFAVLLNSKVVKFRILFRTALF----LPALTSVIVAGMVFMFSESDTAVANQILN
POTC_MYCPN      IIGLITVIVSIPIAIMTAFAL---LRSRQWLNKTVF-GIANFSLATPDIITGISLVLLFANTWL------


                         +         .         .         .         .         *         .:210
query           QLDLKVMFALPGIVLASMFVTAPYVARELIPLMQVQGTDEEEAAVTLGAGGFATFFRVTLPNIRWAMLYG
CYSW_ECOLI      EHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYG
CYSW_ECOL6      EHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYG
CYSW_SYNE7      SNDIKIIFAWPGMALATIFVSMPFVAREVIPNLEEIGTDAEEAASTLGANGWQTFWRVTLPSIKWSMLYG
CYSW_SYNY3      SWDIQIIFSVPGMAIATIFVTLPFVAREVIPVLEELGPEQEEAARTLGAKDWQIFWRVTLPNIRWGLLYG
CYST_NEPOL      SLNIQVAFTRLGVMLAMLFVSFPFVVRTLQPVLQDMERELEEAAWSLGASPFNTFLRVLCPPLMPAMMTG
CYST_CHLAT      SIGIKVAFTRVGVAVAMIFVSFPFVVRTLQPVLVEIDQELEEAAWSLGASTWRTFWRVIFPPLTPAIVTG
CYST_SALTY      QFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAQTLGATRLQSFRKVVLPELSPALIAG
CYST_MESVI      SLSIKVVFTKLGVGVAMIFVSFPFVVRTLQPVLQDIEKELEEAAWSLGASSWTTFWKVIFPSLIPSLLTG
CYST_PROWI      MGNLQIIYTKFGVLLAMIFVSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTFLRVIFPTLVPALVTG
CYST_ZYGCR      WLGIKIAFSRLGVLIAMMFVSLPFIVRTIQPVLQSMEEETEEAAWCIGASPWTTFWNVLFPPMISPLLTG
CYST_MARPO      WLNIKIVFNPIGVLLAMIFVSLPFVVRTIQPVLQNMEEDLEEAAWCLGASPWTTFWHIXXXXXXXXXXXX
CYST_ANTFO      GLGLKIVFSRLGVPMATIFVSLPFVVRTIQPVLQDVEEELEEAAWCIGASPWTTFCQIXXXXXXXXXXXG
CYST_HELSJ      FYNYEIIYTKRGILLAMIFVSFPFSVRAIQPILKEINKEEEEAAWSLGSGPLETFKRFIFPIILPAILNG
CYST_CHLVU      LFGFQIVFTKIGVLLAMIFVSFPFVIRTLQPVLQEMEKSLEEAAWSLGASSWETFRKVILPTLWPALFTG
CYST_ECOLI      KFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVXXXXXXXXXXXXXTLGATRWQSFCKVVLPELSPALVAG
NIFC_CLOPA      NHGINVIFTSTAVIIAQFFVSSALYVRVLRDSVKSVPIELFEVSYVLGAGKIETIIKIMIPMLKKSIVSG
CYST_SYNY3      PFGIQIAFSRLGVFVAMVFISLPFIVRTLQPVLQXXXXXXXXXXWSLGATEFQTFWRVIFPPLIPPILTG
WTPB_ARCFU      -SPLKFVDALPGIVVAMLFVSVPIYINQAKEGFASVDVRLEHVARTLGSSPLRVFFTVSLPLSVRHIVAG
CYST_SYNE7      PFGVQIAFTRWGVLLAMVFISLPFVVRTXXXXXXXXXXXXXXXXXXXXXXXXXTFWRVILPPILPGVLAG
WTPB_PYRFU      NYK--------GIVAVMLFVSSPFIVNSARDGFLSVDEKLEYVARTLGASGLRTFFSVTLPNAIHSIASG
MODB_RHOCA      LLGFKLSFTFAGLVVGSVIYSLPFVVNPIRNAFVAMGPRPMEVAATLRASPLDAFFTVALPQAAPGLITG
MODB_ECOLI      WFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVG
MODB_ECO57      WFGITFAFSWRGAVLAAAVMSFPLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVG
WTPB_PYRAB      ----AILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASKLRTFFSISLPIALPSIASG
MODB_MYCTU      AAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTXXXXXXXXXXX
MODB_MYCBO      AAGISIAFSTAAVVLAQTFVSLPYLVISLEGAARTAGADYEVVAATLGARPGTVWWRVTXXXXXXXXXXX
MODB_HAEIN      QFGLSFGFSWKGAVLSSAVVAFPLVVRAIRLSLENIDIKLEQAAQTLGASAWRVFFTITLPLSLPGVLAG
WTPB_PYRKO      -----ILDSYKGIVAAMLFVSAPFTINAARDGFLAVDEKLEAVARTLGASRWRAFLSISLPMAFPSIASG
WTPB_PYRHO      -----ILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASRIRTFFSISLPMALPSIASG
PHNU_SALCH      SLPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAG
YVGM_BACSU      WI-----FQQP--VIFTWWXXXXXXXXXXFPLMYQSAKDIQGAAMVDGASRWKVFIHISVPLAYPSLLTG
PHNU_SALTY      SLPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAG
PHNU_SALPA      SLPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAG
MODB_AZOVI      -------------VVASVFYSLPFVVQPLQNAFEAIGERPLEVASTLRAGPWDTFFTVVVPLARPGFITA
PHNU_SALTI      SLPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQIDKSQLEAASILGAHPLRVIGQVIFPAALPALMAS
Y4OQ_RHISN      TLGLSLTVALASVIIVDVWQSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFRYLTLPHLVPYIMIA
PSTC_XYLFT      GPPLGIGTLTAGFVLAIMVI--PFISSMMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGG
POTB_SHIFL      WLGIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAG
POTB_ECOLI      WLGIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAG
WTPB_METJA      FIGRYVVDNFWGIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTFFEISLPLIKNNIISG
PSTC_XYLFA      GPPLGIGTLSAGFVLAIMVI--PFISSIMREVFLTVPTQLKESAYALGSTKWEVSWNIVLPYTRSAVIGG
POTB_SALTY      WLGIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKMQTFIRIIIPLTMPGIVAG
POTB_SALTI      WLGIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKMQTFIRIIIPLTMPGIVAG
THIP_ECOLI      SLGLEWTFSLQGILLAHVFFNLPMASRLLLQALENIPGEQRQLAAQLGMRSWHFFRFVEWPWLRRQIPPV
YCJO_SHIFL      LLHLPLWFDNPGVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAI-------
YCJO_ECOLI      LLHLPLWFDNPGVVLFAIWRYFPYAFISFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAI-------
POTH_ECOLI      WLGLTILHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGGIIAG
FBPB_SERMA      ------MHGLGAGVFISVLAYFPFIYLPAAAVLRRLDPGIEDVATSLGSRPPAVFFRVVLPQLKLAVCGG
PSTC_PASMU      GAPFGIGLFTAGLVLAIMII--PFIAAVMRDVFTIVPAILKESAYGLGSTTWEVMWKVVLPYTKTGVVGG
PSTC_RHILO      SMGLNGLFAGPGLLTSAMILAIPFITSITKDVFDTVPSVLKESAYGIGCTTWEVTRRVVIPYTRIGIMGG
PSTC_METJA      YPPLSGYCYLSAGILLGIMVT-PFAAAIIREAYAMIPSVYKEGLVALGATRYETT-KVLIKYIRPAIISG
FBPB_ACTPL      TYDHNWLYGFNGIAIAQILAFAPISFMILDGALKSIHPSIEEASYTLRANRYQTFYNIIFPLLRPALANS
PSTC_HAEIN      NLGLELFFSTAGLVLAIMII--PFIASVMRDVFSIVPPMLKEGAYGLGATTWEVVRQVIVPHTRIGLVGS
MALF_YERPE      EINLMLITAKSMILIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFRITFP---------
YURM_BACSU      YAAYRIPFTI--ILIRSYFLS---ISKEL-----------EEAAYLDGCTSFGVFFRIFLPMSVPILVTS
THIP_BRUME      MLGHPMIYGIAGILIAHIFFNMPLAVRLLLAAYESIPDDHWKLAAQLGMGSRARFRLIDWPVIRRSLPGM
PSTC_SHIFL      EPVGNIMSNIP--IVGALFXXXPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGG
PSTC_ECOLI      EPVGNIMSNIP--IVGALFXXXPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGG
PSTC_ECO57      EPVGNIMSNIP--IVGALFXXXPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGG
Y1475_HAEIN     ------------------------------------------ASYTLELSPFKTLIKIEIPMCWKPLVCA
FBPB2_HAEIN     TFRVEVFWGTIGIMTLSSF---PLAYLPVSAILKRLDRSLEEVSLSLGKSPVYTFWYAISPQLKPAIGSS
FBPB1_HAEIN     TSSHNWLYGFNGIAIAQILAFAPISFMILDGALKSVHPSIEEASYTLRANRYQTFYQIIFPLLRPALANS
PHNV_SALTI      QMNGTLWIVLTAFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRLRHVTLPLLMPWMVSE
MALF_VIBVY      EINM-VLNALFGILIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFTRVTLP---------
MALF_VIBVU      EINM-VLNALFGILIVNTWLGFPYMMILCMGLLKAIPEDLYEASAIDGANFVQNFTRVTLP---------
POTB_HAEIN      DMGIRILNTEIAVIIGLVYLLLPFMILPLYSAIEKLDNRLLEAARDLGANTFQRFFRVILPLTMPGIIAG
PHNV_SALPA      QMNGTLWIVLTAFVLISAF-TFSNVSTGLARI----SADIENVASSLGASPWYRLRHVTLPLLMPWMVXX
YQGI_BACSU      -------YTIIGGALALTVFNLPVMVRVTEDAIRSVPKDLKEASLALGVSRWHTVKTVLIPSAIPSIITG
YURN_BACSU      AIGLDQLTAMLSVIFVSQWQSVGYIAMLYIVSIQKIPDELYEAARLDGAGKIQQFFHITVPQTKEMSFVA
POTI_ECOLI      ------------IWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISG
POTI_ECOL6      ------------IWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGATPLKVFFVITLPMIMPAIISG
UGPA_AGRT5      ----------------------------------------------------------------------
Y4TP_RHISN      YTSINQGVAFLHLILPTVTLSVPYIAITRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALKN--------
Y4FN_RHISN      SLPRDWFIGWFGVLFAHTFLMTSFHFLFLRAAMRRVDYSTIEAARSMGA---------------------
THIP_BRUAB      MLGHPMIYGIAGILIAHIFFNMPLAVRLLLAAYESIPDDHWKLAAQLGMGSRARFRLIEWPVIRRSLPGM
THIP_BRUA2      MLGHPMIYGIAGILIAHIFFNMPLAVRLLLAAYESIPDDHWKLAAQLGMGSRARFRLIEWPVIRRSLPGM
POTC_MYCGE      --SFNQQLGFFTIITSHISFSVPYALILIYPKIQKLNPNLILASQDLGYSPLKTFFHITLPYLMPSIFSA
PSTC2_MYCTU     ----GTIFTA-GIVLSVMILPVTSISREVFPLIQI------EAALALGATKWEVVRMTVLPYGRSGVVAA
PSTC2_MYCBO     ----GTIFTA-GIVLSVMILPVTSISREVFPLIQI------EAALALGATKWEVVRMTVLPYGRSGVVAA
THIP_BRUSU      MLGHPMIYGIAGILIAHIFFNMPLAVRLLLAAYESIPDDYWKLAAQLGMGSRARFRLIEWPVIRRSLPGM
OPPC_MYCPN      FDDSVVIF-----TLIFVFWTWP-AATTRIYILKNKDTEYIQAARTLGAKQIRIIFVHMLPVVRLAVVFV
YESP_BACSU      GIDQKILWALWTLILLSVWQFGSSMLIFLAGLKNIPSSYLEAASVD-GANRVQRFFKITLPILTPIIFFN
ARAP_BACHD      WIGLESVNAWSGMFLMVVLASWRWMGINILYLAALQNVPKEEAADIDGANVVQKFFYVTLPFLK------
POTC_MYCPN      --SFNQQLGXXXXXXXXXXXXVPYALVLIYPKMQKLNRNLILASQDLGYSPIATFFHITLPYLLPSILSA


                         .         .         .         +         .         .         .:280
query           AILCNARVLGEFGAVSVVSGNVRGQTTTLPLQIELLYQDYNXXXXXXXXXXXXXXXXXXILLKMLLERLA
CYSW_ECOLI      VVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYN-----------------------------
CYSW_ECOL6      VVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYN-----------------------------
CYSW_SYNE7      VVLTTARALGEFGAVSVVSGSITGKTQTLPLFVEEAYKQYQTTLSYTAALLLGGISLVTLVLKALLEART
CYSW_SYNY3      VLLTNARAMGEFGAVAVVSGSILGKTSTLPIFVEQEYKNY------------------------------
CYST_NEPOL      IALAFSRAVGEYGSVVIVSGNIPFQDLIAPVLIFQRLEQYD-----------------------------
CYST_CHLAT      VALAFSRAIGEYGSVVIVASNIPFKDLTAPVLIFQRLEQYD-----------------------------
CYST_SALTY      VALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFD-----------------------------
CYST_MESVI      IALAFSRAVGEYGSVVIIASNIPFKDLTAPVLIFQKLEQYD-----------------------------
CYST_PROWI      FTLSFSRALGEFGSVVMISSNL------------------------------------------------
CYST_ZYGCR      TALGFSRAIGEYGSIVLVASNI------------------------------------------------
CYST_MARPO      XXXXXXRALGEYGSIVLIASNI------------------------------------------------
CYST_ANTFO      TALGFSRAIGEYGSIVLIACNI------------------------------------------------
CYST_HELSJ      FTLTFSRSLSEFGSIVMVAGNLPLQDLVSSVLISQYLEQYD-----------------------------
CYST_CHLVU      FTLSFSRALGEFGSIVMISSNL------------------------------------------------
CYST_ECOLI      VALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFVRLQEFD-----------------------------
NIFC_CLOPA      LILAWIRSLGEFGATLMFAGNIIGKTRTIPLQIYTYMQD-------------------------------
CYST_SYNY3      IALGFSRAVGEYGSVVLIASNIPFKDLIAPVLVFERLEQYD-----------------------------
WTPB_ARCFU      AIMSWARGISEFGAVVVIA---------------------------------------------------
CYST_SYNE7      VAQGFSRAVGEFGSVVIISGNLPFDDLIAPVLIFERLEQYD-----------------------------
WTPB_PYRFU      AIMAWARAISEVGAILIVA---------------------------------------------------
MODB_RHOCA      AILGFAHTVGEFGVVLMIGGGIPGRTKVLSVTIFDYVETLEWDKAHVLAGGMLAMSFVVILAMMLIERRY
MODB_ECOLI      TVLAFARSLGEFGATITFVSNIPGETRTIPSAMYTLIQ--------------------------------
MODB_ECO57      TVLAFARSLGEFGATITFVSNIPGETRTIPSAMYTLIQ--------------------------------
WTPB_PYRAB      AIMAWARGISEVGAILIVA---------------------------------------------------
MODB_MYCTU      XXXAFARSLGEFGATLTFAGSRQGVTRTLPLEIYL-----------------------------------
MODB_MYCBO      XXXAFARSLGEFGATLTFAGSRQGVTRTLPLEIYL-----------------------------------
MODB_HAEIN      LVLGFARSLGEFGATITFVSNIAGETQTIPL---------------------------------------
WTPB_PYRKO      AIMTWARAISEVGAILIVA---------------------------------------------------
WTPB_PYRHO      GIMAWARSMSEVGAILIVA---------------------------------------------------
PHNU_SALCH      GSLCLLLTTNEFGIVLFIGAK---GVNTLPMMVAILESDY------------------------------
YVGM_BACSU      SILSLARALGEFGATLMFAGNIPGVTQTLPTAI-------------------------------------
PHNU_SALTY      GSLCLLLTTNEFGIVLFIGAK---GVNTLPMMVAILESDY------------------------------
PHNU_SALPA      GSLCLLLTTNEFGIVLFIGAK---GVNTLPMMVAILESDY------------------------------
MODB_AZOVI      AILGFAHTVGEFGVVLMIGGNIPEKTRTVAVQI-------------------------------------
PHNU_SALTI      GSLCLLLTTNEFGIVLFIGAK---GVNTLPMMVAILESDY------------------------------
Y4OQ_RHISN      AAFRIIGVMADFDKIFLLTLGGPGNVTT------------------------------------------
PSTC_XYLFT      MFLGLGRALGETMAVAFVIGN-------------------------------------------------
POTB_SHIFL      CLLVMLPAMGLFGAKNLLIGNV------------------------------------------------
POTB_ECOLI      CLLVMLPAMGLFGAKNLLIGNV------------------------------------------------
WTPB_METJA      IILSFARGISEVGAILIIA---------------------------------------------------
PSTC_XYLFA      MFLGLGRALGETMAVAFVIGN-------------------------------------------------
POTB_SALTY      CLLVMLPAMGLFGAKNLLIGNV------------------------------------------------
POTB_SALTI      CLLVMLPAMGLFGAKNLLIGNV------------------------------------------------
THIP_ECOLI      AALIFMLCFASFATVLSLGGG--PQATTIELAIQALSYDYD-----------------------------
YCJO_SHIFL      ----------------------------------------------------------------------
YCJO_ECOLI      ----------------------------------------------------------------------
POTH_ECOLI      SMLVFIPAVGEFVIPELLGG--------------------------------------------------
FBPB_SERMA      SLLIALHLLAEYGLYAMI----------------------------------------------------
PSTC_PASMU      IMLGLGRALGETMAVTFVIGN-------------------------------------------------
PSTC_RHILO      VMLALGRALGETMAVTFVIGNAHRISTSL-----------------------------------------
PSTC_METJA      LILAFGRALGETVAVSLVIGN-------------------------------------------------
FBPB_ACTPL      FLIVFIQSLADFSNPLVLGGS-------------------------------------------------
PSTC_HAEIN      VMLGLGRALGETMAITFIIGN-------------------------------------------------
MALF_YERPE      ----------------------------------------------------------------------
YURM_BACSU      GILTAYHTWNEF----------------------------------------------------------
THIP_BRUME      IGLVFMLCVTSFTTVLTLGGGPR--ATTLEVAIQSLHFDFD-----------------------------
PSTC_SHIFL      IMLGLGRALGETMAVTFIIGN-------------------------------------------------
PSTC_ECOLI      IMLGLGRALGETMAVTFIIGN-------------------------------------------------
PSTC_ECO57      IMLGLGRALGETMAVTFIIGN-------------------------------------------------
Y1475_HAEIN     SVLAWSRAIGEFGATLMLAGATRFKTETLPMAVYL-----------------------------------
FBPB2_HAEIN     ILLIALHMLVEFGAVSIL--NYQTFTTAIFQEYEMSFNN-------------------------------
FBPB1_HAEIN     FLIVFIQSLADFSNPLVLGGS-------------------------------------------------
PHNV_SALTI      LALSLSLSMGELGATVMI---YPPGWTTLPVAI-------------------------------------
MALF_VIBVY      ----------------------------------------------------------------------
MALF_VIBVU      ----------------------------------------------------------------------
POTB_HAEIN      CLLVLLPAMGMFYVADLLGG--------------------------------------------------
PHNV_SALPA      XXXXXXXXMGELGATVMI---YPPGWTTLPVAI-------------------------------------
YQGI_BACSU      AILASGRVFGE-----------------------------------------------------------
YURN_BACSU      VVMTLTGAFTVFNEPYILTGGGPGKAS-------------------------------------------
POTI_ECOLI      WLLAFTLSLDDLVIASFVSG---PGATTLPMLV-------------------------------------
POTI_ECOL6      WLLAFTLSLDDLVIASFVSG---PGATTLPMLV-------------------------------------
UGPA_AGRT5      ----------------------------------------------------------------------
Y4TP_RHISN      ----------------------------------------------------------------------
Y4FN_RHISN      ----------------------------------------------------------------------
THIP_BRUAB      IGLVFMLCVTSFTTVLTLGGGPR--ATTLEVAIQSLHFDFD-----------------------------
THIP_BRUA2      IGLVFMLCVTSFTTVLTLGGGPR--ATTLEVAIQSLHFDFD-----------------------------
POTC_MYCGE      VLVVFATSFDDYVITSLVQGSVKTIATEL-----------------------------------------
PSTC2_MYCTU     SMLGLGRALGETVAVLVI----------------------------------------------------
PSTC2_MYCBO     SMLGLGRALGETVAVLVI----------------------------------------------------
THIP_BRUSU      IGLVFMLCVTSFTTVLTLGGGPR--ATTLEVAIQSLHFDFD-----------------------------
OPPC_MYCPN      SLI-------------------------------------------------------------------
YESP_BACSU      LVMQTISAFMTFTPAYIISKGEGG-----PLDGTLLYSLY------------------------------
ARAP_BACHD      ----------------------------------------------------------------------
POTC_MYCPN      ILVVFATSFDDYVITSLVQGSVK-----------------------------------------------


                         .         *         .         .         .         .         +:350
query           Gxxxxxx
CYSW_ECOLI      -------
CYSW_ECOL6      -------
CYSW_SYNE7      G------
CYSW_SYNY3      -------
CYST_NEPOL      -------
CYST_CHLAT      -------
CYST_SALTY      -------
CYST_MESVI      -------
CYST_PROWI      -------
CYST_ZYGCR      -------
CYST_MARPO      -------
CYST_ANTFO      -------
CYST_HELSJ      -------
CYST_CHLVU      -------
CYST_ECOLI      -------
NIFC_CLOPA      -------
CYST_SYNY3      -------
WTPB_ARCFU      -------
CYST_SYNE7      -------
WTPB_PYRFU      -------
MODB_RHOCA      G------
MODB_ECOLI      -------
MODB_ECO57      -------
WTPB_PYRAB      -------
MODB_MYCTU      -------
MODB_MYCBO      -------
MODB_HAEIN      -------
WTPB_PYRKO      -------
WTPB_PYRHO      -------
PHNU_SALCH      -------
YVGM_BACSU      -------
PHNU_SALTY      -------
PHNU_SALPA      -------
MODB_AZOVI      -------
PHNU_SALTI      -------
Y4OQ_RHISN      -------
PSTC_XYLFT      -------
POTB_SHIFL      -------
POTB_ECOLI      -------
WTPB_METJA      -------
PSTC_XYLFA      -------
POTB_SALTY      -------
POTB_SALTI      -------
THIP_ECOLI      -------
YCJO_SHIFL      -------
YCJO_ECOLI      -------
POTH_ECOLI      -------
FBPB_SERMA      -------
PSTC_PASMU      -------
PSTC_RHILO      -------
PSTC_METJA      -------
FBPB_ACTPL      -------
PSTC_HAEIN      -------
MALF_YERPE      -------
YURM_BACSU      -------
THIP_BRUME      -------
PSTC_SHIFL      -------
PSTC_ECOLI      -------
PSTC_ECO57      -------
Y1475_HAEIN     -------
FBPB2_HAEIN     -------
FBPB1_HAEIN     -------
PHNV_SALTI      -------
MALF_VIBVY      -------
MALF_VIBVU      -------
POTB_HAEIN      -------
PHNV_SALPA      -------
YQGI_BACSU      -------
YURN_BACSU      -------
POTI_ECOLI      -------
POTI_ECOL6      -------
UGPA_AGRT5      -------
Y4TP_RHISN      -------
Y4FN_RHISN      -------
THIP_BRUAB      -------
THIP_BRUA2      -------
POTC_MYCGE      -------
PSTC2_MYCTU     -------
PSTC2_MYCBO     -------
THIP_BRUSU      -------
OPPC_MYCPN      -------
YESP_BACSU      -------
ARAP_BACHD      -------
POTC_MYCPN      -------