[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38720.1

[Show Plain Result]


## Summary of Sequence Search
    1::180
   17::145     7e-06  36%  146 aa  FOSB_BACSK RecName: Full=Metallothiol transferase fosB;       
    1::125     3e-05  26%  128 aa  YWKD_BACSU RecName: Full=Uncharacterized protein ywkD;
  214::266     5e-05  44%  307 aa  XYLE1_PSEPU RecName: Full=Metapyrocatechase;         Short=MPC;    
    1::130     5e-05  28%  316 aa  MHQA_BACSU RecName: Full=Putative ring-cleaving dioxygenase mhqA;  
  214::266     8e-05  42%  307 aa  XYLE_PSEAE RecName: Full=Metapyrocatechase;         Short=MPC;     
    5::134     1e-04  32%  138 aa  FOSB_BACC1 RecName: Full=Metallothiol transferase fosB;       
   20::151     2e-04  27%  282 aa  LGUL_BRAOG RecName: Full=Putative lactoylglutathione lyase;        
  214::266     2e-04  42%  307 aa  XYLE2_PSEPU RecName: Full=Metapyrocatechase;         Short=MPC;    
  214::266     2e-04  42%  307 aa  DMPB_PSEUF RecName: Full=Metapyrocatechase;         Short=MPC;     
    2::116     3e-04  33%  139 aa  FOSB_STAHJ RecName: Full=Metallothiol transferase fosB;       
    2::116     3e-04  33%  139 aa  FOSB_STAHA RecName: Full=Metallothiol transferase fosB;       
    1::116     4e-04  32%  144 aa  FOSB_BACSU RecName: Full=Metallothiol transferase fosB;       
  214::266     9e-04  40%  307 aa  NAHH_PSEPU RecName: Full=Metapyrocatechase;         Short=MPC;     
    2::116     9e-04  33%  139 aa  FOSB_STAEP RecName: Full=Metallothiol transferase fosB;       
    1::180

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQIQQIHHVAYRCKDAKQTVEFYGRVMGMDLIGAIAEDKVPSTKAPDPYMHIFLDAGAGNILAFFELPNS
FOSB_BACSK      -------------------------------------------KAVSFYKHVFMEAPLGEKTAYFTIGGT
YWKD_BACSU      MLLKSIHHIAIICSDYEKSKAFYVHKLGFQVIQETYREERGSYK-------LDLSLNGSYVIELFSFPDP
XYLE1_PSEPU     ----------------------------------------------------------------------
MHQA_BACSU      MKVNGIHHVSALTADAQKNLDFYXXXXXXXXXXXXXNQDEPT------MYHLFYGANPGTELTFFEIPRI
XYLE_PSEAE      ----------------------------------------------------------------------
FOSB_BACC1      -----INHLCFSVSNLEDSIEFYEKVLEGELL-------VRGRKLA--YFNI-----CGVWVALNEEIHI
LGUL_BRAOG      -------HVVYRVGDLDRTIQFYTECFGMKV---LRKRDVPEEK----YSNAFLGFGPETSNFVVELTNY
XYLE2_PSEPU     ----------------------------------------------------------------------
DMPB_PSEUF      ----------------------------------------------------------------------
FOSB_STAHJ      --IKGINHITYSVSNIAKSIEFYRDILGADI---LVESETSA------YFNL-----GGIWLALNEEKNI
FOSB_STAHA      --IKGINHITYSVSNIAKSIEFYRDILGADI---LVESETSA------YFNL-----GGIWLALNEEKNI
FOSB_BACSU      MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVK------------------------GRTTAYFDLNEE
NAHH_PSEPU      ----------------------------------------------------------------------
FOSB_STAEP      --IKGINHITYSVSNIAKSIEFYRDILGADI---LVEGETSA------YFNL-----GGIWLALNEEKNI


                         .         .         *         .         .         .         .:140
query           PPMGRDPNTPDWTQHIAFQVENIDALLSAKQRAEANGLDVVGPTDHTIFKSIYFWDPSGHRLEVAAWTAT
FOSB_BACSK      PDIDRKEIRQSYT-HIAFSIEELDAFYTRLLEAGADILPGRKRQVETEGKSIYFRDPDGHLLEVHTGTLA
YWKD_BACSU      PERQTRPEAAG-LRHLAFTVGSLD---KAVQELHEKGIETIRTDPLTGKRFTFFFDPDQLPLEL------
XYLE1_PSEPU     --------------HVSFHLETWEDLLRAADLISMTDTSIIGPTRHTHGKTIYFFDPSGNRNEV------
MHQA_BACSU      APFHAGTNS---ISSIGLRVPGTEALHYWKERFEEQQVTHSGISKRAGRDILAFQDHEGQRLVLTA----
XYLE_PSEAE      --------------HVSFHLETWEDVLRAADLISMTDTSIIGPTRHTHGKTIYFFDPSGNRSEV------
FOSB_BACC1      P---RNEIYQSYT-HIAFSVEQKD-FESLLQRLEENDVHILKGRERDVCESIYFVDPDGHKFEFHSGTLQ
LGUL_BRAOG      GVSSYDIGT--GFGHFAISTQDVSKMVEAVRAKGGNVTREPGPVKGGGSVIAFVKDPDGYTFELIQRGPT
XYLE2_PSEPU     --------------HVSFFLETWEDVLRAADLISMTDTSIIGPTRHTHGKTIYFFDPSGNRNEV------
DMPB_PSEUF      --------------HVSFFLETWEDVLRAADLISMTDTSIIGPTRHTHGKTIYFFDPSGNRNEV------
FOSB_STAHJ      P---RSEIKYSYT-HIAFTISDND-FEDWYNWLKENEVNILEGRDRDIKKSIYFTDLDGHKLEL------
FOSB_STAHA      P---RSEIKYSYT-HIAFTISDND-FEDWYNWLKENEVNILEGRDRDIKKSIYFTDLDGHKLEL------
FOSB_BACSU      PDIPRNDIKLSYT-HIAFTIEDHEEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFE-------
NAHH_PSEPU      --------------HASFFLDTWEDVLRAADLISMTDTSIIGPTRHTQGKTIYFFDPSGNRCEV------
FOSB_STAEP      P---RSEIKYSYT-HIAFTISDND-FEDWYIWLKENEVNILEGRDRDIKKSIYFTDLDGHKLEL------


                         +         .         .         .         .         *         .:210
query           PQQLAQMKDVAHAMVDEWAETKKxxxxxxxxxxxxxxxxx
FOSB_BACSK      -ERLAHYEKTAPDMLVNIDEQNK-----------------
YWKD_BACSU      ----------------------------------------
XYLE1_PSEPU     ----------------------------------------
MHQA_BACSU      ----------------------------------------
XYLE_PSEAE      ----------------------------------------
FOSB_BACC1      DRLNYYREDKPH----------------------------
LGUL_BRAOG      PEPLCQV---------------------------------
XYLE2_PSEPU     ----------------------------------------
DMPB_PSEUF      ----------------------------------------
FOSB_STAHJ      ----------------------------------------
FOSB_STAHA      ----------------------------------------
FOSB_BACSU      ----------------------------------------
NAHH_PSEPU      ----------------------------------------
FOSB_STAEP      ----------------------------------------