[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38782.1

[Show Plain Result]


## Summary of Sequence Search
    1::258
    1::257     7e-60  46%  257 aa  ECHH_RHIME RecName: Full=Probable enoyl-CoA hydratase;       
    1::31      8e-54  59%  257 aa  ECHA8_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA8;      
    1::31      8e-54  59%  257 aa  ECHA8_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA8;      
   29::274     2e-52  43%  277 aa  ECHM_DICDI RecName: Full=Probable enoyl-CoA hydratase,
    1::31      4e-52  57%  257 aa  ECHA8_MYCLE RecName: Full=Probable enoyl-CoA hydratase echA8;      
   36::287     3e-49  42%  290 aa  ECHM_HUMAN RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   36::287     7e-49  43%  290 aa  ECHM_MOUSE RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   36::287     1e-48  42%  290 aa  ECHM_PONAB RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   36::287     4e-47  41%  290 aa  ECHM_RAT RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   36::287     7e-47  40%  290 aa  ECHM_BOVIN RecName: Full=Enoyl-CoA hydratase, mitochondrial;       
   33::285     2e-45  39%  288 aa  ECHM_CAEEL RecName: Full=Probable enoyl-CoA hydratase,
    1::254     4e-36  34%  261 aa  CRT_CLOAB RecName: Full=3-hydroxybutyryl-CoA dehydratase;       
    3::154     6e-30  45%  155 aa  CRT_CLODI RecName: Full=3-hydroxybutyryl-CoA dehydratase;       
   85::255     9e-28  38%  255 aa  PAAF_ECOLI RecName: Full=Probable enoyl-CoA hydratase paaF;        
  141::300     4e-26  38%  303 aa  ECHD3_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
    1::254     6e-25  28%  260 aa  YNGF_BACSU RecName: Full=Putative enoyl-CoA hydratase/isomerase
  141::300     8e-25  36%  300 aa  ECHD3_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
   95::256     4e-24  39%  261 aa  CAID_SALTI RecName: Full=Carnitinyl-CoA dehydratase;       
  169::311     4e-24  42%  314 aa  AUHM_MOUSE RecName: Full=Methylglutaconyl-CoA hydratase,
   95::256     5e-24  39%  261 aa  CAID_SALTY RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     5e-24  39%  261 aa  CAID_SALSV RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     5e-24  39%  261 aa  CAID_SALNS RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     5e-24  39%  261 aa  CAID_SALHS RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  38%  261 aa  CAID_SALPK RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  38%  261 aa  CAID_SALPC RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  38%  261 aa  CAID_SALPA RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  38%  261 aa  CAID_SALCH RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  38%  261 aa  CAID_SALA4 RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     8e-24  39%  261 aa  CAID_CITK8 RecName: Full=Carnitinyl-CoA dehydratase;       
  194::336     8e-24  42%  339 aa  AUHM_HUMAN RecName: Full=Methylglutaconyl-CoA hydratase,
  141::300     1e-23  34%  300 aa  ECHD3_RAT RecName: Full=Enoyl-CoA hydratase domain-containing
   95::256     1e-23  38%  261 aa  CAID_SALPB RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     1e-23  38%  261 aa  CAID_SALG2 RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     1e-23  38%  261 aa  CAID_SALEP RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     1e-23  38%  261 aa  CAID_SALDC RecName: Full=Carnitinyl-CoA dehydratase;       
  115::289     1e-23  35%  293 aa  ECH1_DICDI RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
  134::293     2e-23  34%  294 aa  ECHD3_XENLA RecName: Full=Enoyl-CoA hydratase domain-containing
   81::189     7e-23  47%  723 aa  ECHP_PONAB RecName: Full=Peroxisomal bifunctional enzyme;       
  124::279     2e-22  37%  289 aa  ECHD3_DANRE RecName: Full=Enoyl-CoA hydratase domain-containing
   81::189     3e-22  46%  723 aa  ECHP_HUMAN RecName: Full=Peroxisomal bifunctional enzyme;       
  158::300     3e-22  36%  303 aa  AUHM_DICDI RecName: Full=Methylglutaconyl-CoA hydratase,
   95::256     5e-22  37%  261 aa  CAID_ECOLI RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     5e-22  37%  261 aa  CAID_ECOLC RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     5e-22  37%  261 aa  CAID_ECO57 RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     6e-22  37%  261 aa  CAID_ECOSM RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     6e-22  37%  261 aa  CAID_ECOL6 RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     6e-22  37%  261 aa  CAID_ECOL5 RecName: Full=Carnitinyl-CoA dehydratase;       
   93::258     8e-22  37%  261 aa  CAID_SALAR RecName: Full=Carnitinyl-CoA dehydratase;       
   95::256     1e-21  37%  261 aa  CAID_SHIFL RecName: Full=Carnitinyl-CoA dehydratase;       
   93::261     2e-21  37%  261 aa  CAID_PROSL RecName: Full=Carnitinyl-CoA dehydratase;       
   93::261     2e-21  37%  261 aa  CAID_PROMH RecName: Full=Carnitinyl-CoA dehydratase;       
  127::261     3e-21  42%  763 aa  ECHA_RAT RecName: Full=Trifunctional enzyme subunit alpha,
  125::261     4e-21  41%  763 aa  ECHA_MOUSE RecName: Full=Trifunctional enzyme subunit alpha,
  116::255     1e-20  40%  258 aa  FADB_BACSU RecName: Full=Probable enoyl-CoA hydratase;       
   83::190     1e-20  44%  726 aa  ECHP_CAVPO RecName: Full=Peroxisomal bifunctional enzyme;       
  125::222     2e-20  45%  763 aa  ECHA_PIG RecName: Full=Trifunctional enzyme subunit alpha,
   97::202     3e-20  47%  715 aa  FADJ_SALSV RecName: Full=Fatty acid oxidation complex subunit
   80::175     3e-20  45%  718 aa  ECHP_DANRE RecName: Full=Peroxisomal bifunctional enzyme;       
  107::294     3e-20  34%  296 aa  ECHD2_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
   89::278     3e-20  34%  729 aa  FADB_SERP5 RecName: Full=Fatty acid oxidation complex subunit
  147::290     4e-20  41%  292 aa  ECHD2_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
   97::202     6e-20  46%  715 aa  FADJ_SALTY RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALTI RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALPB RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALNS RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALHS RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALG2 RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALEP RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALDC RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALCH RecName: Full=Fatty acid oxidation complex subunit
   97::202     6e-20  46%  715 aa  FADJ_SALA4 RecName: Full=Fatty acid oxidation complex subunit
   92::259     7e-20  31%  261 aa  MMCD_ECOLI RecName: Full=Methylmalonyl-CoA decarboxylase;       
   94::202     1e-19  43%  708 aa  FADJ_IDILO RecName: Full=Fatty acid oxidation complex subunit
   97::202     1e-19  46%  715 aa  FADJ_SALPK RecName: Full=Fatty acid oxidation complex subunit
   97::202     1e-19  46%  715 aa  FADJ_SALPA RecName: Full=Fatty acid oxidation complex subunit
   97::189     2e-19  49%  715 aa  FADJ_CITK8 RecName: Full=Fatty acid oxidation complex subunit
  151::294     2e-19  39%  296 aa  ECHD2_BOVIN RecName: Full=Enoyl-CoA hydratase domain-containing
   95::259     3e-19  33%  262 aa  PAAG_ECOLI RecName: Full=Probable enoyl-CoA hydratase paaG;        
  101::264     3e-19  37%  271 aa  MENB_BACSU RecName: Full=Naphthoate synthase;       
   89::200     3e-19  38%  728 aa  FADB_PHOLL RecName: Full=Fatty acid oxidation complex subunit
  128::222     4e-19  44%  763 aa  ECHA_HUMAN RecName: Full=Trifunctional enzyme subunit alpha,
  141::319     4e-19  35%  328 aa  ECH1_HUMAN RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
  104::202     5e-19  43%  723 aa  FADB_VIBVY RecName: Full=Fatty acid oxidation complex subunit
  104::202     5e-19  43%  723 aa  FADB_VIBVU RecName: Full=Fatty acid oxidation complex subunit
  141::319     5e-19  34%  328 aa  ECH1_PONAB RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
   90::202     6e-19  38%  723 aa  FADB_VIBCM RecName: Full=Fatty acid oxidation complex subunit
   90::202     6e-19  38%  723 aa  FADB_VIBCH RecName: Full=Fatty acid oxidation complex subunit
   90::202     6e-19  38%  723 aa  FADB_VIBC3 RecName: Full=Fatty acid oxidation complex subunit
  115::278     1e-18  35%  285 aa  MENB_PASMU RecName: Full=Naphthoate synthase;       
  100::263     1e-18  38%  268 aa  MENB_CYACA RecName: Full=Naphthoate synthase;       
  104::203     1e-18  41%  723 aa  FADB_VIBHB RecName: Full=Fatty acid oxidation complex subunit
   76::190     1e-18  42%  718 aa  FADB_IDILO RecName: Full=Fatty acid oxidation complex subunit
  102::265     2e-18  35%  272 aa  MENB_STAHJ RecName: Full=Naphthoate synthase;       
  102::265     2e-18  35%  272 aa  MENB_STAES RecName: Full=Naphthoate synthase;       
  102::265     2e-18  35%  272 aa  MENB_STAEQ RecName: Full=Naphthoate synthase;       
  104::193     2e-18  42%  729 aa  FADB_YERPY RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPS RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPP RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPN RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPG RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPE RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPB RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERPA RecName: Full=Fatty acid oxidation complex subunit
  104::193     2e-18  42%  729 aa  FADB_YERP3 RecName: Full=Fatty acid oxidation complex subunit
  103::266     3e-18  35%  273 aa  MENB_STAAN RecName: Full=Naphthoate synthase;       
  103::266     3e-18  35%  273 aa  MENB_STAAM RecName: Full=Naphthoate synthase;       
  105::201     3e-18  44%  721 aa  FADB_PSEU2 RecName: Full=Fatty acid oxidation complex subunit
  105::201     3e-18  43%  721 aa  FADB_PSE14 RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALTY RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALTI RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  725 aa  FADB_SALPK RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALPB RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  725 aa  FADB_SALPA RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALG2 RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALEP RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALCH RecName: Full=Fatty acid oxidation complex subunit
  104::278     4e-18  36%  729 aa  FADB_SALA4 RecName: Full=Fatty acid oxidation complex subunit
  105::201     4e-18  42%  721 aa  FADB_PSESM RecName: Full=Fatty acid oxidation complex subunit
  104::238     4e-18  38%  729 aa  FADB_ERWCT RecName: Full=Fatty acid oxidation complex subunit
  104::200     4e-18  40%  729 aa  FADB_ENTS8 RecName: Full=Fatty acid oxidation complex subunit
  104::206     5e-18  39%  723 aa  FADB_VIBSL RecName: Full=Fatty acid oxidation complex subunit
   95::200     5e-18  39%  715 aa  FADB_AERHH RecName: Full=Fatty acid oxidation complex subunit
  104::278     7e-18  35%  729 aa  FADB_SALSV RecName: Full=Fatty acid oxidation complex subunit
  104::278     7e-18  35%  729 aa  FADB_ECOL6 RecName: Full=Fatty acid oxidation complex subunit
  104::278     7e-18  35%  729 aa  FADB_ECOL5 RecName: Full=Fatty acid oxidation complex subunit
  104::278     7e-18  35%  729 aa  FADB_ECO27 RecName: Full=Fatty acid oxidation complex subunit
   95::200     7e-18  39%  715 aa  FADB_AERS4 RecName: Full=Fatty acid oxidation complex subunit
  102::265     9e-18  34%  272 aa  MENB_STAS1 RecName: Full=Naphthoate synthase;       
  103::266     9e-18  34%  273 aa  MENB_STAAW RecName: Full=Naphthoate synthase;       
  103::266     9e-18  34%  273 aa  MENB_STAAS RecName: Full=Naphthoate synthase;       
  103::266     9e-18  34%  273 aa  MENB_STAAR RecName: Full=Naphthoate synthase;       
  103::266     9e-18  34%  273 aa  MENB_STAAC RecName: Full=Naphthoate synthase;       
  103::199     9e-18  42%  716 aa  FADB_SHEAM RecName: Full=Fatty acid oxidation complex subunit
  104::278     9e-18  36%  729 aa  FADB_SALNS RecName: Full=Fatty acid oxidation complex subunit
  104::200     9e-18  39%  729 aa  FADB_ENTCL RecName: Full=Fatty acid oxidation complex subunit
  115::278     1e-17  34%  285 aa  MENB_HAEIN RecName: Full=Naphthoate synthase;       
  104::203     2e-17  39%  723 aa  FADB_VIBPA RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_SHIFL RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_SHIF8 RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_SHIDS RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  41%  716 aa  FADB_SHEFN RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  39%  729 aa  FADB_KLEP7 RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  39%  729 aa  FADB_KLEP3 RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECOSM RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECOLU RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECOHS RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECO7I RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECO5E RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  40%  729 aa  FADB_ECO57 RecName: Full=Fatty acid oxidation complex subunit
  115::278     2e-17  34%  285 aa  MENB_ECOLI RecName: Full=Naphthoate synthase;       
  115::278     2e-17  34%  285 aa  MENB_ECOL6 RecName: Full=Naphthoate synthase;       
  104::200     2e-17  40%  720 aa  FADB_PHOPR RecName: Full=Fatty acid oxidation complex subunit
  104::278     2e-17  34%  729 aa  FADB_ECOUT RecName: Full=Fatty acid oxidation complex subunit
  104::278     2e-17  34%  729 aa  FADB_ECO81 RecName: Full=Fatty acid oxidation complex subunit
  104::278     2e-17  34%  729 aa  FADB_ECO45 RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-17  39%  726 aa  FADB_ALISL RecName: Full=Fatty acid oxidation complex subunit
  104::200     3e-17  40%  725 aa  FADB_VIBF1 RecName: Full=Fatty acid oxidation complex subunit
  104::200     3e-17  41%  716 aa  FADB_SHEB8 RecName: Full=Fatty acid oxidation complex subunit
  104::278     3e-17  34%  729 aa  FADB_CITK8 RecName: Full=Fatty acid oxidation complex subunit
   96::215     3e-17  33%  725 aa  MFPA_CUCSA RecName: Full=Glyoxysomal fatty acid beta-oxidation
  104::200     3e-17  39%  725 aa  FADB_VIBFM RecName: Full=Fatty acid oxidation complex subunit
  105::201     3e-17  42%  715 aa  FADB_PSEMY RecName: Full=Fatty acid oxidation complex subunit
  104::200     3e-17  36%  729 aa  FADB_ENT38 RecName: Full=Fatty acid oxidation complex subunit
   80::187     3e-17  41%  722 aa  ECHP_RAT RecName: Full=Peroxisomal bifunctional enzyme;       
  104::195     4e-17  41%  729 aa  FADB_SHISS RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_SHIB3 RecName: Full=Fatty acid oxidation complex subunit
  104::200     4e-17  39%  717 aa  FADB_SHEPA RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ESCF3 RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECOLI RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECOLC RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECODH RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECOBW RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECO8A RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECO55 RecName: Full=Fatty acid oxidation complex subunit
  104::195     4e-17  41%  729 aa  FADB_ECO24 RecName: Full=Fatty acid oxidation complex subunit
  104::200     6e-17  39%  717 aa  FADB_SHEHH RecName: Full=Fatty acid oxidation complex subunit
  104::200     8e-17  41%  716 aa  FADB_SHESH RecName: Full=Fatty acid oxidation complex subunit
  105::201     8e-17  41%  715 aa  FADB_PSEU5 RecName: Full=Fatty acid oxidation complex subunit
  104::193     1e-16  42%  716 aa  FADB_SHELP RecName: Full=Fatty acid oxidation complex subunit
  105::201     1e-16  40%  719 aa  FADB_PSYWF RecName: Full=Fatty acid oxidation complex subunit
  104::195     1e-16  40%  729 aa  FADB_ECOSE RecName: Full=Fatty acid oxidation complex subunit
  104::200     2e-16  38%  717 aa  FADB_SHEPW RecName: Full=Fatty acid oxidation complex subunit
  104::184     2e-16  47%  716 aa  FADB_SHEB9 RecName: Full=Fatty acid oxidation complex subunit
  104::184     3e-16  46%  716 aa  FADB_SHEB5 RecName: Full=Fatty acid oxidation complex subunit
  114::236     3e-16  39%  285 aa  ECH12_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA12;     
  114::236     3e-16  39%  285 aa  ECH12_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA12;     
   79::186     4e-16  37%  718 aa  ECHP_MOUSE RecName: Full=Peroxisomal bifunctional enzyme;       
  104::210     6e-16  41%  716 aa  FADB_SHEWM RecName: Full=Fatty acid oxidation complex subunit
   98::258     6e-16  36%  258 aa  DCH_THAAR RecName: Full=Cyclohexa-1,5-dienecarbonyl-CoA hydratase; 
  104::184     8e-16  44%  716 aa  FADB_SHEB2 RecName: Full=Fatty acid oxidation complex subunit
  104::182     1e-15  46%  716 aa  FADB_SHEON RecName: Full=Fatty acid oxidation complex subunit
  104::182     1e-15  46%  716 aa  FADB_SHESW RecName: Full=Fatty acid oxidation complex subunit
  104::182     1e-15  46%  716 aa  FADB_SHEPC RecName: Full=Fatty acid oxidation complex subunit
  124::210     2e-15  41%  725 aa  MFPA_BRANA RecName: Full=Glyoxysomal fatty acid beta-oxidation
  104::200     2e-15  38%  729 aa  FADB_YERE8 RecName: Full=Fatty acid oxidation complex subunit
  104::182     2e-15  44%  716 aa  FADB_SHESR RecName: Full=Fatty acid oxidation complex subunit
  104::182     2e-15  44%  716 aa  FADB_SHESM RecName: Full=Fatty acid oxidation complex subunit
  104::182     2e-15  44%  716 aa  FADB_SHESA RecName: Full=Fatty acid oxidation complex subunit
   99::233     3e-15  30%  726 aa  MFP_ORYSJ RecName: Full=Peroxisomal fatty acid beta-oxidation
  105::234     5e-15  35%  717 aa  FADB_ACIAD RecName: Full=Fatty acid oxidation complex subunit
  148::288     2e-14  33%  299 aa  CRTL_DICDI RecName: Full=3-hydroxybutyryl-CoA dehydratase-like
  157::248     3e-14  46%  745 aa  FADJ_YERE8 RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECOUT RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECOSM RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECOLU RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECOL5 RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECOK1 RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECO81 RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECO7I RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECO45 RecName: Full=Fatty acid oxidation complex subunit
  138::230     3e-14  45%  714 aa  FADJ_ECO27 RecName: Full=Fatty acid oxidation complex subunit
  105::189     3e-14  41%  719 aa  FADB_PSYCK RecName: Full=Fatty acid oxidation complex subunit
  105::189     3e-14  41%  719 aa  FADB_PSYA2 RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_SHISS RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_SHIFL RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_SHIF8 RecName: Full=Fatty acid oxidation complex subunit
  135::229     5e-14  45%  714 aa  FADJ_KLEP3 RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECOLI RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECOL6 RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECOHS RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECODH RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECOBW RecName: Full=Fatty acid oxidation complex subunit
  138::230     5e-14  45%  714 aa  FADJ_ECO5E RecName: Full=Fatty acid oxidation complex subunit
  138::230     6e-14  45%  714 aa  FADJ_SHIB3 RecName: Full=Fatty acid oxidation complex subunit
  138::230     6e-14  45%  714 aa  FADJ_ECOSE RecName: Full=Fatty acid oxidation complex subunit
  138::230     6e-14  45%  714 aa  FADJ_ECO8A RecName: Full=Fatty acid oxidation complex subunit
  138::230     6e-14  45%  714 aa  FADJ_ECO55 RecName: Full=Fatty acid oxidation complex subunit
  138::230     6e-14  45%  714 aa  FADJ_ECO24 RecName: Full=Fatty acid oxidation complex subunit
  120::201     6e-14  44%  715 aa  FADB_PSEFS RecName: Full=Fatty acid oxidation complex subunit
  133::257     8e-14  35%  257 aa  ECHH_RHOCA RecName: Full=Probable enoyl-CoA hydratase;       
  376::541     8e-14  28%  541 aa  CDY2_HUMAN RecName: Full=Testis-specific chromodomain protein Y 2; 
  117::253     1e-13  36%  255 aa  YHAR_BACSU RecName: Full=Putative enoyl-CoA hydratase/isomerase
  138::230     1e-13  44%  714 aa  FADJ_ECOLC RecName: Full=Fatty acid oxidation complex subunit
  138::230     2e-13  44%  714 aa  FADJ_SHIBS RecName: Full=Fatty acid oxidation complex subunit
  104::211     2e-13  39%  727 aa  FADJ_PECCP RecName: Full=Fatty acid oxidation complex subunit
  138::211     2e-13  49%  714 aa  FADJ_ECO57 RecName: Full=Fatty acid oxidation complex subunit
  137::230     2e-13  44%  714 aa  FADJ_SHIDS RecName: Full=Fatty acid oxidation complex subunit
  118::200     3e-13  41%  722 aa  FADB_COLP3 RecName: Full=Fatty acid oxidation complex subunit
  375::540     3e-13  28%  540 aa  CDY1_HUMAN RecName: Full=Testis-specific chromodomain protein Y 1; 
  120::201     4e-13  45%  715 aa  FADB_PSEFR RecName: Full=Fatty acid oxidation complex subunit
  142::196     5e-13  56%  715 aa  FADJ_PHOPR RecName: Full=Fatty acid oxidation complex subunit
  135::202     5e-13  49%  714 aa  FADJ_KLEP7 RecName: Full=Fatty acid oxidation complex subunit
   97::215     5e-13  37%  731 aa  FADJ_ERWCT RecName: Full=Fatty acid oxidation complex subunit
  120::201     5e-13  44%  715 aa  FADB_PSEPU RecName: Full=Fatty acid oxidation complex subunit
  145::209     7e-13  49%  753 aa  FADJ_YERPS RecName: Full=Fatty acid oxidation complex subunit
  172::236     7e-13  49%  774 aa  FADJ_YERPP RecName: Full=Fatty acid oxidation complex subunit
  145::209     7e-13  49%  747 aa  FADJ_YERPN RecName: Full=Fatty acid oxidation complex subunit
  145::209     7e-13  49%  747 aa  FADJ_YERPE RecName: Full=Fatty acid oxidation complex subunit
  145::209     7e-13  49%  747 aa  FADJ_YERPA RecName: Full=Fatty acid oxidation complex subunit
  145::209     7e-13  49%  747 aa  FADJ_YERP3 RecName: Full=Fatty acid oxidation complex subunit
  142::204     7e-13  51%  715 aa  FADJ_SERP5 RecName: Full=Fatty acid oxidation complex subunit
  433::598     7e-13  28%  598 aa  CDYL1_HUMAN RecName: Full=Chromodomain Y-like protein;       
  120::201     1e-12  43%  715 aa  FADB_PSEPW RecName: Full=Fatty acid oxidation complex subunit
  120::201     1e-12  40%  715 aa  FADB_PSEPF RecName: Full=Fatty acid oxidation complex subunit
  424::589     1e-12  28%  589 aa  CDYL_RAT RecName: Full=Chromodomain Y-like protein;       
  150::209     1e-12  53%  727 aa  FADJ_PHOLL RecName: Full=Fatty acid oxidation complex subunit
  120::201     1e-12  41%  715 aa  FADB_PSEE4 RecName: Full=Fatty acid oxidation complex subunit
  133::277     1e-12  32%  301 aa  ECHD1_PONAB RecName: Full=Enoyl-CoA hydratase domain-containing
  139::283     1e-12  32%  307 aa  ECHD1_HUMAN RecName: Full=Enoyl-CoA hydratase domain-containing
  115::261     2e-12  31%  385 aa  HIBCH_MOUSE RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   34::287     2e-12  26%  382 aa  HIBCH_DANRE RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  138::231     2e-12  41%  715 aa  FADJ_ENT38 RecName: Full=Fatty acid oxidation complex subunit
  120::194     2e-12  45%  715 aa  FADB_PSEPG RecName: Full=Fatty acid oxidation complex subunit
  120::201     2e-12  43%  715 aa  FADB_PSEOL RecName: Full=Fatty acid oxidation complex subunit
  120::189     2e-12  49%  715 aa  FADB_PSEF5 RecName: Full=Fatty acid oxidation complex subunit
  105::166     2e-12  48%  717 aa  FADB_ACIBY RecName: Full=Fatty acid oxidation complex subunit
  105::166     2e-12  48%  717 aa  FADB_ACIBS RecName: Full=Fatty acid oxidation complex subunit
  105::166     2e-12  48%  717 aa  FADB_ACIBC RecName: Full=Fatty acid oxidation complex subunit
  105::166     2e-12  48%  717 aa  FADB_ACIB5 RecName: Full=Fatty acid oxidation complex subunit
  105::166     2e-12  48%  717 aa  FADB_ACIB3 RecName: Full=Fatty acid oxidation complex subunit
  428::593     2e-12  27%  593 aa  CDYL_MOUSE RecName: Full=Chromodomain Y-like protein;       
  143::298     3e-12  29%  322 aa  ECHD1_MOUSE RecName: Full=Enoyl-CoA hydratase domain-containing
  138::229     3e-12  40%  714 aa  FADJ_ESCF3 RecName: Full=Fatty acid oxidation complex subunit
  131::275     3e-12  32%  299 aa  ECHD1_RAT RecName: Full=Enoyl-CoA hydratase domain-containing
  120::194     6e-12  44%  715 aa  FADB_PSEPK RecName: Full=Fatty acid oxidation complex subunit
  120::194     6e-12  44%  715 aa  FADB_PSEP1 RecName: Full=Fatty acid oxidation complex subunit
  120::189     6e-12  47%  715 aa  FADB_PSEAE RecName: Full=Fatty acid oxidation complex subunit
  120::189     6e-12  47%  715 aa  FADB_PSEAB RecName: Full=Fatty acid oxidation complex subunit
  120::189     6e-12  47%  715 aa  FADB_PSEA8 RecName: Full=Fatty acid oxidation complex subunit
  120::189     6e-12  47%  715 aa  FADB_PSEA7 RecName: Full=Fatty acid oxidation complex subunit
  140::317     6e-12  30%  327 aa  ECH1_RAT RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
   37::60      1e-11  33%  385 aa  HIBCH_RAT RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  138::282     1e-11  30%  306 aa  ECHD1_BOVIN RecName: Full=Enoyl-CoA hydratase domain-containing
  139::317     1e-11  29%  327 aa  ECH1_MOUSE RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA
  346::456     2e-11  33%  506 aa  CDYL2_HUMAN RecName: Full=Chromodomain Y-like protein 2;       
   88::240     2e-11  31%  243 aa  ECHA6_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA6;      
   88::240     2e-11  31%  243 aa  ECHA6_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA6;      
  116::238     3e-11  33%  294 aa  ECH12_MYCLE RecName: Full=Probable enoyl-CoA hydratase echA12;     
  233::389     4e-11  31%  391 aa  PECI_MOUSE RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;
  121::276     4e-11  31%  500 aa  HIBCH_YEAST RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   37::244     5e-11  24%  385 aa  HIBCH_CHICK RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
   96::211     1e-10  27%  249 aa  PKSI_BACSU RecName: Full=Putative polyketide biosynthesis enoyl-CoA
  115::221     2e-10  31%  385 aa  HIBCH_XENLA RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
    1::217     2e-10  31%  255 aa  YKB4_CAEEL RecName: Full=Uncharacterized protein B0272.4;
  136::190     3e-10  49%  687 aa  FADJ_VIBF1 RecName: Full=Fatty acid oxidation complex subunit
  115::221     4e-10  30%  385 aa  HIBCH_XENTR RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  233::389     5e-10  30%  391 aa  PECI_RAT RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;  
  132::222     2e-09  34%  386 aa  HIBCH_HUMAN RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  116::222     2e-09  31%  386 aa  HIBCH_BOVIN RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  236::362     6e-09  32%  394 aa  PECI_HUMAN RecName: Full=Peroxisomal 3,2-trans-enoyl-CoA isomerase;
   93::181     8e-08  34%  259 aa  PKSH_BACSU RecName: Full=Probable polyketide biosynthesis enoyl-CoA
  120::256     1e-07  35%  256 aa  ECH14_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA14;     
  120::256     1e-07  35%  256 aa  ECH14_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA14;     
  128::236     2e-07  28%  257 aa  ECH17_MYCPA RecName: Full=Probable enoyl-CoA hydratase echA17;     
  128::188     2e-07  39%  257 aa  ECH17_MYCA1 RecName: Full=Probable enoyl-CoA hydratase echA17;     
  558::624     3e-07  42%  789 aa  FADN_BACSU RecName: Full=Probable 3-hydroxyacyl-CoA dehydrogenase; 
  125::181     4e-07  42%  254 aa  ECH17_MYCTU RecName: Full=Probable enoyl-CoA hydratase echA17;     
  125::181     4e-07  42%  254 aa  ECH17_MYCTA RecName: Full=Probable enoyl-CoA hydratase echA17;     
  125::181     4e-07  42%  254 aa  ECH17_MYCBP RecName: Full=Probable enoyl-CoA hydratase echA17;     
  125::181     4e-07  42%  254 aa  ECH17_MYCBO RecName: Full=Probable enoyl-CoA hydratase echA17;     
  535::584     2e-06  40%  720 aa  FAD3_RICFE RecName: Full=Putative fatty acid oxidation complex
  535::590     1e-05  40%  720 aa  FAD3_RICPR RecName: Full=Putative fatty acid oxidation complex
  535::590     1e-05  40%  720 aa  FAD3_RICTY RecName: Full=Putative fatty acid oxidation complex
  135::191     2e-05  35%  703 aa  FADJ_VIBPA RecName: Full=Fatty acid oxidation complex subunit
  149::189     3e-05  46%  717 aa  FADJ_ENTS8 RecName: Full=Fatty acid oxidation complex subunit
  129::285     4e-05  25%  289 aa  D3D2_MOUSE RecName: Full=3,2-trans-enoyl-CoA isomerase,
  147::268     5e-05  31%  429 aa  HIBCH_SCHPO RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  133::189     7e-05  33%  705 aa  FADJ_VIBVY RecName: Full=Fatty acid oxidation complex subunit
  135::191     7e-05  33%  704 aa  FADJ_VIBHB RecName: Full=Fatty acid oxidation complex subunit
  129::285     7e-05  24%  289 aa  D3D2_RAT RecName: Full=3,2-trans-enoyl-CoA isomerase,
  133::189     9e-05  33%  705 aa  FADJ_VIBVU RecName: Full=Fatty acid oxidation complex subunit
  136::202     9e-05  31%  708 aa  FADJ_VIBCH RecName: Full=Fatty acid oxidation complex subunit
  136::202     9e-05  31%  708 aa  FADJ_VIBC3 RecName: Full=Fatty acid oxidation complex subunit
  136::218     3e-04  28%  381 aa  HIBCH_DICDI RecName: Full=3-hydroxyisobutyryl-CoA hydrolase,
  157::232     4e-04  30%  706 aa  FADJ_SHELP RecName: Full=Fatty acid oxidation complex subunit
  132::237     7e-04  23%  302 aa  D3D2_HUMAN RecName: Full=3,2-trans-enoyl-CoA isomerase,
   72::192     7e-04  33%  192 aa  CLPP1_CHLMU RecName: Full=ATP-dependent Clp protease proteolytic
    1::258

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPENVIIVEREGRVGIVTLNRPEVLNALNDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ECHH_RHIME      MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKAFAAGADIKEM
ECHA8_MYCTU     MTYETILVERDQRVGIITLNRPQALNALNSQ---------------------------------------
ECHA8_MYCBO     MTYETILVERDQRVGIITLNRPQALNALNSQ---------------------------------------
ECHM_DICDI      --------EKKGRVGLVTLNRPKSLNALSDGLISEINSAVKLFQEDKDVGSIIITGSEKAFAAGADIKEM
ECHA8_MYCLE     MKYDTILVDGYQRVGIITLNRPQALNALNSQ---------------------------------------
ECHM_HUMAN      -----IIAEKRGKVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEM
ECHM_MOUSE      -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEM
ECHM_PONAB      -----IIAEKRGKVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEM
ECHM_RAT        -----IITEKKGKVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM
ECHM_BOVIN      -----IITAKKGRVGLIQLNRPKALNALCNGLIVELNQALQAFEEDPAVGAIVLTGGEKVFAAGADIKEM
ECHM_CAEEL      ----MIKIEKVGEVALIKLNRPKALNALCAQLMTELADALEVLDTDKSVGAIVITGSERAFAAGADIKEM
CRT_CLOAB       MELNNVILEKEGKVAVVTINRPKALNALNSDTLKEMDYVIGEIENDSEVLAVILTGAGEKSFVAGA----
CRT_CLODI       ----------------------------------------------------------------------
PAAF_ECOLI      ----------------------------------------------------------------------
ECHD3_HUMAN     ----------------------------------------------------------------------
YNGF_BACSU      MGDSILFTVKNEHMALITLNRPQAANALSAEMLRNLQMIIQEIEFNSNIRCVILTGTGEKAFCAGADLKE
ECHD3_MOUSE     ----------------------------------------------------------------------
CAID_SALTI      ----------------------------------------------------------------------
AUHM_MOUSE      ----------------------------------------------------------------------
CAID_SALTY      ----------------------------------------------------------------------
CAID_SALSV      ----------------------------------------------------------------------
CAID_SALNS      ----------------------------------------------------------------------
CAID_SALHS      ----------------------------------------------------------------------
CAID_SALPK      ----------------------------------------------------------------------
CAID_SALPC      ----------------------------------------------------------------------
CAID_SALPA      ----------------------------------------------------------------------
CAID_SALCH      ----------------------------------------------------------------------
CAID_SALA4      ----------------------------------------------------------------------
CAID_CITK8      ----------------------------------------------------------------------
AUHM_HUMAN      ----------------------------------------------------------------------
ECHD3_RAT       ----------------------------------------------------------------------
CAID_SALPB      ----------------------------------------------------------------------
CAID_SALG2      ----------------------------------------------------------------------
CAID_SALEP      ----------------------------------------------------------------------
CAID_SALDC      ----------------------------------------------------------------------
ECH1_DICDI      ----------------------------------------------------------------------
ECHD3_XENLA     ----------------------------------------------------------------------
ECHP_PONAB      ----------------------------------------------------------------------
ECHD3_DANRE     ----------------------------------------------------------------------
ECHP_HUMAN      ----------------------------------------------------------------------
AUHM_DICDI      ----------------------------------------------------------------------
CAID_ECOLI      ----------------------------------------------------------------------
CAID_ECOLC      ----------------------------------------------------------------------
CAID_ECO57      ----------------------------------------------------------------------
CAID_ECOSM      ----------------------------------------------------------------------
CAID_ECOL6      ----------------------------------------------------------------------
CAID_ECOL5      ----------------------------------------------------------------------
CAID_SALAR      ----------------------------------------------------------------------
CAID_SHIFL      ----------------------------------------------------------------------
CAID_PROSL      ----------------------------------------------------------------------
CAID_PROMH      ----------------------------------------------------------------------
ECHA_RAT        ----------------------------------------------------------------------
ECHA_MOUSE      ----------------------------------------------------------------------
FADB_BACSU      ----------------------------------------------------------------------
ECHP_CAVPO      ----------------------------------------------------------------------
ECHA_PIG        ----------------------------------------------------------------------
FADJ_SALSV      ----------------------------------------------------------------------
ECHP_DANRE      ----------------------------------------------------------------------
ECHD2_MOUSE     ----------------------------------------------------------------------
FADB_SERP5      ----------------------------------------------------------------------
ECHD2_HUMAN     ----------------------------------------------------------------------
FADJ_SALTY      ----------------------------------------------------------------------
FADJ_SALTI      ----------------------------------------------------------------------
FADJ_SALPB      ----------------------------------------------------------------------
FADJ_SALNS      ----------------------------------------------------------------------
FADJ_SALHS      ----------------------------------------------------------------------
FADJ_SALG2      ----------------------------------------------------------------------
FADJ_SALEP      ----------------------------------------------------------------------
FADJ_SALDC      ----------------------------------------------------------------------
FADJ_SALCH      ----------------------------------------------------------------------
FADJ_SALA4      ----------------------------------------------------------------------
MMCD_ECOLI      ----------------------------------------------------------------------
FADJ_IDILO      ----------------------------------------------------------------------
FADJ_SALPK      ----------------------------------------------------------------------
FADJ_SALPA      ----------------------------------------------------------------------
FADJ_CITK8      ----------------------------------------------------------------------
ECHD2_BOVIN     ----------------------------------------------------------------------
PAAG_ECOLI      ----------------------------------------------------------------------
MENB_BACSU      ----------------------------------------------------------------------
FADB_PHOLL      ----------------------------------------------------------------------
ECHA_HUMAN      ----------------------------------------------------------------------
ECH1_HUMAN      ----------------------------------------------------------------------
FADB_VIBVY      ----------------------------------------------------------------------
FADB_VIBVU      ----------------------------------------------------------------------
ECH1_PONAB      ----------------------------------------------------------------------
FADB_VIBCM      ----------------------------------------------------------------------
FADB_VIBCH      ----------------------------------------------------------------------
FADB_VIBC3      ----------------------------------------------------------------------
MENB_PASMU      ----------------------------------------------------------------------
MENB_CYACA      ----------------------------------------------------------------------
FADB_VIBHB      ----------------------------------------------------------------------
FADB_IDILO      ----------------------------------------------------------------------
MENB_STAHJ      ----------------------------------------------------------------------
MENB_STAES      ----------------------------------------------------------------------
MENB_STAEQ      ----------------------------------------------------------------------
FADB_YERPY      ----------------------------------------------------------------------
FADB_YERPS      ----------------------------------------------------------------------
FADB_YERPP      ----------------------------------------------------------------------
FADB_YERPN      ----------------------------------------------------------------------
FADB_YERPG      ----------------------------------------------------------------------
FADB_YERPE      ----------------------------------------------------------------------
FADB_YERPB      ----------------------------------------------------------------------
FADB_YERPA      ----------------------------------------------------------------------
FADB_YERP3      ----------------------------------------------------------------------
MENB_STAAN      ----------------------------------------------------------------------
MENB_STAAM      ----------------------------------------------------------------------
FADB_PSEU2      ----------------------------------------------------------------------
FADB_PSE14      ----------------------------------------------------------------------
FADB_SALTY      ----------------------------------------------------------------------
FADB_SALTI      ----------------------------------------------------------------------
FADB_SALPK      ----------------------------------------------------------------------
FADB_SALPB      ----------------------------------------------------------------------
FADB_SALPA      ----------------------------------------------------------------------
FADB_SALG2      ----------------------------------------------------------------------
FADB_SALEP      ----------------------------------------------------------------------
FADB_SALCH      ----------------------------------------------------------------------
FADB_SALA4      ----------------------------------------------------------------------
FADB_PSESM      ----------------------------------------------------------------------
FADB_ERWCT      ----------------------------------------------------------------------
FADB_ENTS8      ----------------------------------------------------------------------
FADB_VIBSL      ----------------------------------------------------------------------
FADB_AERHH      ----------------------------------------------------------------------
FADB_SALSV      ----------------------------------------------------------------------
FADB_ECOL6      ----------------------------------------------------------------------
FADB_ECOL5      ----------------------------------------------------------------------
FADB_ECO27      ----------------------------------------------------------------------
FADB_AERS4      ----------------------------------------------------------------------
MENB_STAS1      ----------------------------------------------------------------------
MENB_STAAW      ----------------------------------------------------------------------
MENB_STAAS      ----------------------------------------------------------------------
MENB_STAAR      ----------------------------------------------------------------------
MENB_STAAC      ----------------------------------------------------------------------
FADB_SHEAM      ----------------------------------------------------------------------
FADB_SALNS      ----------------------------------------------------------------------
FADB_ENTCL      ----------------------------------------------------------------------
MENB_HAEIN      ----------------------------------------------------------------------
FADB_VIBPA      ----------------------------------------------------------------------
FADB_SHIFL      ----------------------------------------------------------------------
FADB_SHIF8      ----------------------------------------------------------------------
FADB_SHIDS      ----------------------------------------------------------------------
FADB_SHEFN      ----------------------------------------------------------------------
FADB_KLEP7      ----------------------------------------------------------------------
FADB_KLEP3      ----------------------------------------------------------------------
FADB_ECOSM      ----------------------------------------------------------------------
FADB_ECOLU      ----------------------------------------------------------------------
FADB_ECOHS      ----------------------------------------------------------------------
FADB_ECO7I      ----------------------------------------------------------------------
FADB_ECO5E      ----------------------------------------------------------------------
FADB_ECO57      ----------------------------------------------------------------------
MENB_ECOLI      ----------------------------------------------------------------------
MENB_ECOL6      ----------------------------------------------------------------------
FADB_PHOPR      ----------------------------------------------------------------------
FADB_ECOUT      ----------------------------------------------------------------------
FADB_ECO81      ----------------------------------------------------------------------
FADB_ECO45      ----------------------------------------------------------------------
FADB_ALISL      ----------------------------------------------------------------------
FADB_VIBF1      ----------------------------------------------------------------------
FADB_SHEB8      ----------------------------------------------------------------------
FADB_CITK8      ----------------------------------------------------------------------
MFPA_CUCSA      ----------------------------------------------------------------------
FADB_VIBFM      ----------------------------------------------------------------------
FADB_PSEMY      ----------------------------------------------------------------------
FADB_ENT38      ----------------------------------------------------------------------
ECHP_RAT        ----------------------------------------------------------------------
FADB_SHISS      ----------------------------------------------------------------------
FADB_SHIB3      ----------------------------------------------------------------------
FADB_SHEPA      ----------------------------------------------------------------------
FADB_ESCF3      ----------------------------------------------------------------------
FADB_ECOLI      ----------------------------------------------------------------------
FADB_ECOLC      ----------------------------------------------------------------------
FADB_ECODH      ----------------------------------------------------------------------
FADB_ECOBW      ----------------------------------------------------------------------
FADB_ECO8A      ----------------------------------------------------------------------
FADB_ECO55      ----------------------------------------------------------------------
FADB_ECO24      ----------------------------------------------------------------------
FADB_SHEHH      ----------------------------------------------------------------------
FADB_SHESH      ----------------------------------------------------------------------
FADB_PSEU5      ----------------------------------------------------------------------
FADB_SHELP      ----------------------------------------------------------------------
FADB_PSYWF      ----------------------------------------------------------------------
FADB_ECOSE      ----------------------------------------------------------------------
FADB_SHEPW      ----------------------------------------------------------------------
FADB_SHEB9      ----------------------------------------------------------------------
FADB_SHEB5      ----------------------------------------------------------------------
ECH12_MYCTU     ----------------------------------------------------------------------
ECH12_MYCBO     ----------------------------------------------------------------------
ECHP_MOUSE      ----------------------------------------------------------------------
FADB_SHEWM      ----------------------------------------------------------------------
DCH_THAAR       ----------------------------------------------------------------------
FADB_SHEB2      ----------------------------------------------------------------------
FADB_SHEON      ----------------------------------------------------------------------
FADB_SHESW      ----------------------------------------------------------------------
FADB_SHEPC      ----------------------------------------------------------------------
MFPA_BRANA      ----------------------------------------------------------------------
FADB_YERE8      ----------------------------------------------------------------------
FADB_SHESR      ----------------------------------------------------------------------
FADB_SHESM      ----------------------------------------------------------------------
FADB_SHESA      ----------------------------------------------------------------------
MFP_ORYSJ       ----------------------------------------------------------------------
FADB_ACIAD      ----------------------------------------------------------------------
CRTL_DICDI      ----------------------------------------------------------------------
FADJ_YERE8      ----------------------------------------------------------------------
FADJ_ECOUT      ----------------------------------------------------------------------
FADJ_ECOSM      ----------------------------------------------------------------------
FADJ_ECOLU      ----------------------------------------------------------------------
FADJ_ECOL5      ----------------------------------------------------------------------
FADJ_ECOK1      ----------------------------------------------------------------------
FADJ_ECO81      ----------------------------------------------------------------------
FADJ_ECO7I      ----------------------------------------------------------------------
FADJ_ECO45      ----------------------------------------------------------------------
FADJ_ECO27      ----------------------------------------------------------------------
FADB_PSYCK      ----------------------------------------------------------------------
FADB_PSYA2      ----------------------------------------------------------------------
FADJ_SHISS      ----------------------------------------------------------------------
FADJ_SHIFL      ----------------------------------------------------------------------
FADJ_SHIF8      ----------------------------------------------------------------------
FADJ_KLEP3      ----------------------------------------------------------------------
FADJ_ECOLI      ----------------------------------------------------------------------
FADJ_ECOL6      ----------------------------------------------------------------------
FADJ_ECOHS      ----------------------------------------------------------------------
FADJ_ECODH      ----------------------------------------------------------------------
FADJ_ECOBW      ----------------------------------------------------------------------
FADJ_ECO5E      ----------------------------------------------------------------------
FADJ_SHIB3      ----------------------------------------------------------------------
FADJ_ECOSE      ----------------------------------------------------------------------
FADJ_ECO8A      ----------------------------------------------------------------------
FADJ_ECO55      ----------------------------------------------------------------------
FADJ_ECO24      ----------------------------------------------------------------------
FADB_PSEFS      ----------------------------------------------------------------------
ECHH_RHOCA      ----------------------------------------------------------------------
CDY2_HUMAN      ----------------------------------------------------------------------
YHAR_BACSU      ----------------------------------------------------------------------
FADJ_ECOLC      ----------------------------------------------------------------------
FADJ_SHIBS      ----------------------------------------------------------------------
FADJ_PECCP      ----------------------------------------------------------------------
FADJ_ECO57      ----------------------------------------------------------------------
FADJ_SHIDS      ----------------------------------------------------------------------
FADB_COLP3      ----------------------------------------------------------------------
CDY1_HUMAN      ----------------------------------------------------------------------
FADB_PSEFR      ----------------------------------------------------------------------
FADJ_PHOPR      ----------------------------------------------------------------------
FADJ_KLEP7      ----------------------------------------------------------------------
FADJ_ERWCT      ----------------------------------------------------------------------
FADB_PSEPU      ----------------------------------------------------------------------
FADJ_YERPS      ----------------------------------------------------------------------
FADJ_YERPP      ----------------------------------------------------------------------
FADJ_YERPN      ----------------------------------------------------------------------
FADJ_YERPE      ----------------------------------------------------------------------
FADJ_YERPA      ----------------------------------------------------------------------
FADJ_YERP3      ----------------------------------------------------------------------
FADJ_SERP5      ----------------------------------------------------------------------
CDYL1_HUMAN     ----------------------------------------------------------------------
FADB_PSEPW      ----------------------------------------------------------------------
FADB_PSEPF      ----------------------------------------------------------------------
CDYL_RAT        ----------------------------------------------------------------------
FADJ_PHOLL      ----------------------------------------------------------------------
FADB_PSEE4      ----------------------------------------------------------------------
ECHD1_PONAB     ----------------------------------------------------------------------
ECHD1_HUMAN     ----------------------------------------------------------------------
HIBCH_MOUSE     ----------------------------------------------------------------------
HIBCH_DANRE     -----VLFEKVGKAGVITLNRPKALNALNMIRHIYPQLKKWDKDSETDIVIIKGAGEKAFCAGGDIRAIA
FADJ_ENT38      ----------------------------------------------------------------------
FADB_PSEPG      ----------------------------------------------------------------------
FADB_PSEOL      ----------------------------------------------------------------------
FADB_PSEF5      ----------------------------------------------------------------------
FADB_ACIBY      ----------------------------------------------------------------------
FADB_ACIBS      ----------------------------------------------------------------------
FADB_ACIBC      ----------------------------------------------------------------------
FADB_ACIB5      ----------------------------------------------------------------------
FADB_ACIB3      ----------------------------------------------------------------------
CDYL_MOUSE      ----------------------------------------------------------------------
ECHD1_MOUSE     ----------------------------------------------------------------------
FADJ_ESCF3      ----------------------------------------------------------------------
ECHD1_RAT       ----------------------------------------------------------------------
FADB_PSEPK      ----------------------------------------------------------------------
FADB_PSEP1      ----------------------------------------------------------------------
FADB_PSEAE      ----------------------------------------------------------------------
FADB_PSEAB      ----------------------------------------------------------------------
FADB_PSEA8      ----------------------------------------------------------------------
FADB_PSEA7      ----------------------------------------------------------------------
ECH1_RAT        ----------------------------------------------------------------------
HIBCH_RAT       -----VLLERRGCAGVITLNRPKLLNALS-----------------------------------------
ECHD1_BOVIN     ----------------------------------------------------------------------
ECH1_MOUSE      ----------------------------------------------------------------------
CDYL2_HUMAN     ----------------------------------------------------------------------
ECHA6_MYCTU     ----------------------------------------------------------------------
ECHA6_MYCBO     ----------------------------------------------------------------------
ECH12_MYCLE     ----------------------------------------------------------------------
PECI_MOUSE      ----------------------------------------------------------------------
HIBCH_YEAST     ----------------------------------------------------------------------
HIBCH_CHICK     -----VLLQKQGGAGIITLNRPKVLNALSFKMIQQIYPQIKAWEQDPETFLIIIKGTGEKAFCAGGDVRA
PKSI_BACSU      ----------------------------------------------------------------------
HIBCH_XENLA     ----------------------------------------------------------------------
YKB4_CAEEL      MTSGLILTERKNNVLWVTLNRPKKFNALTRQMFLDLCTXXXXXXXXXXXXXXXXTGGKGKYYCAGSDFSP
FADJ_VIBF1      ----------------------------------------------------------------------
HIBCH_XENTR     ----------------------------------------------------------------------
PECI_RAT        ----------------------------------------------------------------------
HIBCH_HUMAN     ----------------------------------------------------------------------
HIBCH_BOVIN     ----------------------------------------------------------------------
PECI_HUMAN      ----------------------------------------------------------------------
PKSH_BACSU      ----------------------------------------------------------------------
ECH14_MYCTU     ----------------------------------------------------------------------
ECH14_MYCBO     ----------------------------------------------------------------------
ECH17_MYCPA     ----------------------------------------------------------------------
ECH17_MYCA1     ----------------------------------------------------------------------
FADN_BACSU      ----------------------------------------------------------------------
ECH17_MYCTU     ----------------------------------------------------------------------
ECH17_MYCTA     ----------------------------------------------------------------------
ECH17_MYCBP     ----------------------------------------------------------------------
ECH17_MYCBO     ----------------------------------------------------------------------
FAD3_RICFE      ----------------------------------------------------------------------
FAD3_RICPR      ----------------------------------------------------------------------
FAD3_RICTY      ----------------------------------------------------------------------
FADJ_VIBPA      ----------------------------------------------------------------------
FADJ_ENTS8      ----------------------------------------------------------------------
D3D2_MOUSE      ----------------------------------------------------------------------
HIBCH_SCHPO     ----------------------------------------------------------------------
FADJ_VIBVY      ----------------------------------------------------------------------
FADJ_VIBHB      ----------------------------------------------------------------------
D3D2_RAT        ----------------------------------------------------------------------
FADJ_VIBVU      ----------------------------------------------------------------------
FADJ_VIBCH      ----------------------------------------------------------------------
FADJ_VIBC3      ----------------------------------------------------------------------
HIBCH_DICDI     ----------------------------------------------------------------------
FADJ_SHELP      ----------------------------------------------------------------------
D3D2_HUMAN      ----------------------------------------------------------------------
CLPP1_CHLMU     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XEWSYSDVYSSNFITRNWETIKRVRKPVLASVAGLAFGGGCELALACDIIVAARSAKFALPEIKLGLLPG
ECHH_RHIME      QGLDFVDGYLADFLG-GWEHVANARKPMIAAVSGFALGGGCELAMMCDFIIASETAKFGQPEITLGVIPG
ECHA8_MYCTU     -----------------WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPG
ECHA8_MYCBO     -----------------WGKLAAVRTPTIAAVAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPG
ECHM_DICDI      EKVTLPDAYNNDLLAQ-WHDLTKIRKPIIAAVNGYALGGGCELAMMCDIIIAGEKAVFGQPEIKLGTIPG
ECHA8_MYCLE     -----------------WGKLAAVRTPMIAAVAGYALGGGCELAMMCDLLIAADTAKFGQPEIKLGVLPG
ECHM_HUMAN      QNLSFQDCYSSKFL-KHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPG
ECHM_MOUSE      QNRTFQDCYSSKFLS-HWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
ECHM_PONAB      QNLSFQDCYSSKFL-KHWDHLTQIKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPG
ECHM_RAT        QNRTFQDCYSGKFLS-HWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPG
ECHM_BOVIN      QSLTFQNCYSGGFLS-HWDQLTRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILIGTIPG
ECHM_CAEEL      TNNEFATTFSGSFLS-NWTAVSDVKKPVIAAVNGFALGGGNELAMMCDIIYAGEKARFGQPEINIGTIPG
CRT_CLOAB       ---DISEMKEMNTINKVFRRLELLEKPVIAAVNGFALGGGCEIAMSCDIRIASSNARFGQPEVGLGITPG
CRT_CLODI       ------------------------KKVVIAAVNGFALGG-CELAMACDIRIASAKAKFGQPEVTLGITPG
PAAF_ECOLI      -----------------WARLQAFNKPLIAAVNGYXXXXXXXXXXXXDVVVAGENARFGLPEITLGIMPG
ECHD3_HUMAN     --------------------------PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
YNGF_BACSU      RIKLKEDLESVSLIQRTAALLDALPQPVIAAINXXXXXXXXXXXXXCDLRIATEAAVLGLPETGLAIIPG
ECHD3_MOUSE     --------------------------PILAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
CAID_SALTI      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
AUHM_MOUSE      ----------------------------------------------CDIRVAASSAKMGLVETKLAIIPG
CAID_SALTY      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALSV      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALNS      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALHS      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALPK      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALPC      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALPA      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALCH      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALA4      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_CITK8      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
AUHM_HUMAN      ----------------------------------------------CDIRVAASSAKMGLVETKLAIIPG
ECHD3_RAT       --------------------------PIVAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCS
CAID_SALPB      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALG2      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALEP      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
CAID_SALDC      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCAENASFALPEAKLGIVPD
ECH1_DICDI      ---------------RRWQAINKCSKPTIALIHGACIGGGVDMITACDIRLCSSDAKFSIRETKLSIIAD
ECHD3_XENLA     --------------------------PVIAEVNGLATAAGCQLVASCDIAVASDKSRFATPGVNVGLFCS
ECHP_PONAB      ------------------DEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHSEAQVGLPEVTLGLLPG
ECHD3_DANRE     --------------------------PVIAMVNGVATAAGCQLVASCDVAVASEKSTFATPGVNVGLFPA
ECHP_HUMAN      ------------------DEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPG
AUHM_DICDI      ------------------------------------------MVLACDFRVASKSSKMGLPETGLAIIPG
CAID_ECOLI      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_ECOLC      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_ECO57      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_ECOSM      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_ECOL6      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_ECOL5      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_SALAR      -----------------------LNKPVIAAVNXXXXXXXXXXXXXXDFIICADHASFALPEAKLGIVPD
CAID_SHIFL      -------------------------KPVIAAVNXXXXXXXXXXXXXXDFIVCADNASFALPEAKLGIVPD
CAID_PROSL      -----------------------LNKPVIAAINXXXXXXXXXXXXXXDMIICSDNASFALPEAQLGIVPD
CAID_PROMH      -----------------------LNKPVIAAINXXXXXXXXXXXXXXDMIICSDNASFALPEAQLGIVPD
ECHA_RAT        -----------------FEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLPEVLLGILPG
ECHA_MOUSE      ---------------RMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLPEVLLGILPG
FADB_BACSU      ----------------------------------------------CHIRIAAEDAKLGLPELNLGIIPG
ECHP_CAVPO      ------------------DEMQRYEKPVVAAIQGMALGGGLELSLGCHYRIAHAEARIGFPEVTLGILPG
ECHA_PIG        ---------------RTFEKLEKSTKPIVAAINGTCLGGGLELAISCQYRIATKDKKTVLPEVLLGILPG
FADJ_SALSV      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
ECHP_DANRE      ------------------DAIEAGEKPVVAAIEGVALGGGFELALVCHYRIAHYKARLGLPEVTLGILPA
ECHD2_MOUSE     -----SDVEVGTFVQRLRGLMSEIAAPTIAAMDXXXXXXXXXXXXXCDLRIAASSAVMGLIETTRGLLPG
FADB_SERP5      -----------NFANAIFNRLEDLPVPTISAINGYALGGGCECILATDFRVASPDARIGLPETKLGIMPG
ECHD2_HUMAN     ----------------------------------------------CDLRVAASSAVMGLIETTRGLLPG
FADJ_SALTY      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALTI      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALPB      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALNS      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALHS      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALG2      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALEP      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALDC      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALCH      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALA4      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
MMCD_ECOLI      --------------------IQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYN
FADJ_IDILO      -----------------FDRIEQLNVPVVAAINGACLGGGLELAMACHVRVCTDNSKTALPEVKLGLLPG
FADJ_SALPK      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_SALPA      --------------------IQALPVPVIAAIHGACLGGGLEMALACHRRICTDDVKLGLPEVQLGLLPG
FADJ_CITK8      --------------------IQALSVPVVAAIHGACLGGGLEMALACHRRICTDDAKLGLPEVQLGLLPG
ECHD2_BOVIN     ----------------------------------------------CDLRVAASSAVMGLIETTRGLLPG
PAAG_ECOLI      --------------------LAKLPKPVICXXXXXXXXXXXXXXXXXDIVIAARSAKFVMAFSKLGLIPD
MENB_BACSU      --------------------IRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAADNAIFGQTGPKVGSFDA
FADB_PHOLL      -----------NFSNSIFNRIEDLPVPTISAINGYALGGGCECVLSTDFRVASPDIRIGLPETKLGIMPG
ECHA_HUMAN      ------------------EKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLPEVLLGALPG
ECH1_HUMAN      --------YLRDIITRYQETIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAAD
FADB_VIBVY      --------------------------PTVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGIMPG
FADB_VIBVU      --------------------------PTVAVVKGHTLGGGCECVLATDLRIGDKTTSIGLPETKLGIMPG
ECH1_PONAB      --------YLRDIITRYQETIEKCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAAD
FADB_VIBCM      ------------FANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGIMPG
FADB_VIBCH      ------------FANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGIMPG
FADB_VIBC3      ------------FANRIFNKLEDLPFPTLSALKGHTLGGGCECVLATDFRIGDATTSIGLPETKLGIMPG
MENB_PASMU      --------------------IRTCPKPVVAMVAGYAIGGGHVLHMICDLTIAADNAIFGQTGPKVGSFDG
MENB_CYACA      --------------------IRTFPKPVIAKVSGYAVGGGQILNMMCDLTIASENAVLGQSGPKVGSFDA
FADB_VIBHB      --------------------------PTISVLKGHTLGGGCECVLATDMRIGDKTTSIGLPETKLGIMPG
FADB_IDILO      -------LFSDQEKTRSWDQLEDLPVPTVGAVTGFALGGGCEALLACDYRVADTTATIGLPEVKLGLIPG
MENB_STAHJ      --------------------IRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAES      --------------------IRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAEQ      --------------------IRVIPKPVIAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
FADB_YERPY      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPS      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPP      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPN      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPG      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPE      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPB      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERPA      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
FADB_YERP3      --------------------------PTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPG
MENB_STAAN      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAAM      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
FADB_PSEU2      --------------------------PTVVAINGIALGGGLEMCLAADYRVMASSARIGLPEVKLGLYPG
FADB_PSE14      --------------------------PTVVAINGIALGGGLEMCLAADYRVISSSARIGLPEVKLGLYPG
FADB_SALTY      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALTI      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALPK      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALPB      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALPA      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALG2      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALEP      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALCH      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SALA4      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_PSESM      --------------------------PTVVAINGIALGGGLEMCLAADYRVISSSARVGLPEVKLGLYPG
FADB_ERWCT      --------------------------PTLSAINSYALGGGCECVLATDFRLATPDARIGLPETKLGIMPG
FADB_ENTS8      --------------------------PTLCAINGYALGGGCECVLATDFRLATPDARIGLPETKLGIMPG
FADB_VIBSL      --------------------------PTLSMMRGHALGGGCECVLATDFRIGDKTTSIGLPETKLGIMPG
FADB_AERHH      -----------------FSAIEDLPVPTLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGIMPG
FADB_SALSV      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOL6      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOL5      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO27      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_AERS4      -----------------FSAIEDLPVPTLSAIKGHALGGGCETILSTDFRLADTSAKIGLPETKLGIMPG
MENB_STAS1      --------------------IRVIPKPVVAMVRGYAIGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAAW      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAAS      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAAR      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
MENB_STAAC      --------------------IRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDA
FADB_SHEAM      --------------------------PTVSAIKGFALGGGCEAILATDFRVADTSAKIGLPETKLGLIPG
FADB_SALNS      --------------------------PTLAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ENTCL      --------------------------PTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETRLGIMPG
MENB_HAEIN      --------------------IRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAAENAIFGQTGPKVGSFDG
FADB_VIBPA      --------------------------PTISVLKGHTLGGGCECVLATDMRIGDKTTSIGLPETKLGIMPG
FADB_SHIFL      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHIF8      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHIDS      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHEFN      --------------------------PTASAINGFALGGGCETILATDLRVADTNARIGLPETKLGLIPG
FADB_KLEP7      --------------------------PTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_KLEP3      --------------------------PTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOSM      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOLU      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOHS      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO7I      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO5E      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO57      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
MENB_ECOLI      --------------------IRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDG
MENB_ECOL6      --------------------IRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDG
FADB_PHOPR      --------------------------PTLSAINGHALGGGCECVLATDFRLADITARIGLPETRLGIMPG
FADB_ECOUT      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO81      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO45      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ALISL      --------------------------PTLSAITGFALGGGCECVLATDFRLADDTASIGLPETQLGIMPG
FADB_VIBF1      --------------------------PTLSAITGFALGGGCECVLATDFRLADETASIGLPETQLGIMPG
FADB_SHEB8      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
FADB_CITK8      --------------------------PTLSAINGYALGGGCECVLATDYRLVTPDLRIGLPETKLGIMPG
MFPA_CUCSA      ------------------DIFEAARKPXXXXXXXXXXXXXXEVAMACHARISTPTAQLGLPELQLGIIPG
FADB_VIBFM      --------------------------PTLSAITGFALGGGCECVLATDFRLADETASIGLPETQLGIMPG
FADB_PSEMY      --------------------------PTVVAINGIALGGGFEMCLAGDYRVMSETAKIGLPEVKLGIYPG
FADB_ENT38      --------------------------PTISAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
ECHP_RAT        ------------------DEIQRYQKPVLAAIQGVXXXXXXXXXXXCHYRIANAKARVGLPEVTLGILPG
FADB_SHISS      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHIB3      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHEPA      --------------------------PTISAINGFALGAGCETILATDFRIADTTARIGLPETKLGIIPG
FADB_ESCF3      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOLI      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOLC      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECODH      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECOBW      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO8A      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO55      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_ECO24      --------------------------PTIAAVNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHEHH      --------------------------PTLSAINGFALGAGCETILATDFRIADTTARIGLPETKLGIIPG
FADB_SHESH      --------------------------PTISAINGFALGGGFETVLATDFRIADTTAKIGLPETKLGLIPG
FADB_PSEU5      --------------------------PTVVAINGIALGGGFEMCMAADYRVMSTTAKVGLPEVKLGIYPG
FADB_SHELP      --------------------------PTISAIKGFALGGGCETILATDLRIADTSARIGLPETKLGIIPG
FADB_PSYWF      --------------------------PKVAAINGAALGGGCEMTLVCEYRVMGDKAQIGLPETQLGIFPG
FADB_ECOSE      --------------------------PTIAAANGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPG
FADB_SHEPW      --------------------------PTISAINGFALGAGCETILATDFRVADTTARIGLPETKLGIIPG
FADB_SHEB9      --------------------------PTASAIKGFALGGGCETILATDFRVADTTAKIGLPETKLGIIPG
FADB_SHEB5      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
ECH12_MYCTU     --------------------LRRLHQPVIAAVNGPAIXXXXXXXXXXDIRVASSSAYFRAAGINNGLTAS
ECH12_MYCBO     --------------------LRRLHQPVIAAVNGPAIXXXXXXXXXXDIRVASSSAYFRAAGINNGLTAS
ECHP_MOUSE      ------------------DEIQRYQKPVVAAIQGVXXXXXXXXXXXCHYRIANAKARVGFPEVMLGILPG
FADB_SHEWM      --------------------------PTISAINGFALGGGFETVLATDFRIADTTAKLGLPETKLGLIPG
DCH_THAAR       --------------------------PILVALRGQCLGGGLEVAAAGNLLFAAPDAKFGQPEIRLGVFAP
FADB_SHEB2      --------------------------PTASAIKGFALGGGCETILTTDFRIADTTAKIGLPETKLGIIPG
FADB_SHEON      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
FADB_SHESW      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
FADB_SHEPC      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
MFPA_BRANA      ----------------------------------------------CHARISAPGAQLGLPELQLGVIPG
FADB_YERE8      --------------------------PTIAAINGYALGGGCECILATDFRVASPEARIGLPETKLGIMPG
FADB_SHESR      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
FADB_SHESM      --------------------------PTASAIKGFALGGGCEAILATDFRIADTTAKIGLPETKLGIIPG
FADB_SHESA      --------------------------PTASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPG
MFP_ORYSJ       ------------------------KKPSVAAIQXXXXXXXXXXTMGCHARISTPEAQLGLPELTLGIIPG
FADB_ACIAD      --------------------------PKVAAINGMALGGGFEMCLVCDYRVMSDQAQVGLPEIKLGIFPG
CRTL_DICDI      ------------------------------------------LALATDIRVVSNKAPVGLTFTKLGIHPG
FADJ_YERE8      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOUT      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOSM      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOLU      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOL5      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOK1      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO81      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO7I      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO45      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO27      -----------------------------------------------------------LPEVQLGLLPG
FADB_PSYCK      --------------------------PKVAAINGAALGGGCEMTLVCEYRVMSDKAIIGLPETQLGIFPG
FADB_PSYA2      --------------------------PKVAAINGAALGGGCEMTLVCEYRVMSDKAIIGLPETQLGIFPG
FADJ_SHISS      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SHIFL      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SHIF8      -----------------------------------------------------------LPEVQLGLLPG
FADJ_KLEP3      --------------------------------------------------------RLGLPEVQLGLLPG
FADJ_ECOLI      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOL6      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOHS      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECODH      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOBW      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO5E      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SHIB3      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECOSE      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO8A      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO55      -----------------------------------------------------------LPEVQLGLLPG
FADJ_ECO24      -----------------------------------------------------------LPEVQLGLLPG
FADB_PSEFS      -----------------------------------------EMCLAADFRVMSATAKIGLPEVKLGIYPG
ECHH_RHOCA      ---------------------------------------------------------------RIGLMPD
CDY2_HUMAN      -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
YHAR_BACSU      -----------------------------------------------DIVLAEKNAVLAMNFIGIGLVPD
FADJ_ECOLC      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SHIBS      -----------------------------------------------------------LPEVQLGLLPG
FADJ_PECCP      -----------------FEQIAALPFPVVAAIHXXXXXXXXXXXXXXDYRVCSLDEKLGLPEVQLGLLPG
FADJ_ECO57      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SHIDS      ----------------------------------------------------------SLPEVQLGLLPG
FADB_COLP3      ----------------------------------------CEMTLACDYRVAATTASIGLPEVKLGLMPG
CDY1_HUMAN      -------------------TFIQFKKPIVVSVNGPAIGLGASILPLCDLVWANEKAWFQTPYTTFGQSPD
FADB_PSEFR      -----------------------------------------EMCLAADFRVMADSAKIGLPEVKLGIYPG
FADJ_PHOPR      --------------------------------------------------------RLGLPEVQLGLLPG
FADJ_KLEP7      --------------------------------------------------------RLGLPEVQLGLLPG
FADJ_ERWCT      ---------AENLAKQGQETFDQIAAPVVAAIHXXXXXXXXXXXXXXDYRVCSLDEKLGLPEVQLGLLPG
FADB_PSEPU      -----------------------------------------EMCLAADYRVMSTSAKIGLPEVKLGIYPG
FADJ_YERPS      -----------------------------------------------------------LPEVQLGLLPG
FADJ_YERPP      -----------------------------------------------------------LPEVQLGLLPG
FADJ_YERPN      -----------------------------------------------------------LPEVQLGLLPG
FADJ_YERPE      -----------------------------------------------------------LPEVQLGLLPG
FADJ_YERPA      -----------------------------------------------------------LPEVQLGLLPG
FADJ_YERP3      -----------------------------------------------------------LPEVQLGLLPG
FADJ_SERP5      -----------------------------------------------------------LPEVQLGLLPG
CDYL1_HUMAN     -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
FADB_PSEPW      -----------------------------------------EMCLAADYRVMSTSAKIGLPEVKLGIYPG
FADB_PSEPF      -----------------------------------------EMCLAADYRVMSTKAKIGLPEVKLGIYPG
CDYL_RAT        -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
FADJ_PHOLL      --------------------------------------------------------RLGLPEVQLGLLPG
FADB_PSEE4      -----------------------------------------EMCLAADYRIMSSSAKIGLPEVKLGIYPG
ECHD1_PONAB     -------------------TLTRFMRLPLISVAGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPS
ECHD1_HUMAN     -------------------TLTRFMRLPLISVAGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPS
HIBCH_MOUSE     ------DLFREEYILNN--AIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPD
HIBCH_DANRE     EAGKAGNLLSQVFFREEYNTIGTYQKPYVALINGITMGGGVGLSVHGQFRVATEKTLFAMPETGIGLFPD
FADJ_ENT38      -----------------------------------------------------------LPEVQLGLLPG
FADB_PSEPG      -----------------------------------------EMCLAADYRVMSNSAKIGLPEVKLGIYPG
FADB_PSEOL      -----------------------------------------EMCLAADYRVMSTSAKIGLPEVKLGIYPG
FADB_PSEF5      -----------------------------------------EMCLAADYRVMAASAKIGLPEVKLGIYPG
FADB_ACIBY      --------------------------PKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPG
FADB_ACIBS      --------------------------PKVAAINGIALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPG
FADB_ACIBC      --------------------------PKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPG
FADB_ACIB5      --------------------------PKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPG
FADB_ACIB3      --------------------------PKVAAINGMALGGGFEMCLVCDYRVMSEAAQVGLPEIKLGIYPG
CDYL_MOUSE      -------------------TFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQSPD
ECHD1_MOUSE     -----SGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHKEMGIVPS
FADJ_ESCF3      -----------------------------------------------------------LPEVQLGLLPG
ECHD1_RAT       -------------------TLTRFMRLPLISVAGWAMGGGAELTTACDFRLMTEESVIRFVHKEMGIVPS
FADB_PSEPK      -----------------------------------------EMCLAADYRVMSTSARIGLPEVKLGIYPG
FADB_PSEP1      -----------------------------------------EMCLAADYRVMSTSARIGLPEVKLGIYPG
FADB_PSEAE      -----------------------------------------EMCLAADFRVMSATAKVGLPEVKLGIYPG
FADB_PSEAB      -----------------------------------------EMCLAADFRVMSATAKVGLPEVKLGIYPG
FADB_PSEA8      -----------------------------------------EMCLAADFRVMSATAKVGLPEVKLGIYPG
FADB_PSEA7      -----------------------------------------EMCLAADFRVMSATAKVGLPEVKLGIYPG
ECH1_RAT        --------YLRDLISRYQKTIEKCPKPVXXXXXXXXXXXXVDLISACDIRYCTQDAFFQVKEVDVGLAAD
HIBCH_RAT       ------DLFREEYILNN--AIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERSLFAMPETGIGLFPD
ECHD1_BOVIN     -------------------TLTRFMRLPLISVAGRALGGGAEVTTACDFRLMTTESEIRFVHKEMGIIPS
ECH1_MOUSE      --WYLRDLISK--YQKTFTVIEKCPKPVXXXXXXXXXXXXVDLVSACDIRYCTQDAFFQIKEVDMGLAAD
CDYL2_HUMAN     ------------------------KKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPA
ECHA6_MYCTU     --------------------------PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALD
ECHA6_MYCBO     --------------------------PVVGAINGPAIGAGLQLAMQCDLRVVAPDAFFQFPTSKYGLALD
ECH12_MYCLE     --------------------LRRLHQPVXXXXXXXXXXXXXXXXXXXDVRVASTRAYFRAAGINNGLSAS
PECI_MOUSE      -------------------------KPLVAVVNGPAVGISVTLLGLFDAVFASDRATFHTPFSQLGQSPE
HIBCH_YEAST     ----FTDEYSLNF------QIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD
HIBCH_CHICK     IAGKAGDTMTRDYFREEYRAIGTCKKPYVALIDGITMGGGVGLSVHGHFRVATEKTVFAMPETAIGLFPD
PKSI_BACSU      --------------------------PVIAAMQGHGIGGGFVMGLFADIVILSRESVYTANFMKYGFTPG
HIBCH_XENLA     ------DFFREEYILNN--AIGTCKKPYVAVIDGITMGGGVGLSVHGHFRVASEKTLFAMPETAIGLFPD
YKB4_CAEEL      AELSTLTDIQEHGYKLFVDILIAFPKPIIALVNGHAVGVSVTMLGVMDAVIAIDTATFATPFADIGVCPE
FADJ_VIBF1      --------------------------------------------------------KLGLPEVQLGLLPG
HIBCH_XENTR     ------DFFREEYILNN--AIGTYKKPYVALIDGITMGGGVGLSVHGHFRVASENTLFAMPETAIGLFPD
PECI_RAT        -------------------------KPLVAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE
HIBCH_HUMAN     ------------------------QKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPD
HIBCH_BOVIN     ------DLFREEYILNN--AIDSCQKPYIALIHGITMGGGVGVSVHGQFRVATEKSVFAMPETAIGLFPD
PECI_HUMAN      -------------------------KPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPE
PKSH_BACSU      -----------------WMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYP-
ECH14_MYCTU     -----------------------------------------------DVRIAGPAALFDARFQKLGLHPG
ECH14_MYCBO     -----------------------------------------------DVRIAGPAALFDARFQKLGLHPG
ECH17_MYCPA     --------------------------------------------------ISGDNVKFGATEILAGLVPG
ECH17_MYCA1     --------------------------------------------------ISGDNVKFGATEILAGLVPG
FADN_BACSU      -------------IRRFQETMMKIKKPVVAAPFGMTLGGGTEACLPAARIQAASEAYMGLVESGVGLIPG
ECH17_MYCTU     --------------------------------------------------VSGDNVKFGATEILAGLIPS
ECH17_MYCTA     --------------------------------------------------VSGDNVKFGATEILAGLIPS
ECH17_MYCBP     --------------------------------------------------VSGDNVKFGATEILAGLIPS
ECH17_MYCBO     --------------------------------------------------VSGDNVKFGATEILAGLIPS
FAD3_RICFE      ---------------------------IISCAKGVALGGGCELLLYSSYIVANQELNAGLVELGVGLIPG
FAD3_RICPR      ---------------------------IISCARGVALGGGCELLLNSSYIVANQELNAGLIELGVGLIPG
FAD3_RICTY      ---------------------------IISCARGVALGGGCELLLNSSYIVANQELNAGLIEFGVGLIPG
FADJ_VIBPA      --------------------------------------------------------RLGLPEVQLGLLPG
FADJ_ENTS8      ----------------------------------------------------------------------
D3D2_MOUSE      ---------------------------LVSAINGASPAGGCLLALCCDYRVMADNPKYGLNESLLGIVAP
HIBCH_SCHPO     -------------------TLATYQKPVVALMNGITMGGGSGLAMHVPFRIACEDTMFAMPETGIGYFTD
FADJ_VIBVY      ------------------------------------------------------ATRLGLPEVQLGLLPG
FADJ_VIBHB      --------------------------------------------------------RLGLPEVQLGLLPG
D3D2_RAT        ---------------------------LISAINGASPAGGCLMALTCDYRIMADNSKYGLNESLLGIVAP
FADJ_VIBVU      ------------------------------------------------------ATRLGLPEVQLGLLPG
FADJ_VIBCH      --------------------------------------------------------RLGLPEVMLGLLPG
FADJ_VIBC3      --------------------------------------------------------RLGLPEVMLGLLPG
HIBCH_DICDI     ---------------------------------GFAMGGGIGLSVHGKFRVATENTVFAMPETGIGFFCD
FADJ_SHELP      ----------------------------------------------------------------------
D3D2_HUMAN      -----------------WLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYGLNETQLGIIAP
CLPP1_CHLMU     -----------------WDQIKMISSPVTTVVTGLAASMGSVLSLC-----AAPGRRFATPHARIMIQPS


                         +         .         .         .         .         *         .:210
query           AGGTQRLPRAIGKAKAMDMCLSARPLDAEEADRYGLVSRVVDDDRLREETMKLATTIASFSAPALMALKE
ECHH_RHIME      MGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVVAPDRLLEEALGAAEKIASFSLPAAMMAKE
ECHA8_MYCTU     MGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKE
ECHA8_MYCBO     MGGSQRLTRAIGKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMSASAARMAKE
ECHM_DICDI      CGGTQRLIRAIGKSKAMELVLTGNNLTAVEAEKAGLVSKVVPVEELLTEATKMAEKIASYSQLTVAMAKE
ECHA8_MYCLE     MGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVVLADDLLPEAKAVATTISQMSRSATRMAKE
ECHM_HUMAN      AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKE
ECHM_MOUSE      AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKE
ECHM_PONAB      AGGTQRLTRTVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIIAAMAKE
ECHM_RAT        AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKE
ECHM_BOVIN      AGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAMAKE
ECHM_CAEEL      AGGTQRWARAAGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQMAKE
CRT_CLOAB       FGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQ
CRT_CLODI       YGGTQRLTRLVGMAKAKELIFTGQVIKADEAEKIGLVNRVVEPDILIEEVEKLAKIIAKNAQLAVRYSKE
PAAF_ECOLI      AGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYALQLASKMARHSPXXXXXXXX
ECHD3_HUMAN     TPGVA-LARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKA
YNGF_BACSU      AGGTQRLPRLIGRGKAKEFIYTGRRVTAHEAKEIGLVEHVTAPCDLMPKAEELAAAISANGPIAVRQAKF
ECHD3_MOUSE     TPAVA-LGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEAETMRIAKKISSLSRSVVALGKA
CAID_SALTI      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMESARELAQQLVNSAPLAIAALKE
AUHM_MOUSE      GGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPAMRVAKL
CAID_SALTY      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKE
CAID_SALSV      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKE
CAID_SALNS      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKE
CAID_SALHS      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMESARELAQQLVNSAPLAIAALKE
CAID_SALPK      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALPC      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALPA      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALCH      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALA4      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGIVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_CITK8      SGGVLRLPKLLPPAIVNEMLMTGRRMDAEEALRWGIVNRVVSQQALMDSARELAQQLVNSAPLAIAALKE
AUHM_HUMAN      GGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPAMRVAKL
ECHD3_RAT       TPAVA-LGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPEEQLEEEATRIAKKIASLSRSVVALGKA
CAID_SALPB      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALG2      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALEP      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
CAID_SALDC      SGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVVSQSELMDSARELAQQLVNSAPLAIAALKE
ECH1_DICDI      LGTLQRISKIVGSGFARELALTGKDIDAKTAERFNLVNHVYDHDTLLSEGRKLALSIAQNSPLVVQATKL
ECHD3_XENLA     TPGVA-LGRAVPRKVALEMLFTGEPISAHDALLHGLVSKVVPEENLKSETNRIALKICQTSHSVVALGKS
ECHP_PONAB      ARGTQLLPRLIGVPAALDLITSGRHILADEALKLGILDKVVNSDPV-EEAIRFAQRVS------------
ECHD3_DANRE     VAIGRTVPRKI----AMQMLLTGRPLSAQQALQHGLLSAVFSEERLEDETLAIARRVCESSRPVVSLGKQ
ECHP_HUMAN      ARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPV-EEAIRFAQRVS------------
AUHM_DICDI      AGGTQRLPRLIGIPRAKELIFTGAILDSKRALEIGLVQYETEKGEAFDKAIEIAKQIIPKGPIAIRMAKQ
CAID_ECOLI      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_ECOLC      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_ECO57      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_ECOSM      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_ECOL6      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_ECOL5      SGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGVVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_SALAR      SGGVLRLPKILPPAIVNDMVMTGRRMTAEEALRWGVVNRVVSPHELLDSARELARQLVQSAPLAVAALKE
CAID_SHIFL      SGGVLRLPKILPPTIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAIAALKE
CAID_PROSL      SGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAALKE
CAID_PROMH      SGGVLRLPKRLPPAIVNEMLMTGRRMNAQEALRWGIANRVVSATELMDSARELADQIANSAPLAVAALKE
ECHA_RAT        AGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVDEERTIEYLEEVAVNFAKGLADRKVSAKQ
ECHA_MOUSE      AGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEEERTIEYLEEVAVNFAKGLADRKVSAKQ
FADB_BACSU      FAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGAKDEAEVIXXXXXXXXXXXXXSPQTLASLL
ECHP_CAVPO      ARGTQLLPRLIGVPAALDLITSGRHITAGEALKLGILDKVVNSAPV-EEAIKFAQKI-------------
ECHA_PIG        AGGTQRLPKMVGVPAAFDMMLTGRGIRADKAKKMGLVDQLV-----------------------------
FADJ_SALSV      SGGTQRLPRLVGVSTALDMILTGKQLRARQALRAGLVDDVVPQTILLEAAVELA----------------
ECHP_DANRE      AGGTQRLPRLIGIPAALELITTGRHVSAQEALKLGMVDQVTEQN--------------------------
ECHD2_MOUSE     AGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVEGNAAYHRALALAQEILPQAPIAVRLGKV
FADB_SERP5      FGGSVRLPRLLGNDSALEIIAAGKDVSAKDALKVGLVDAVVAPEKLVEAALKMLQQARAYRQPKLEPLKL
ECHD2_HUMAN     AGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVEGDAAYQRARALAQEILPQAPIAVRLGKV
FADJ_SALTY      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALTI      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALPB      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALNS      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALHS      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALG2      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALEP      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALDC      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALCH      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALA4      SGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
MMCD_ECOLI      LVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAVIKE
FADJ_IDILO      SGGTQRLPELVGVQQGLTMILTGKELRAKQALKAGLVTEVVPQSILLDVAVEHA----------------
FADJ_SALPK      SGGTQRLPRLVGVSTALDMILIGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_SALPA      SGGTQRLPRLVGVSTALDMILIGKQLRARQALKAGLVDDVVPQTILLEAAVELA----------------
FADJ_CITK8      SGGTQRLPRLVGVSTALDMILTGKQLRPKQALRVGLVDEVV-----------------------------
ECHD2_BOVIN     AGGTQRLPRCLGVALAKELIFTGRRLSGAQAQALGLVNHAVAQNEEGNAAYHRARALAQEILPAVRLSKV
PAAG_ECOLI      CGGTWLLPXXXXXXXXXXXXXXXNQLSAEQAHEWGMIWQVVDDETLADTAQQLARHLATQPTFGLGLIKQ
MENB_BACSU      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQLEEETIKWCEEMLEKSPTALRFLKA
FADB_PHOLL      FGGSVRLPRLIGTDNALDIIAAGKDIGAEEALKNGLIDAVVPKEKLVDSAVSM-----------------
ECHA_HUMAN      AGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQLV-----------------------------
ECH1_HUMAN      VGTLQRLPKVIGNQSLVELAFTARKMMADEALGSGLVSRVFDKEVMLDAALALAAEISSKSPVAVQSTKV
FADB_VIBVY      FGGCVRLPRVIGADSAMEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLT---------------
FADB_VIBVU      FGGCVRLPRVIGADSAMEIITQGKACRAEEALKIGLLDAVVDSDRLYASALQTLT---------------
ECH1_PONAB      VGTLQRLPKVIGNQSLVELAFTARKMMADEALGSGLVSRVFDKEVMLDAALALAAEISSKSPVAVQSTKV
FADB_VIBCM      FGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAITTLT---------------
FADB_VIBCH      FGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAITTLT---------------
FADB_VIBC3      FGGTVRLPRLIGADSAMEIITQGKACRAEEALKVGLLDAIVDSDKLIDSAITTLT---------------
MENB_PASMU      GWGASYMARIVGQKKAREIWFLCRQYDAKEALEMGLVNTVVPYAELEKETVRWCREMLRNSPIALRCLKA
MENB_CYACA      GYGSAYMARIIGQKKARELWFTCYQYDAFEAYKMGLVNWVVKIEDLDSYAIKLATDILNKSPLAIRFLKS
FADB_VIBHB      FGGCVRLPRVIGADSAMEVITQGKACRADEALKIGLLDAVVDSDALYESALKTLTS--------------
FADB_IDILO      FGGTMRLPRVIGPDNALEWITTGKNNKALDALKVGAVDAVVEPE--------------------------
MENB_STAHJ      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDQIEDETVQWCKEIMKHSPTALRFLKA
MENB_STAES      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQVEDETVKWCKDIMQHSPTALRFLKA
MENB_STAEQ      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEQVEDETVKWCKDIMQHSPTALRFLKA
FADB_YERPY      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPS      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPP      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPN      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPG      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPE      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPB      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERPA      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
FADB_YERP3      FGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKL------------------------
MENB_STAAN      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEDETVQWCKEIMKHSPTALRFLKA
MENB_STAAM      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDKVEDETVQWCKEIMKHSPTALRFLKA
FADB_PSEU2      FGGTVRLPRIIGADNAIEWIASGKENAAEDALKVGAVDAVVAPEKLQAAALDL-----------------
FADB_PSE14      FGGTVRLPRIIGADNAIEWIASGKESSAEDALKVGAVDAVVAPEKLQAAALDL-----------------
FADB_SALTY      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALTI      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALPK      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALPB      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALPA      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALG2      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALEP      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALCH      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_SALA4      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAIAVLRQAITGDQPKLEPLKL
FADB_PSESM      FGGTVRLPRIIGADNAIEWIASGKENSAEDALKVGVVDAIVAPEKLQAAALDL-----------------
FADB_ERWCT      FGGTVRLPRLLGADSALEIIAAGKDVSAADALKVGLVQAVVANEKLIPAAIKM--------------LKQ
FADB_ENTS8      FGGSVRLPRLLGADSALEIIAAGKDITADAALKVGLVDAVVKPEKLIEGALRM-----------------
FADB_VIBSL      FGGCVRLPRVIGADSAMEIITQGKACRADEALKVGLLDAIVETDQLLESAINTVSLAAN-----------
FADB_AERHH      FGGTVRLPRVIGADNALEWITTGKDYRADDALKVGAIDAVVAPDALQSAAVQM-----------------
FADB_SALSV      FGGSVRMPRMLGADSALEIIAAGKDIGAEQALKIGLVDGVVKQEKLIDGAIAVLRQAITGDQPKLEPLKL
FADB_ECOL6      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAILRQAINGDQPKLEPLKL
FADB_ECOL5      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAILRQAINGDQPKLEPLKL
FADB_ECO27      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAILRQAINGDQPKLEPLKL
FADB_AERS4      FGGTVRLPRVIGADNALEWITTGKDYRADDALKVGAIDAVVAPDALHSAAVQM-----------------
MENB_STAS1      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLDQVEDETVQWCQEMKQHSPTALRFLKA
MENB_STAAW      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
MENB_STAAS      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
MENB_STAAR      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
MENB_STAAC      GYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKA
FADB_SHEAM      FGGTVRLPRLIGADNALEWITTGKDQRPEDALKVGAIDAVVAPENLEAAAIQM-----------------
FADB_SALNS      FGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQETLIEGAIAVLRQAITGDQPKLEPLKL
FADB_ENTCL      FGGSVRMPRMLGADSAMEIIAAGKDVGAEQAQKIGLVDGVVKPEKLVEGALAI-----------------
MENB_HAEIN      GWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYADLEKETVRWCREMLRNSPIAIRCLKA
FADB_VIBPA      FGGCVRLPRVIGADSAMEIITQGKACRADEALKIGLLDAVVETDALYESALQTLTS--------------
FADB_SHIFL      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_SHIF8      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_SHIDS      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_SHEFN      FGGTVRLPRVIGADNALEWITTAKDQRPEDALKVGAIDAVVAPENLEAAAIQM-----------------
FADB_KLEP7      FGGSVRLPRLLGADSALEIIAAGKDVGADQALKIGLVDGVVAAEKLRDGALAI-----------------
FADB_KLEP3      FGGSVRLPRLLGADSALEIIAAGKDVGADQALKIGLVDGVVAAEKLRDGALAI-----------------
FADB_ECOSM      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_ECOLU      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI-----------------
FADB_ECOHS      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_ECO7I      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAMAI-----------------
FADB_ECO5E      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
FADB_ECO57      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLIEGAMAI-----------------
MENB_ECOLI      GWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKA
MENB_ECOL6      GWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKA
FADB_PHOPR      FGGTVRLPRLLGADSAMEIITAGKDKKAQDALKLGLVDAVVAPTALKDAALSM-----------------
FADB_ECOUT      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAILRQAINGDQPKLEPLKL
FADB_ECO81      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAILRQAINGDQPKLEPLKL
FADB_ECO45      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVEGAIAILRQAINGDQPKLEPLKL
FADB_ALISL      WGGSVRLPRLIGADPAMEVITTGKPKRAKDALKIGMVDGIVSRETLIDASVSM-----------------
FADB_VIBF1      WGGSVRLPRLIGADPAMEVITTGKPKRAKDALALGMVDGVVSRETLITDSVTM-----------------
FADB_SHEB8      FGGTVRLPRVIGADNALEWITTGKDQRAEDALKVGAVDSVVAPQALEAAAIQM-----------------
FADB_CITK8      FGGSVRMPRMLGADSALEIIAAGKDIGAEQALKIGLVDGVVKPEKLLDGAIAVLRQAIDGSQPKLEPLKL
MFPA_CUCSA      FGGTQRLPRLVGLSKALEMMLTSKPIKGQEAHSLGLVDAIVPPEELINTARRWALEILERRRPWVHSL--
FADB_VIBFM      WGGSVRLPRLIGADPAMEVITTGKPKRAKDALALGMIDGVVSRETLITDSVTM-----------------
FADB_PSEMY      FGGTVRLPRVIGTDNAVEWIASGKENKAADALKVGAVDAVVAPAKLKEAALDL-----------------
FADB_ENT38      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLIDGIVKAEKLRDGAISI-----------------
ECHP_RAT        ARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPV-EEAIKFAQKI-------------
FADB_SHISS      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_SHIB3      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_SHEPA      FGGTVRLPRVIGADNALEWITSGKDQRPEAALKVGAIDAVVAPEQLKPAALKM-----------------
FADB_ESCF3      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECOLI      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECOLC      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECODH      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECOBW      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECO8A      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECO55      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_ECO24      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_SHEHH      FGGTVRLPRVIGADNALEWITSGKDQRPDAALKVGAIDAVVAPEQLRPAALRM-----------------
FADB_SHESH      FGGTVRLPRLIGTDNALEWITSGKDQRPEAALKVGAIDAVVAPENLQASAIKM-----------------
FADB_PSEU5      FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVHAVDAVVAPEKLQEAALDL-----------------
FADB_SHELP      FGGTVRLPRVIGADNALEWITTGKDQRPEAALKVGAIDAVVAPELL------------------------
FADB_PSYWF      FGGSVRTPRVIGIDNAVELIATGKAQKPAEALKLGLVDAVVAQDDLQEAAVDL-----------------
FADB_ECOSE      FGGSVRMPRMLGADSALEIIAAGKDVGADQALKIGLVDGVVKAEKLVE----------------------
FADB_SHEPW      FGGTVRLPRVVGTDNALEWITSGKDQRPEAALNVGAIDALVAPEQLQSAALKM-----------------
FADB_SHEB9      FGGTVRLPRVIGADNALEWITTGKDQRAEDALKVGAV---------------------------------
FADB_SHEB5      FGGTVRLPRVIGADNALEWITTGKDQRAEDALKVGAV---------------------------------
ECH12_MYCTU     ELGSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAGFSRPGIELTKR
ECH12_MYCBO     ELGSYLLPRAIGSSRAFEIMLTGRDVSAEEAERIGLVSRQVPDEQLLDACYAIAARMAGFSRPGIELTKR
ECHP_MOUSE      ARGTQLLPRVVGVPVALDLITSGRHISTDEALKLGILDVVVKSDPV-EEAIKFAQTV-------------
FADB_SHEWM      FGGTVRLPRLIGADNALEWITTGKDHKPEAALKVGAIDAVVAPENL--------------EASAIAMLKE
DCH_THAAR       AASC-LLPPRVGQACAEDLLWSGRSIDGAEGHRIGLIDVLAEDPEFDEHIARLSASSLRFAVRAA-----
FADB_SHEB2      FGGTVRLPRVIGADNALEWITTGKDQRAEDALKVGAV---------------------------------
FADB_SHEON      FGGTVRLPRVIGADNALEWITTGNEQRAEDALKVG-----------------------------------
FADB_SHESW      FGGTVRLPRVIGADNALEWISTGNDQRAEDALKVG-----------------------------------
FADB_SHEPC      FGGTVRLPRVIGADNALEWISTGNDQRAEDALKVG-----------------------------------
MFPA_BRANA      FGGTQRLPRLVGLTKALEMILTSKPVKAEEGHSLGLIDAVVPPAELLNAARRWALDIAERRKP-------
FADB_YERE8      FGGSVRLPRLLGADSALEXXXXXXXXXXXXXLKVGLVDAVVAPEKLVDAALSI-----------------
FADB_SHESR      FGGTVRLPRVIGADNALEWITTGKDQRPEDALKVG-----------------------------------
FADB_SHESM      FGGTVRLPRVIGADNALEWITTGKDQRPEDALKVG-----------------------------------
FADB_SHESA      FGGTVRLPRVIGADNALEWITTGKDQRPEDALKVG-----------------------------------
MFP_ORYSJ       FGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGLVDALCSPDELIKMSRLWALEIANYRKPWIRSLAR
FADB_ACIAD      FGGTVRLSRLIGIDNAVEWIXXXXXXXXXXXLKDGAVDAVVSADKLQEAAIDLVKQALAGRVDWKAKRQE
CRTL_DICDI      MGVTHSITNIVGQDVASYMLLSSDIIKGDEAQRLGLVLKSVESDQVLPTALNLAETISKNSTIAVNSTTK
FADJ_YERE8      SGGTQRLPRLVGVSKALDMILTGRQVRARQALKMGLVDDVVPQDILLDVAIQRAKA-GWLDKPALPWQER
FADJ_ECOUT      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECOSM      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECOLU      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECOL5      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECOK1      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECO81      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECO7I      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPQSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECO45      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECO27      SGGTQRLPRLIGVSTALEMILTGKQLRAKQAVKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADB_PSYCK      FGGTVRSTRVIGIDNALELIATGTPKKALDALKLGLVDATV-----------------------------
FADB_PSYA2      FGGTVRSTRVIGIDNALELIATGAPKKALDALKLGLVDATV-----------------------------
FADJ_SHISS      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP--LPVRE
FADJ_SHIFL      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP--LPVRE
FADJ_SHIF8      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP--LPVRE
FADJ_KLEP3      SGGTQRLPRLIGVSTALDMMLTGRQLRARQALKAGLVDEVVPQAILLQAAVELA--LKGRPASRDMPVRE
FADJ_ECOLI      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRP--LPVRE
FADJ_ECOL6      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADJ_ECOHS      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP--LPVRE
FADJ_ECODH      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRP--LPVRE
FADJ_ECOBW      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKERPSSRP--LPVRE
FADJ_ECO5E      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP--LPVRE
FADJ_SHIB3      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADJ_ECOSE      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADJ_ECO8A      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADJ_ECO55      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADJ_ECO24      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADB_PSEFS      FGGTVRLPRLIGADNAIEWIAAGKENRAEDALKVGAVDAVVAPDKLAEAALNL-----------------
ECHH_RHOCA      AGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEAVPDVDFEXXXXXXXXXXXXGPSXXXXXXXX
CDY2_HUMAN      GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNAIVLEECKA
YHAR_BACSU      GGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTFAGDPAEGARPIIETLLAS---PLLAMIEK
FADJ_ECOLC      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELVKQDRPSSRP--LPVRE
FADJ_SHIBS      SGGTQRLPRLIGVSTTLEMILTGKQLRAKQALKLGLVDDVVPHSILLEVAVELAKKDRPSSRP--LPVRE
FADJ_PECCP      SGGTQRLPRLIGLDSALDLILTGRHLRANQALRQGLVDEAVPHDILLDTAVEM-----------------
FADJ_ECO57      SGGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKKDRPSSRP-------
FADJ_SHIDS      SDGTQRLPRLIGVSTALEMILTGKQLRAKQALKLGLVDDVVPHSILLEAAVELAKQDRPSSRP--LPVRE
FADB_COLP3      FGGTVRLPRLIGFDNAATWMSTGKAFKPAAALAQGAIDAVVEPENLQAAAISM-----------------
CDY1_HUMAN      GCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQVFLTGTFTQEVMIQIKELASYNPIVLEECKA
FADB_PSEFR      FGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDL-----------------
FADJ_PHOPR      SGGTQRLPRLIGVANALDMILTGKQLRAKKAKNLGLVEEAV-----------------------------
FADJ_KLEP7      SGGTQRLPRLIGVSTALDMMLTGKQLRPRQALKAGLVDEVVPQAILLQAAVELA----------------
FADJ_ERWCT      SGGTQRLPRLIGLDSALDLILTGRHLRAGQALRQGLVDEAVPHDILLDTAVEI-----------------
FADB_PSEPU      FGGTVRLPRLIGSDNAVEWIASGKENRAEDALKVGAVDAVVAPELLQAGALDL-----------------
FADJ_YERPS      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_YERPP      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_YERPN      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_YERPE      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_YERPA      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_YERP3      SGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRA----------------
FADJ_SERP5      SGGTQRLPRLIGASKALDMILTGKHIRARQALRLGLVDDAVPQSILLQTAIE------------------
CDYL1_HUMAN     GCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKA
FADB_PSEPW      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLQAGALDL-----------------
FADB_PSEPF      FGGTVRLPRLIGADNAIEWIAAGKENRPEDALKVGAVDAVVAPEKLQDAALEL-----------------
CDYL_RAT        GCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPIVLEESKA
FADJ_PHOLL      SGGTQRLPRLIGVSSALDIMLTGKQLRAKQALRLGLVDDAVPLDIL------------------------
FADB_PSEE4      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLQAGALDL-----------------
ECHD1_PONAB     WGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLDETKSLEEAQEWLKQFIQGPPEVIRALKK
ECHD1_HUMAN     WGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLDETKSLEEAQEWLKQFIQGPPEVIRALKK
HIBCH_MOUSE     VGGGYFLPRLQGKL-GYFLALTGYRLKGRDVHRAGIATHFVDSEKLRVLEEEL-LALKSPSAEDVAGVLE
HIBCH_DANRE     VGGGYFLPRLQGKL-GLFLALTGFRLKGRDVQRVGVATHFVQSEKLEKDLVDLKSPSISDVAQLLDSYQE
FADJ_ENT38      SGGTQRLPRLVGVSTALEMILTGKQLRPRQALKVGLVDEVVPHSILLTAAVELAQ--KERQASRHLPVRE
FADB_PSEPG      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELL------------------------
FADB_PSEOL      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELLMAGALDL-----------------
FADB_PSEF5      FGGTVRLPRLIGADNAIEWIAAGKENRAEDALKVGAVDAVV-----------------------------
FADB_ACIBY      FGGSVRLSRLIGIDNAVE----------------------------------------------------
FADB_ACIBS      FGGSVRLSRLIGIDNAVE----------------------------------------------------
FADB_ACIBC      FGGSVRLSRLIGIDNAVE----------------------------------------------------
FADB_ACIB5      FGGSVRLSRLIGIDNAVE----------------------------------------------------
FADB_ACIB3      FGGSVRLSRLIGIDNAVE----------------------------------------------------
CDYL_MOUSE      GCSTVMFPKIMGGASANEMLFSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKELASCNPVVLEESKA
ECHD1_MOUSE     WGGTSRLVEIIGSRQALKVLSGTLKLDSKEALNIGLTDEVLDETTALEQAQEWLEKFVSGPPQVIRGLKK
FADJ_ESCF3      SGGTQRLPRLVGLSTALDMILTGKQLRPGQALKSGLVDEIVPQSILLQAAVERAK--QERQTPRSLPVRE
ECHD1_RAT       WGGASRLVEIIGSRQALKVLSGTFKLDSKEALRIGLADEVLDEATALEQAQEWLEQFVSGPAQVIRGLKK
FADB_PSEPK      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELL------------------------
FADB_PSEP1      FGGTVRLPRLIGSDNAIEWIAAGKENRAEDALKVGAVDAVVAPELL------------------------
FADB_PSEAE      FGGTVRLPRLIGCDNAVEWIASGKENKAEDALKVGAVDAVV-----------------------------
FADB_PSEAB      FGGTVRLPRLIGCDNAVEWIASGKENKAEDALKVGAVDAVV-----------------------------
FADB_PSEA8      FGGTVRLPRLIGCDNAVEWIASGKENKAEDALKVGAVDAVV-----------------------------
FADB_PSEA7      FGGTVRLPRLIGCDNAVEWIASGKENKAEDALKVGAVDAVV-----------------------------
ECH1_RAT        VGTLQRLPKVIGRSLVNELTFTARKMMADEALDSGLVSRVFDKDVMLNAAFALAADISSKSPVAVQGSKI
HIBCH_RAT       VGGGYFLPRLQGKL-GYFLALTGFRLKGRDVHRAGIATHFVDSEKLHVLEEEL-LALKSPSAEDVAGVLE
ECHD1_BOVIN     WGGATRLVEIIGGRQALKVLSGALKLDSEKALNIGMVDDILDETECLKEAQEWLQQFIKGPPEVIRALKK
ECH1_MOUSE      VGTLQRLPKVIGNQSLVELTFSARKMMADEALDSGLVSRVFQDDXXXXXXXXXXXDISSKSPVAVQGSKI
CDYL2_HUMAN     GCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVVL-----
ECHA6_MYCTU     NWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKR
ECHA6_MYCBO     NWSIRRLSSLVGHGRARAMLLSAEKLTAEIALHTGMANRI----GTLADAQAWAAEIARLAPLAIQHAKR
ECH12_MYCLE     ELGSYLLPRAVGSSRAFEIMLSGRDVGAEEAEQIGLVSYRVSDDRLLDTCYSIAARMATFSRSGTELTKR
PECI_MOUSE      ACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNAMRISKE
HIBCH_YEAST     VGSTFALPRIVTLANALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGEISPPFSAYFFGMVNE
HIBCH_CHICK     VGGGYFLPRLSGKIGHL-LALTGFRLKGRDVLKAGIATHFVESGKLPE----LEKDLIALKSPSKENIAD
PKSI_BACSU      MGATFIVPKKLGFSLAQEILLNAGSYRGADLEKRGVPFKVLPRAEVLDYAVELAQELAEKPRNSLVTLKD
HIBCH_XENLA     VGGGYFLPRLTGKL-GLYLALTGFRLKGSDVQKAGIATHFVESEKL------------------------
YKB4_CAEEL      ACSSYTLPRIMGHQKAAALMMFSEKFTAHEAHIAGLVTQILPAATFEKDAKKIIDRYSKLS-PITMKVAK
FADJ_VIBF1      SGGTQRLPRLIGLLPSLDIILTGKQLRPKTALKLGVVDASV-----------------------------
HIBCH_XENTR     VGGGYFLPRLPGKL-GLYLALTGFRLKGSDVQKAGIATHFVESEKI------------------------
PECI_RAT        ACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRISKE
HIBCH_HUMAN     VGGGYFLPRLQGKL-GYFLALTGFRLKGRDVYRAGIATHFVDSEKL------------------------
HIBCH_BOVIN     VGGGYFLPRLQGKL-GYFLALTGFRLKGRDVYTAGIATHFVDFEKL------------------------
PECI_HUMAN      GCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRISKE
PKSH_BACSU      ACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLI---------------------------------
ECH14_MYCTU     GGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLALMVADDXXXREVVLASKATMRATASPGSLDLEQ
ECH14_MYCBO     GGATWMLQRAVGPQVARAALLFGMCFDAESAVRHGLALMVADDXXXREVVLASKATMRATASPGSLDLEQ
ECH17_MYCPA     GDALARLTRVAGASKAKELVFSGRFFDAEEALALGLIDEMVXXXXXXXXXXXXXRRFLDGPRHXXXXXXX
ECH17_MYCA1     GDALARLTRVAGASKAKELVFSGRFFDAEEALALGLIDEMV-----------------------------
FADN_BACSU      GGGNKEL---------------------------------------------------------------
ECH17_MYCTU     GDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI---------------------------------
ECH17_MYCTA     GDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI---------------------------------
ECH17_MYCBP     GDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI---------------------------------
ECH17_MYCBO     GDGMARLTRAAGPSRAKELVFSGRFFDAEEALALGLI---------------------------------
FAD3_RICFE      WGGVTEM---------------------------------------------------------------
FAD3_RICPR      TGVTEMFARSNG----------------------------------------------------------
FAD3_RICTY      SGVTEMFARSNG----------------------------------------------------------
FADJ_VIBPA      SGGTQXXXXXXXXXXXXXXXXTGKQLRAKKAKKLGVVDACVPD---------------------------
FADJ_ENTS8      SGGTQRLPRLVGVSTALEMILAGKQLRPRQALKAGLVDDVV-----------------------------
D3D2_MOUSE      FWFKDMYVNTIGHREADGALQLGTLFSPAEALKVGVVDEVVPEDQVHSKARSVMTKWLAIPDHSRQLTKN
HIBCH_SCHPO     VAASSRLPGYFGTY----LGLTSQIVKGYDCLRTGIATHFVPEDRLAEDISKINNTILEFA---------
FADJ_VIBVY      SGGTQXXXXXXXXXXXXXXXXTGKQLRAKKAKKLGVVDACV-----------------------------
FADJ_VIBHB      SGGTQXXXXXXXXXXXXXXXXTGKQLRAKKAKKLGVVDACVPE---------------------------
D3D2_RAT        FWLKDNYVNTIGHRAAERALQLGTLFPPAEALKVGLVDEVVPEDQVHSKARSVMAKWFTIPDHSRQLTKS
FADJ_VIBVU      SGGTQXXXXXXXXXXXXXXXXTGKQLRANKAKKLGVVDACV-----------------------------
FADJ_VIBCH      SGGTQXXXXXXXXXXXXXXXXTGKQLRAKKAKKLGVVDACVPHSVLLDVAKRL-----------------
FADJ_VIBC3      SGGTQXXXXXXXXXXXXXXXXTGKQLRAKKAKKLGVVDACVPHSVLLDVAKRL-----------------
HIBCH_DICDI     VGGSYFLPR-LPNNYGMYLALTGSKLKGNNVYLAGVATHFVSNEHIQ-----------------------
FADJ_SHELP      ----------VGIAKSLDMMLTGKQLRAKQALKMGLVDDVVPESILLQTAIEMALAGARPAKKPKLSTVE
D3D2_HUMAN      FWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTAL-------------------
CLPP1_CHLMU     IGGTI-------TGQATDLDIHAREILKTKA-------RIID---VYVEATGQSREVIEKAIDRDMWM--


                         .         .         .         +         .         .         .:280
query           SLNRAFEIPLAEGILFERRELHARFATADAREGIRAFLEKRKPSFVHR
ECHH_RHIME      AVNRSLELTLAEGLRFERRLFQSLFATEDQKEGMAAFVAKRKAEFKHR
ECHA8_MYCTU     AVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTHR
ECHA8_MYCBO     AVNRAFESSLSEGLLYERRLFHSAFATEDQSEGMAAFIEKRAPQFTHR
ECHM_DICDI      AVNASYELTLQEGIRFERRMFHSTFGTHDQKEGMNAFVEKRTPTW---
ECHA8_MYCLE     AVNRSFESTLAEGLLHERRLFHSTFVTDDQSEGMAAFIEKRAPQFTHR
ECHM_HUMAN      SVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANF---
ECHM_MOUSE      SVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANF---
ECHM_PONAB      SVNAAFEMTLAEGSKLEKKLFYSTFATNDRKEGMTAFVEKRKANF---
ECHM_RAT        SVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANF---
ECHM_BOVIN      SVNAAFEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRKANF---
ECHM_CAEEL      AVNKAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQW---
CRT_CLOAB       AINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK------
CRT_CLODI       AIQLGAQTDINTGIDIESNLFGLCFSTKDQKEGIVSF-----------
PAAF_ECOLI      XXXXXXEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKRTPDFKGR
ECHD3_HUMAN     TFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH-
YNGF_BACSU      AINKGLETDLATGLAIEQKAYEQTIPTKDRREGLQAFQEKRR------
ECHD3_MOUSE     TFYKQLPQDLRTAYFLASQAMVDNLALQDGQEGIEAFIQKRKPIWSH-
CAID_SALTI      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRAP-----
AUHM_MOUSE      AINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAFKEKRPPRY---
CAID_SALTY      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALSV      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALNS      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRAP-----
CAID_SALHS      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALPK      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALPC      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALPA      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALCH      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALA4      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_CITK8      IYRATSEMPVEEGYRYIRKHYPSVLHSEDAIEGPQAFAEKRDP-----
AUHM_HUMAN      AINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRY---
ECHD3_RAT       TFYKQLPQDLSTAYFLASQAMVDNLTLKDGQEGIEAFIQKRRPVWSH-
CAID_SALPB      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALG2      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALEP      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
CAID_SALDC      IYRATSEMPVEEGYRYIRSGVLKHYPSVDALEGPQAFAEKRDP-----
ECH1_DICDI      TLNHADDHTIDEGLYRVALQNAAFLKSDDLNESATSFFEKRQPIF---
ECHD3_XENLA     TFYRQMAKSLTDAYKLTSEVMVENLAMKDGQEGLKSFIQKRKPVWTH-
ECHP_PONAB      ------------------------------------------------
ECHD3_DANRE     IFNTQMSQSRDAAYSTAGAAMLDNLRLRDGQEGIRAFLEKRKP-----
ECHP_HUMAN      ------------------------------------------------
AUHM_DICDI      AIDRGMNVDQASGMIIEQASYAQVIPTKDRIEGLTAFKEKRKPIY---
CAID_ECOLI      IYRTTSEMPVEEAYRYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_ECOLC      IYRTTSEMPVEEAYRYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_ECO57      IYRTTSEMPVEESYSYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_ECOSM      IYRTTSEMPVEEAYRYIRSGVLKNYPSVDAIEGPLAFAEKRDP-----
CAID_ECOL6      IYRTTSEMPVEEAYRYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_ECOL5      IYRTTSEMPVEEAYRYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_SALAR      ITRTTRDMSVEEGYRYIRRHYPAVLHSEDALEGPLAFAEKRDPEW---
CAID_SHIFL      IYRTTSEMPVEEAYRYIRSGVLKHYPSVDAIEGPLAFAEKRDP-----
CAID_PROSL      IYRATSELSIEEGYKLMRRVLHSE----DALEGPLAFAEKRSPEWKGR
CAID_PROMH      IYRATSELSIEEGYKLMRRVLHSE----DALEGPLAFAEKRSPEWKGR
ECHA_RAT        S-----------------------------------------------
ECHA_MOUSE      S-----------------------------------------------
FADB_BACSU      ELLYSNKVYSYEGSLLEAKRFGEAFESEDAKEGIQAFLEKRKPQF---
ECHP_CAVPO      ------------------------------------------------
ECHA_PIG        ------------------------------------------------
FADJ_SALSV      ------------------------------------------------
ECHP_DANRE      ------------------------------------------------
ECHD2_MOUSE     AIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFV--
FADB_SERP5      SIEAAMSFTTAKGMVMQTAGKHVKTIEAAARLGRDEALKLETASFV--
ECHD2_HUMAN     AIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAAFREKRTPKFV--
FADJ_SALTY      ------------------------------------------------
FADJ_SALTI      ------------------------------------------------
FADJ_SALPB      ------------------------------------------------
FADJ_SALNS      ------------------------------------------------
FADJ_SALHS      ------------------------------------------------
FADJ_SALG2      ------------------------------------------------
FADJ_SALEP      ------------------------------------------------
FADJ_SALDC      ------------------------------------------------
FADJ_SALCH      ------------------------------------------------
FADJ_SALA4      ------------------------------------------------
MMCD_ECOLI      ELRVLGEAHTMNSDEFERIQRRAVYDSEDYQEGMNAFLEKRKPNFV--
FADJ_IDILO      ------------------------------------------------
FADJ_SALPK      ------------------------------------------------
FADJ_SALPA      ------------------------------------------------
FADJ_CITK8      ------------------------------------------------
ECHD2_BOVIN     AIDRGIEVDIASGMAIEGICYAQNIPTRDRLEGMAAFREKRLPRFV--
PAAG_ECOLI      AINSAETNTLDTQLDLERDYQRLAGRSADYREGVSAFLAKRSPQF---
MENB_BACSU      AFN-ADTDGLAGIQQFAGDATLLYYTTDEAKEGRDSFKEKRKPDF---
FADB_PHOLL      ------------------------------------------------
ECHA_HUMAN      ------------------------------------------------
ECH1_HUMAN      NLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKE------
FADB_VIBVY      ------------------------------------------------
FADB_VIBVU      ------------------------------------------------
ECH1_PONAB      NLLYSRDHSVAESLNYVASWNMSMLQTQDLMKSVQAATENKE------
FADB_VIBCM      ------------------------------------------------
FADB_VIBCH      ------------------------------------------------
FADB_VIBC3      ------------------------------------------------
MENB_PASMU      ALNADCDGQAGLQELAGNATM-LFYMTEEGQEGRNAFNEKRAPDF---
MENB_CYACA      SLNALQELAGYSTMLF--------YMSAEGQEGHRAFLENREPDF---
FADB_VIBHB      ------------------------------------------------
FADB_IDILO      ------------------------------------------------
MENB_STAHJ      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAES      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRNPDF---
MENB_STAEQ      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRNPDF---
FADB_YERPY      ------------------------------------------------
FADB_YERPS      ------------------------------------------------
FADB_YERPP      ------------------------------------------------
FADB_YERPN      ------------------------------------------------
FADB_YERPG      ------------------------------------------------
FADB_YERPE      ------------------------------------------------
FADB_YERPB      ------------------------------------------------
FADB_YERPA      ------------------------------------------------
FADB_YERP3      ------------------------------------------------
MENB_STAAN      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAAM      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
FADB_PSEU2      ------------------------------------------------
FADB_PSE14      ------------------------------------------------
FADB_SALTY      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALTI      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALPK      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALPB      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALPA      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALG2      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALEP      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALCH      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_SALA4      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_PSESM      ------------------------------------------------
FADB_ERWCT      AINLGYRRPKLEALKLNKIEAMMSFTTAKA------------------
FADB_ENTS8      ------------------------------------------------
FADB_VIBSL      ------------------------------------------------
FADB_AERHH      ------------------------------------------------
FADB_SALSV      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ECOL6      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ECOL5      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ECO27      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_AERS4      ------------------------------------------------
MENB_STAS1      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAAW      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAAS      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAAR      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
MENB_STAAC      AMNADTDLAGLQQMAGDATLLY--YTTDEAKEGRDAFKEKRDPDF---
FADB_SHEAM      ------------------------------------------------
FADB_SALNS      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ENTCL      ------------------------------------------------
MENB_HAEIN      ALNADCDGQAGLQELAGNATM-LFYMTEEGQEGRNAFNEKRAPDF---
FADB_VIBPA      ------------------------------------------------
FADB_SHIFL      ------------------------------------------------
FADB_SHIF8      ------------------------------------------------
FADB_SHIDS      ------------------------------------------------
FADB_SHEFN      ------------------------------------------------
FADB_KLEP7      ------------------------------------------------
FADB_KLEP3      ------------------------------------------------
FADB_ECOSM      ------------------------------------------------
FADB_ECOLU      ------------------------------------------------
FADB_ECOHS      ------------------------------------------------
FADB_ECO7I      ------------------------------------------------
FADB_ECO5E      ------------------------------------------------
FADB_ECO57      ------------------------------------------------
MENB_ECOLI      ALNADCDGQAGLQELAGNATM-LFYMTEEGQEGRNAFNQKRQPDF---
MENB_ECOL6      ALNADCDGQAGLQELAGNATM-LFYMTEEGQEGRNAFNQKRQPDF---
FADB_PHOPR      ------------------------------------------------
FADB_ECOUT      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ECO81      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ECO45      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
FADB_ALISL      ------------------------------------------------
FADB_VIBF1      ------------------------------------------------
FADB_SHEB8      ------------------------------------------------
FADB_CITK8      SIEAAMSFTIAKGMVAQTAGKHVKTIEAAARFGREEALNLENKSFV--
MFPA_CUCSA      ------------------------------------------------
FADB_VIBFM      ------------------------------------------------
FADB_PSEMY      ------------------------------------------------
FADB_ENT38      ------------------------------------------------
ECHP_RAT        ------------------------------------------------
FADB_SHISS      ------------------------------------------------
FADB_SHIB3      ------------------------------------------------
FADB_SHEPA      ------------------------------------------------
FADB_ESCF3      ------------------------------------------------
FADB_ECOLI      ------------------------------------------------
FADB_ECOLC      ------------------------------------------------
FADB_ECODH      ------------------------------------------------
FADB_ECOBW      ------------------------------------------------
FADB_ECO8A      ------------------------------------------------
FADB_ECO55      ------------------------------------------------
FADB_ECO24      ------------------------------------------------
FADB_SHEHH      ------------------------------------------------
FADB_SHESH      ------------------------------------------------
FADB_PSEU5      ------------------------------------------------
FADB_SHELP      ------------------------------------------------
FADB_PSYWF      ------------------------------------------------
FADB_ECOSE      ------------------------------------------------
FADB_SHEPW      ------------------------------------------------
FADB_SHEB9      ------------------------------------------------
FADB_SHEB5      ------------------------------------------------
ECH12_MYCTU     TL----------------------------------------------
ECH12_MYCBO     TL----------------------------------------------
ECHP_MOUSE      ------------------------------------------------
FADB_SHEWM      ALSEKLD-----------------------------------------
DCH_THAAR       ---RCDSVPRIKQKLVEALYLEELMASHDAVEGLKAFLEKRSANWENR
FADB_SHEB2      ------------------------------------------------
FADB_SHEON      ------------------------------------------------
FADB_SHESW      ------------------------------------------------
FADB_SHEPC      ------------------------------------------------
MFPA_BRANA      ------------------------------------------------
FADB_YERE8      ------------------------------------------------
FADB_SHESR      ------------------------------------------------
FADB_SHESM      ------------------------------------------------
FADB_SHESA      ------------------------------------------------
MFP_ORYSJ       T-DRLGSLSEARSVLNSARQ----------------------------
FADB_ACIAD      KLNPVKLNPLEQMMAF--------------------------------
CRTL_DICDI      TLRNKYNSDLDKSLTREADAQSQCWASKDIVEGILAIRESRDP-----
FADJ_YERE8      LLSG----PLGKALLF--------------------------------
FADJ_ECOUT      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOSM      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOLU      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOL5      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOK1      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO81      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO7I      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO45      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO27      ---RILAGPLGRALLFK-------------------------------
FADB_PSYCK      ------------------------------------------------
FADB_PSYA2      ------------------------------------------------
FADJ_SHISS      ---RILAGPLGRALLFK-------------------------------
FADJ_SHIFL      ---RILAGPLGRALLFK-------------------------------
FADJ_SHIF8      ---RILAGPLGRALLFK-------------------------------
FADJ_KLEP3      ---RVLAGPLGRHLLF--------------------------------
FADJ_ECOLI      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOL6      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOHS      ---RILAGPLGRALLFK-------------------------------
FADJ_ECODH      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOBW      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO5E      ---RILAGPLGRALLFK-------------------------------
FADJ_SHIB3      ---RILAGPLGRALLFK-------------------------------
FADJ_ECOSE      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO8A      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO55      ---RILAGPLGRALLFK-------------------------------
FADJ_ECO24      ---RILAGPLGRALLFK-------------------------------
FADB_PSEFS      ------------------------------------------------
ECHH_RHOCA      XXXXGLSNPLPAQLALEARLQGELGQSADFREGVQAFLEKRPPHFTGR
CDY2_HUMAN      LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF---
YHAR_BACSU      GIFQSLQIEELKKVLSLERSAQERMRTKDHQEGIRAFLEKREPKF---
FADJ_ECOLC      ---RILAGPLGRALLFK-------------------------------
FADJ_SHIBS      ---RILAGPLGRALLFK-------------------------------
FADJ_PECCP      ------------------------------------------------
FADJ_ECO57      ------------------------------------------------
FADJ_SHIDS      ---RILAGPLGRALLFK-------------------------------
FADB_COLP3      ------------------------------------------------
CDY1_HUMAN      LVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDEF---
FADB_PSEFR      ------------------------------------------------
FADJ_PHOPR      ------------------------------------------------
FADJ_KLEP7      ------------------------------------------------
FADJ_ERWCT      ------------------------------------------------
FADB_PSEPU      ------------------------------------------------
FADJ_YERPS      ------------------------------------------------
FADJ_YERPP      ------------------------------------------------
FADJ_YERPN      ------------------------------------------------
FADJ_YERPE      ------------------------------------------------
FADJ_YERPA      ------------------------------------------------
FADJ_YERP3      ------------------------------------------------
FADJ_SERP5      ------------------------------------------------
CDYL1_HUMAN     LVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF---
FADB_PSEPW      ------------------------------------------------
FADB_PSEPF      ------------------------------------------------
CDYL_RAT        LVRCNMKMELEQANERECDALKKIWGSAQGMDSMLKYLQRKIDEF---
FADJ_PHOLL      ------------------------------------------------
FADB_PSEE4      ------------------------------------------------
ECHD1_PONAB     SVCSGRELYLEEALQNER------------------------------
ECHD1_HUMAN     SVCSGRELYLEEALQNER------------------------------
HIBCH_MOUSE     SYHAKSKMDQDKSIIFE-------------------------------
HIBCH_DANRE     QSHLDAEKPF---VLQEQTEAIDRLFSAGSVEEIVENLKKDGSAF---
FADJ_ENT38      ---RILAGPLGRALLFNR------------------------------
FADB_PSEPG      ------------------------------------------------
FADB_PSEOL      ------------------------------------------------
FADB_PSEF5      ------------------------------------------------
FADB_ACIBY      ------------------------------------------------
FADB_ACIBS      ------------------------------------------------
FADB_ACIBC      ------------------------------------------------
FADB_ACIB5      ------------------------------------------------
FADB_ACIB3      ------------------------------------------------
CDYL_MOUSE      LVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF---
ECHD1_MOUSE     SVCSARELYIEEALQNER------------------------------
FADJ_ESCF3      ---RILAGPLGRSLLF--------------------------------
ECHD1_RAT       SVCSGRELYLEEALQNER------------------------------
FADB_PSEPK      ------------------------------------------------
FADB_PSEP1      ------------------------------------------------
FADB_PSEAE      ------------------------------------------------
FADB_PSEAB      ------------------------------------------------
FADB_PSEA8      ------------------------------------------------
FADB_PSEA7      ------------------------------------------------
ECH1_RAT        NLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKK-------
HIBCH_RAT       SYHAKSKMGQDKSIIFE-------------------------------
ECHD1_BOVIN     SVSSCKELCLEEALQRER------------------------------
ECH1_MOUSE      NLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKR-------
CDYL2_HUMAN     ------------------------------------------------
ECHA6_MYCTU     VLND--DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF---
ECHA6_MYCBO     VLND--DGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKF---
ECH12_MYCLE     AL----------------------------------------------
PECI_MOUSE      LIRKNEKEKLYAVNAEECTTLQARWLSEECMNAIMSFV-SRKP-----
HIBCH_YEAST     SIDE-FVSPLPKDYVFK-------------------------------
HIBCH_CHICK     LLN---------------------------------------------
PKSI_BACSU      HL----------------------------------------------
HIBCH_XENLA     ------------------------------------------------
YKB4_CAEEL      ELMRTTQI----------------------------------------
FADJ_VIBF1      ------------------------------------------------
HIBCH_XENTR     ------------------------------------------------
PECI_RAT        LIRKNEKEKLHAVNEEECTTLRARWLSEECINAIMSFV-TRKP-----
HIBCH_HUMAN     ------------------------------------------------
HIBCH_BOVIN     ------------------------------------------------
PECI_HUMAN      VIRKR-----------EREKLHA-------------------------
PKSH_BACSU      ------------------------------------------------
ECH14_MYCTU     ELAKRLELPQAKSV--QSPEFAARLAAAQHR-----------------
ECH14_MYCBO     ELAKRLELPQAKSV--QSPEFAARLAAAQHR-----------------
ECH17_MYCPA     XXXXVFELPRAERLAAEQR-----------------------------
ECH17_MYCA1     ------------------------------------------------
FADN_BACSU      ------------------------------------------------
ECH17_MYCTU     ------------------------------------------------
ECH17_MYCTA     ------------------------------------------------
ECH17_MYCBP     ------------------------------------------------
ECH17_MYCBO     ------------------------------------------------
FAD3_RICFE      ------------------------------------------------
FAD3_RICPR      ------------------------------------------------
FAD3_RICTY      ------------------------------------------------
FADJ_VIBPA      ------------------------------------------------
FADJ_ENTS8      ------------------------------------------------
D3D2_MOUSE      MMRKA----TADNLIKQREADIQNFTSFISKDSIQMYLEKLK------
HIBCH_SCHPO     ------------------------------------------------
FADJ_VIBVY      ------------------------------------------------
FADJ_VIBHB      ------------------------------------------------
D3D2_RAT        MMRKA----TADNLIKQREADIQNFTSFISRDSIQVYLEKLK------
FADJ_VIBVU      ------------------------------------------------
FADJ_VIBCH      ------------------------------------------------
FADJ_VIBC3      ------------------------------------------------
HIBCH_DICDI     ------------------------------------------------
FADJ_SHELP      KLLEG--TPVGRNIIFEQ------------------------------
D3D2_HUMAN      ------------------------------------------------
CLPP1_CHLMU     SANEAMEFGLLDGILFSFNDL---------------------------