[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE38828.1

[Show Plain Result]


## Summary of Sequence Search
    1::372
   13::377     e-117  55%  378 aa  YXJG_BACSU RecName: Full=Uncharacterized protein yxjG;
   14::376     e-116  55%  377 aa  YXJH_BACSU RecName: Full=Uncharacterized protein yxjH;
   12::295     1e-11  26%  338 aa  METE_SULTO RecName: Full=Probable methylcobalamin:homocysteine
   11::295     7e-11  26%  338 aa  METE_PYRAB RecName: Full=Probable methylcobalamin:homocysteine
   11::295     3e-10  25%  338 aa  METE_PYRHO RecName: Full=Probable methylcobalamin:homocysteine
   11::295     6e-09  26%  338 aa  METE_PYRFU RecName: Full=Probable methylcobalamin:homocysteine
   12::315     3e-07  24%  332 aa  METE_SULSO RecName: Full=Probable methylcobalamin:homocysteine
  427::490     3e-07  36%  760 aa  METE_CHRVO RecName:
   13::296     6e-07  26%  339 aa  METE_SULAC RecName: Full=Probable methylcobalamin:homocysteine
   12::315     2e-06  24%  332 aa  METE_SULIY RecName: Full=Probable methylcobalamin:homocysteine
   12::180     2e-06  26%  332 aa  METE_SULIM RecName: Full=Probable methylcobalamin:homocysteine
   12::180     2e-06  26%  332 aa  METE_SULIL RecName: Full=Probable methylcobalamin:homocysteine
   12::180     2e-06  26%  332 aa  METE_SULIK RecName: Full=Probable methylcobalamin:homocysteine
   12::180     2e-06  26%  332 aa  METE_SULIA RecName: Full=Probable methylcobalamin:homocysteine
   12::180     2e-06  26%  332 aa  METE_SULIN RecName: Full=Probable methylcobalamin:homocysteine
  442::499     3e-06  38%  767 aa  METE_BIFA0 RecName:
  442::611     7e-06  28%  768 aa  METE_BIFAA RecName:
  433::490     9e-06  36%  757 aa  METE_PASMU RecName:
  404::466     1e-05  33%  735 aa  METE_THEP1 RecName:
  441::610     1e-05  28%  767 aa  METE_BIFLO RecName:
  441::610     1e-05  28%  767 aa  METE_BIFLI RecName:
  441::610     1e-05  28%  767 aa  METE_BIFLD RecName:
  429::497     1e-05  35%  767 aa  METE_BURVG RecName:
  432::489     1e-05  38%  757 aa  METE_ACTPJ RecName:
  432::489     1e-05  38%  757 aa  METE_ACTP7 RecName:
  436::493     2e-05  33%  758 aa  METE_XYLFT RecName:
  436::493     2e-05  33%  758 aa  METE_XYLFM RecName:
  436::493     2e-05  33%  758 aa  METE_XYLF2 RecName:
  445::507     2e-05  37%  776 aa  METE_RHILO RecName:
  432::489     2e-05  36%  756 aa  METE_HAEIN RecName:
  432::489     2e-05  36%  756 aa  METE_HAEIG RecName:
  432::489     2e-05  36%  756 aa  METE_HAEIE RecName:
  432::489     2e-05  38%  757 aa  METE_ACTP2 RecName:
  436::493     3e-05  31%  758 aa  METE_XYLFA RecName:
  433::490     3e-05  36%  758 aa  METE_NEIMF RecName:
  433::490     3e-05  36%  758 aa  METE_NEIMA RecName:
  433::490     3e-05  36%  758 aa  METE_NEIM0 RecName:
  430::492     3e-05  32%  761 aa  METE_HAHCH RecName:
  449::517     3e-05  34%  784 aa  METE_ACIF5 RecName:
  449::517     3e-05  34%  784 aa  METE_ACIF2 RecName:
   11::295     3e-05  24%  336 aa  METE_PYRKO RecName: Full=Probable methylcobalamin:homocysteine
  439::501     4e-05  33%  767 aa  METE_YEAST RecName:
  433::490     6e-05  34%  758 aa  METE_NEIMB RecName:
  433::490     6e-05  34%  758 aa  METE_NEIG1 RecName:
  418::634     6e-05  27%  745 aa  METE_CORGL RecName:
  418::634     6e-05  27%  745 aa  METE_CORGB RecName:
  442::516     7e-05  32%  769 aa  METE_MESSB RecName:
  431::488     7e-05  36%  764 aa  METE_BURXL RecName:
  431::488     7e-05  36%  764 aa  METE_BURPP RecName:
  404::466     1e-04  30%  734 aa  METE_THESQ RecName:
  404::466     1e-04  30%  734 aa  METE_THEMA RecName:
  435::757     1e-04  22%  762 aa  METE_BACLD RecName:
  451::520     1e-04  35%  788 aa  METE_RHOPT RecName:
  451::520     1e-04  35%  788 aa  METE_RHOPA RecName:
  427::490     1e-04  33%  756 aa  METE_MYCPA RecName:
  427::490     1e-04  33%  756 aa  METE_MYCA1 RecName:
  426::489     1e-04  33%  762 aa  METE_METCA RecName:
  417::479     2e-04  30%  744 aa  METE_TRIEI RecName:
  432::489     2e-04  33%  776 aa  METE_RALSO RecName:
  435::492     2e-04  33%  776 aa  METE_RALPJ RecName:
  429::486     2e-04  31%  756 aa  METE_BACHD RecName:
  435::497     2e-04  33%  769 aa  METE_ACICJ RecName:
  445::508     2e-04  30%  771 aa  METE_NITWN RecName:
  428::485     2e-04  29%  757 aa  METE_LACLS RecName:
  449::512     2e-04  31%  777 aa  METE_CAUCR RecName:
  435::497     2e-04  30%  764 aa  METE_BURCM RecName:
  435::497     2e-04  30%  764 aa  METE_BURCC RecName:
  437::499     3e-04  35%  772 aa  METE_THIDA RecName:
  431::506     3e-04  32%  759 aa  METE_MYCTU RecName:
  431::506     3e-04  32%  759 aa  METE_MYCTA RecName:
  431::506     3e-04  32%  759 aa  METE_MYCBP RecName:
  431::506     3e-04  32%  759 aa  METE_MYCBO RecName:
  432::489     4e-04  34%  792 aa  METE_RALEU RecName:
  432::489     4e-04  34%  792 aa  METE_RALEH RecName:
  428::485     4e-04  29%  757 aa  METE_LACLM RecName:
  435::737     4e-04  23%  762 aa  METE_BACSU RecName:
  448::505     5e-04  29%  775 aa  METE_CYTH3 RecName:
  441::503     5e-04  32%  767 aa  METE_CANAL RecName:
  435::497     5e-04  30%  764 aa  METE_BURCJ RecName:
  438::495     6e-04  33%  763 aa  METE_PARL1 RecName:
  433::490     6e-04  33%  758 aa  METE_NITEU RecName:
  435::497     8e-04  29%  764 aa  METE_BURS3 RecName:
  435::497     8e-04  29%  763 aa  METE_BURP8 RecName:
  448::510     8e-04  32%  781 aa  METE_BRAJA RecName:
    1::372

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQRTKAPFRADEVGSLLRPQSIKDARARLEKGEISAADLRRIEDMEIEKIVHKQSAIGLKLATDGEFRRS
YXJG_BACSU      LQRKKPPFRADQVGSLLRSEPVKKARLQKAAGEMTAEQLRQIENDEIIRIVEKQKETGLNVVTDGEFRRA
YXJH_BACSU      -KQRKAPFRADHVGSLLRSVPVKEARQKKAAGEMTAEQLRDIENQEITRIVEKQKEIGLDVVTDGEFRRS
METE_SULTO      ------------IGSYPRPKWLREAIRLHKAGKISDEDLQEAFDDAVVTVLHDHEIAGVDVPTDGEMRRD
METE_PYRAB      ------------IGSYPKPRWLLRMYKLRELGKIPEEDFKEAVKDASVAVLREHERAGVDIPWDGEMWRS
METE_PYRHO      ------------IGSYPKPRWLLRMYRLRDLGKIPEEDFKEAVKDASVSVLREHERAGVDIPWDGEMWRT
METE_PYRFU      ------------IGSYPKPRWLLRMYKLRELGKIPEEDFKEVRDASIS-VLREHERAGIDIPWDGEMGRS
METE_SULSO      ------------IGSYPRPKWLRESIRLHKAGKMSNEDLQEAFNDAVIAVFQDHYKAGVDVPTDGEVRRD
METE_CHRVO      ------PLPTTTIGSFPQTPAIRASRAAFKKGELSAAGYRQAMEKEIELAIRRQEALGLDVLVHGEAERN
METE_SULAC      ------------IGSYPRPKWLRETIRLHRAGKVNQEDLEEAFNDAVVTVVRDHQEAGIDVPTDGEMRRD
METE_SULIY      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFNDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_SULIM      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFNDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_SULIL      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFNDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_SULIK      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFNDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_SULIA      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFNDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_SULIN      ------------IGSYPRPKWLRESIRLHKAGKISDEDLQEAFSDAVIAVLKDHYNAGVDVPTDGEVRRD
METE_BIFA0      ------------IGSFPQTKQVRAERARLRKGEISQGQYDEFIRRQIDDVVAKQEQIGLDVLVHGEFERN
METE_BIFAA      ------------IGSFPQTKEVRAERAKLRKGEITKAEYDEFMKNQIDACIKHQEEIGLDVLVHGEFERN
METE_PASMU      ------------IGSFPQTVEIRQARAKFKKGELSVADYEAAMKKEIEFVVRRQEELDLDVLVHGEAERN
METE_THEP1      -------FPTTTIGSFPQTSDVRKMRARYRRGEISEEEYESFIKEQIKKVVRIQEEIGLDVLVHGEFERT
METE_BIFLO      ------------IGSFPQTKEIRAERAKLRKGEVTKEAYDEFIKAQIDAVIKKQEEIGLDVLVHGEFERN
METE_BIFLI      ------------IGSFPQTKEIRAERAKLRKGEVTKEAYDEFIASQIDAVIRKQEEIGLDVLVHGEFERN
METE_BIFLD      ------------IGSFPQTKEIRAERAKLRKGEVTKEAYDEFIKAQIDAVIKKQEEIGLDVLVHGEFERN
METE_BURVG      --RLKLPFPTTTIGSFPQTAEIRDARRRFKAGELDEAGYRHAMHAEIERSVREQESLQLDVLVHGEAERN
METE_ACTPJ      ------------IGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLVHGEAERN
METE_ACTP7      ------------IGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLVHGEAERN
METE_XYLFT      ------------IGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLVHGEFERN
METE_XYLFM      ------------IGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLVHGEFERN
METE_XYLF2      ------------IGSFPQTLEVREARAQFKSGKLSESDYEAFLKAETERCVRTQEEIGLDVLVHGEFERN
METE_RHILO      -------FPTTTIGSFPQTAEVRKARAAHAKGELSYVDYEAFLKKEIEAAVRWQEEIGLDVLVHGEFERN
METE_HAEIN      ------------IGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLVHGEAERN
METE_HAEIG      ------------IGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLVHGEAERN
METE_HAEIE      ------------IGSFPQTTEIRHARASFKKGELSLADYEAAMKKEIEYVVRRQEELDLDVLVHGEAERN
METE_ACTP2      ------------IGSFPQTLEIRHARAAFKKGELSLADYEAAMKKEIEFVVRKQEELDLDVLVHGEGERN
METE_XYLFA      ------------IGSFPQTLEVREARAQFKSGKLSESDYETFLKAETERCIRTQEEIGLDVLVHGEFERN
METE_NEIMF      ------------IGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
METE_NEIMA      ------------IGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
METE_NEIM0      ------------IGSFPQTTEIRQARAAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
METE_HAHCH      -------FPTTTIGSFPQTADIRNARRRYRQGELQDNEYRTLMQQEIERCVREQENLGLDVLVHGEAERN
METE_ACIF5      --RFKLPFPTTSIGSFPQTPEIRKARLQNRKGELSNADYQKAMEAEIALVVKEQERLGIDVPVHGEPERN
METE_ACIF2      --RFKLPFPTTSIGSFPQTPEIRKARLQNRKGELSNADYQKAMEAEIALVVKEQERLGIDVPVHGEPERN
METE_PYRKO      ------------IGSYPKPRWLLRMYNLRELGRLPEEDFREAVRDASVAVLREHERAGIDIPWDGEMGRS
METE_YEAST      -------FPTTTIGSFPQTKDIRINRNKFNKGTISAEEYEKFINSEIEKVIRFQEEIGLDVLVHGEPERN
METE_NEIMB      ------------IGSFPQTTEIRQARSAFKKGELSAADYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
METE_NEIG1      ------------IGSFPQTTEIRQARAAFKKGELSASDYEAAMKKEIALVVEEQEKLDLDVLVHGEAERN
METE_CORGL      ------------IGSFPQTPSIRSARARLRKESITLEQYEEAMREEIDLVIAKQEELGLDVLVHGEPERN
METE_CORGB      ------------IGSFPQTPSIRSARARLRKESITLEQYEEAMREEIDLVIAKQEELGLDVLVHGEPERN
METE_MESSB      -------FPTTTIGSFPQTAEVRQARAACAKGELSEAGYDGFLKGETEKAIRWQEEIGIDVLVHGEFERN
METE_BURXL      ------------IGSFPQTAAIRQARAAYKRGELRALDYLQRMRTEIEIAVRKQEELGLDVLVHGEAERN
METE_BURPP      ------------IGSFPQTPAIRQARAAYKRGELRALDYLQRMRAEIEIAVRKQEELGLDVLVHGEAERN
METE_THESQ      -------FPTTTIGSFPQTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERT
METE_THEMA      -------FPTTTIGSFPQTPEVRKMRSKYRKGEISKEEYEAFIKEQIKKAIELQEEIGLDVLVHGEFERT
METE_BACLD      ------------IGSFPQTADVRSARQKWRKKEWSDEQYEAFIQEETKKWIDIQEDLGLDVLVHGEFERT
METE_RHOPT      -QRLQLPFPTTTIGSFPQTAQIRQARAAHAKGAISDADYNTFLRGETARAIQWQEKVGLDVLVHGEFERN
METE_RHOPA      -QRLQLPFPTTTIGSFPQTAQIRQARAAHAKGAISDADYNTFLRGETARAIQWQEKVGLDVLVHGEFERN
METE_MYCPA      ------PLPTTTIGSYPQTSAIRKARAALRSGEIDQAEYERRMKKEIADVITLQEQLGLDVLVHGEPERN
METE_MYCA1      ------PLPTTTIGSYPQTSAIRKARAALRSGEIDQAEYERRMKKEIADVITLQEQLGLDVLVHGEPERN
METE_METCA      ------PFPTTTIGSFPQTPKIRAARAAHRRGELNGDAYRDAMRAAIREAVYKQESLGLDLLVHGEAERN
METE_TRIEI      -------FPTTTIGSFPQTKQVRKLRARYKKGELTQAEYLAQIDANIAYCIGLQEGMGMDVLVHGEFERS
METE_RALSO      ------------IGSFPQTAEIRQARAQYKRGELQALTYLERMRAEIADVVQRQEALGLDMLVHGEAERN
METE_RALPJ      ------------IGSFPQTPEIRRARAQHKRGDLPALDYLQRMRTEIADVVRRQEALGLDMLVHGEAERN
METE_BACHD      ------------IGSFPQTKDVRRTRSLWRKGELSTVEYERTMKSYIEKWINIQEELGLDVLVHGEFERN
METE_ACICJ      -------FPTTTIGSLPQTSGVRRTRAALARGEIGAAEYDEAIATWTEDAIRLQERIGLDVLVHGEFERN
METE_NITWN      ------PFPTTTIGSFPQTAEVRKARSAHAKGTLSDTDYEKFLQEETARTIRWQEDIGLDVLVHGEFERN
METE_LACLS      ------------IGSFPQTPEVRKARLQYKRGELSKSDYEAFLEEKIKECLELQENIGLDVLVHGEFERN
METE_CAUCR      ------PLPTTTIGSFPQTTEVRQARAAFAKGQISDATYEAFLRQETARAVAWQETVGLDVLVHGEFERN
METE_BURCM      -------FPTTTIGSFPQTADIRHARSQFKAGALDEAGYRAAMQAEIERSVREQESLGLDVLVHGEAERN
METE_BURCC      -------FPTTTIGSFPQTAEIRQARSRFKAGALDEAGYRKAMQAEIERSVREQESLELDVLVHGEAERN
METE_THIDA      -------FPTTTIGSFPQTAEIRQARRRFKAGEIDDAAYRAAMQDEIAHSVRAQEALGLDVLVHGEAERN
METE_MYCTU      ------PLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLVHGEPERN
METE_MYCTA      ------PLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLVHGEPERN
METE_MYCBP      ------PLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLVHGEPERN
METE_MYCBO      ------PLPTTTIGSYPQTSAIRVARAALRAGEIDEAEYVRRMRQEITEVIALQERLGLDVLVHGEPERN
METE_RALEU      ------------IGSFPQTAAIRQTRAAFKRGEIGALEYLERIRAEIAVAVRKQEALGLDVLVHGEAERN
METE_RALEH      ------------IGSFPQTAAIRQTRAAFKRGEIGALEYLERIRAEIAVAVRKQEALGLDVLVHGEAERN
METE_LACLM      ------------IGSFPQTPEIRKSRLQYKRGELSKSDYEAFLEEKIKECLELQENIGLDVLVHGEFERN
METE_BACSU      ------------IGSFPQSAEVRSARQKWRKAEWSDEQYQNFINAETKRWIDIQEELELDVLVHGEFERT
METE_CYTH3      ------------IGSFPQTDEVRANRAKYKKGDITLAQYEDFVKTEMTKAIEWQEKIGIDVLVHGEFERN
METE_CANAL      -------FPTTTIGSFPQTKDIRINRNKFAKGQITAEEYEAFINKEIETVVRFQEEIGLDVLVHGEPERN
METE_BURCJ      -------FPTTTIGSFPQTAEIRQARSRFKAGTLDEAGYRTAMQAEIERSVREQESLELDVLVHGEAERN
METE_PARL1      ------------IGSFPQTSDVRKARASLRRGDWNEAQYDAFMKAEIEKTIRLQERIGLDVLVHGEPERT
METE_NITEU      ------------IGSFPQTATIRQARAAFRKNELSHLEYLSAMRAEIREMIRKQEEIGLDVLVHGEPERN
METE_BURS3      -------FPTTTIGSFPQTGEIRQARSQFKAGTLDEAGYRKAMQAEIERSVREQESLELDVLVHGEAERN
METE_BURP8      -------FPTTTIGSFPQTADIRRARSQFKAGELDYAGYKLAMEREITRAVKEQETLGLDVLVHGEAERN
METE_BRAJA      -------FPTTTIGSFPQTTAVRNARAAHARGAMSEEQYDRFLKEEIARAVRWQEDIGLDVLVHGEFERN


                         .         .         *         .         .         .         .:140
query           WWHFDFLSHLTGCELYHPDTGIQFAGVQTRNDSIRVIGKLDFPDDHPMLEHFRFLKRHADIAHVTAKMTI
YXJG_BACSU      WWHFDFLENLDGVEPFTPEQGIQFHNVQTKARGIKVTGDIDF-STHPMLEDYSFL--HSIAGDATPKMTI
YXJH_BACSU      WWHYDFLEGLDGVEPFIPAEGIQFHNTKTKARSIKVTGKLDFTS-HPALGDYQFL--HEIAGNATPKLTI
METE_SULTO      EMVEFFAERLAGFKFYGP---VRVWGTNYYRKP-SVVSKVEY--IKPMLDEFLFAKSVSYTENL--KITI
METE_PYRAB      EMTEHFTAKISGFKFYGP---VRVWGNAYFNKAAAV-DKLEYKEPL-VLEEFLWVRENT--TREIVKVPI
METE_PYRHO      EMTEHFTAKIGGFKFYGP---VRVWGNAYFNKAAAV-DKLEYKEPL-VLEEFLWVKKNT--TREVVKIPI
METE_PYRFU      EMTEYFTSKIKGFKFYGP---VRVWGNAYFNKAAAV-DKLEY-EEPLVLDEFLWVKENT--TREIVKIPI
METE_SULSO      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEYRE--PMLDEFTFAKSVSYTDNL--KITI
METE_CHRVO      ----------------------------------------------------------------------
METE_SULAC      EMVEFFAERLSGFKFY--------GHVRVWGDHYSVTGKIKY--NNPMLDEVNFAKSVSYTQNL--KVTI
METE_SULIY      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_SULIM      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_SULIL      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_SULIK      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_SULIA      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_SULIN      EMVEFFAERIKGFKFYGP---VRVWGTAYYRKP-SVVSKIEY--KKPMLDEFTFAKSVSYTDNL--KITI
METE_BIFA0      ----------------------------------------------------------------------
METE_BIFAA      DMVEYFGQNLNGF-LFTKNAWVQSYGTRCVKPPI-VWG--DVSRANPIVEWSAYAQSRTD--HVMKGMLT
METE_PASMU      ----------------------------------------------------------------------
METE_THEP1      ----------------------------------------------------------------------
METE_BIFLO      DMVEYFGQNLNGF-LFTKNAWVQSYGTRCVKPPI-VWG--DVSRANPIVEWSAYAQSKTD--HVMKGMLT
METE_BIFLI      DMVEYFGQNLNGF-LFTKNAWVQSYGTRCVKPPI-VWG--DVSRANPIVEWSAYAQSKTD--HVMKGMLT
METE_BIFLD      DMVEYFGQNLNGF-LFTKNAWVQSYGTRCVKPPI-VWG--DVSRANPIVEWSAYAQSKTD--HVMKGMLT
METE_BURVG      ----------------------------------------------------------------------
METE_ACTPJ      ----------------------------------------------------------------------
METE_ACTP7      ----------------------------------------------------------------------
METE_XYLFT      ----------------------------------------------------------------------
METE_XYLFM      ----------------------------------------------------------------------
METE_XYLF2      ----------------------------------------------------------------------
METE_RHILO      ----------------------------------------------------------------------
METE_HAEIN      ----------------------------------------------------------------------
METE_HAEIG      ----------------------------------------------------------------------
METE_HAEIE      ----------------------------------------------------------------------
METE_ACTP2      ----------------------------------------------------------------------
METE_XYLFA      ----------------------------------------------------------------------
METE_NEIMF      ----------------------------------------------------------------------
METE_NEIMA      ----------------------------------------------------------------------
METE_NEIM0      ----------------------------------------------------------------------
METE_HAHCH      ----------------------------------------------------------------------
METE_ACIF5      ----------------------------------------------------------------------
METE_ACIF2      ----------------------------------------------------------------------
METE_PYRKO      EMTEYFTAKIAGFKFYGP---IRVWGNAYFNKA-AAVSKLEYREP-LVLDEFRWVKENT--TREIIKVPI
METE_YEAST      ----------------------------------------------------------------------
METE_NEIMB      ----------------------------------------------------------------------
METE_NEIG1      ----------------------------------------------------------------------
METE_CORGL      DM-VQYFSELLDGFLSTANGWVQSYGSRCVRPPV-LFGNVSRP--APMTVKWFQYAQSLTQKHVKGMLTG
METE_CORGB      DM-VQYFSELLDGFLSTANGWVQSYGSRCVRPPV-LFGNVSRP--APMTVKWFQYAQSLTQKHVKGMLTG
METE_MESSB      DMVQYFSEQLSG----------------------------------------------------------
METE_BURXL      ----------------------------------------------------------------------
METE_BURPP      ----------------------------------------------------------------------
METE_THESQ      ----------------------------------------------------------------------
METE_THEMA      ----------------------------------------------------------------------
METE_BACLD      DM-VEYFGEKLGGFAFTKYAWVQSYGSRCVRPPV-IYGDVEFKEPMTVKEYAQSLTSKKVKGMLTGPVTI
METE_RHOPT      ----------------------------------------------------------------------
METE_RHOPA      ----------------------------------------------------------------------
METE_MYCPA      ----------------------------------------------------------------------
METE_MYCA1      ----------------------------------------------------------------------
METE_METCA      ----------------------------------------------------------------------
METE_TRIEI      ----------------------------------------------------------------------
METE_RALSO      ----------------------------------------------------------------------
METE_RALPJ      ----------------------------------------------------------------------
METE_BACHD      ----------------------------------------------------------------------
METE_ACICJ      ----------------------------------------------------------------------
METE_NITWN      ----------------------------------------------------------------------
METE_LACLS      ----------------------------------------------------------------------
METE_CAUCR      ----------------------------------------------------------------------
METE_BURCM      ----------------------------------------------------------------------
METE_BURCC      ----------------------------------------------------------------------
METE_THIDA      ----------------------------------------------------------------------
METE_MYCTU      DMVQYFAEQLAG----------------------------------------------------------
METE_MYCTA      DMVQYFAEQLAG----------------------------------------------------------
METE_MYCBP      DMVQYFAEQLAG----------------------------------------------------------
METE_MYCBO      DMVQYFAEQLAG----------------------------------------------------------
METE_RALEU      ----------------------------------------------------------------------
METE_RALEH      ----------------------------------------------------------------------
METE_LACLM      ----------------------------------------------------------------------
METE_BACSU      DMVEYFGEKLAGFAF------TKYAWVQSYGSRVRIYGDVEFIE--PMTVKDTVYAQSLTSKHVKGMLTG
METE_CYTH3      ----------------------------------------------------------------------
METE_CANAL      ----------------------------------------------------------------------
METE_BURCJ      ----------------------------------------------------------------------
METE_PARL1      ----------------------------------------------------------------------
METE_NITEU      ----------------------------------------------------------------------
METE_BURS3      ----------------------------------------------------------------------
METE_BURP8      ----------------------------------------------------------------------
METE_BRAJA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           PSPAVLHFRGGRKAISSEVYPDLDGFFEDLARTYRKAVKAFYDAGCRYLQFDDTVWAYLCSQDELQKARE
YXJG_BACSU      PSPNMLFFRG--KLEKDEYKNDYQLFQHDVSKAYKKAIQAFYDRGCRYLQLDDTAWAVFLSEKGLKQIEA
YXJH_BACSU      PSPNMLFF--GEKA-DKGIYDDQEEYFHDMAQAYKKAIKAFYDAGCRYLQLDDTSWSLFFEDKGREVVRA
METE_SULTO      TGPYTI-----AEWSYNEYYKSKKDLAFDLAKVINSEMKKLVEAGAKIIQVDEP--AIHTHKNEVEWAIE
METE_PYRAB      TGPYTI-----AEWSFNEYYPDKESFVMDLAKIINKELKTLEEHGATYIQLDEP--AMLNHPDEVPLAVE
METE_PYRHO      TGPYTI-----AEWSFNEYYPDKESFIMDLAKIINKELKMLENHGALYIQLDEP--AMLNHPDEVPLAVE
METE_PYRFU      TGPYTI-----AEWSFNEYYPDKESFVMDLAEIINKELKVLEKHGAKFVQLDEP--AMLNHPSEVPLAVD
METE_SULSO      TGPYTI-----AEWSYNEYYRNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDEP--ALHTRKEDVSWGVE
METE_CHRVO      ----------------------------------------------------------------------
METE_SULAC      TGPYTI-----SEWSYNEYYKTQRDMAFDLAKVINQEIKNLVDIGIKVIQVDEP--AIHTRKEDVEWAID
METE_SULIY      TGPYTI-----VEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDEP--ALHTRREDVSWGVE
METE_SULIM      TGPYTI-----AEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDE-----------------
METE_SULIL      TGPYTI-----AEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDE-----------------
METE_SULIK      TGPYTI-----AEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDE-----------------
METE_SULIA      TGPYTI-----AEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDE-----------------
METE_SULIN      TGPYTI-----AEWSYNEYYKNKKDLVFDLAKAINQEIKNLVEAGAKIIQIDE-----------------
METE_BIFA0      ----------------------------------------------------------------------
METE_BIFAA      GPVTILNWSWPREDITHEQQT------QQLALAIRDEVLDLEKAGIKVIQIDE-----------------
METE_PASMU      ----------------------------------------------------------------------
METE_THEP1      ----------------------------------------------------------------------
METE_BIFLO      GPVTILNWSWPREDITHEEQT------KQLALAIRDEVLDLEAAGIKVIQIDE-----------------
METE_BIFLI      GPVTILNWSWPREDITHEEQT------KQLALAIRDEVLDLEAAGIKIIQIDE-----------------
METE_BIFLD      GPVTILNWSWPREDITHEEQT------KQLALAIRDEVLDLEAAGIKVIQIDE-----------------
METE_BURVG      ----------------------------------------------------------------------
METE_ACTPJ      ----------------------------------------------------------------------
METE_ACTP7      ----------------------------------------------------------------------
METE_XYLFT      ----------------------------------------------------------------------
METE_XYLFM      ----------------------------------------------------------------------
METE_XYLF2      ----------------------------------------------------------------------
METE_RHILO      ----------------------------------------------------------------------
METE_HAEIN      ----------------------------------------------------------------------
METE_HAEIG      ----------------------------------------------------------------------
METE_HAEIE      ----------------------------------------------------------------------
METE_ACTP2      ----------------------------------------------------------------------
METE_XYLFA      ----------------------------------------------------------------------
METE_NEIMF      ----------------------------------------------------------------------
METE_NEIMA      ----------------------------------------------------------------------
METE_NEIM0      ----------------------------------------------------------------------
METE_HAHCH      ----------------------------------------------------------------------
METE_ACIF5      ----------------------------------------------------------------------
METE_ACIF2      ----------------------------------------------------------------------
METE_PYRKO      TGPYTI-----AEWSFNEYYSSKEELAFDLAKILNKEFKLLEKEGATFIQIDEP--AMLNHPDEVSIAVE
METE_YEAST      ----------------------------------------------------------------------
METE_NEIMB      ----------------------------------------------------------------------
METE_NEIG1      ----------------------------------------------------------------------
METE_CORGL      PVTILAW---------SFVRDDLATTADQVALALRDEINDLIEAGAKIIQVDEPAIRELLPLRDV-----
METE_CORGB      PVTILAW---------SFVRDDLATTADQVALALRDEINDLIEAGAKIIQVDEPAIRELLPLRDV-----
METE_MESSB      ----------------------------------------------------------------------
METE_BURXL      ----------------------------------------------------------------------
METE_BURPP      ----------------------------------------------------------------------
METE_THESQ      ----------------------------------------------------------------------
METE_THEMA      ----------------------------------------------------------------------
METE_BACLD      LNWSFARYDLPRKEIAFQI-----------ACALRKEVEALEKAGIQIIQVDEP------ALREGLPLKE
METE_RHOPT      ----------------------------------------------------------------------
METE_RHOPA      ----------------------------------------------------------------------
METE_MYCPA      ----------------------------------------------------------------------
METE_MYCA1      ----------------------------------------------------------------------
METE_METCA      ----------------------------------------------------------------------
METE_TRIEI      ----------------------------------------------------------------------
METE_RALSO      ----------------------------------------------------------------------
METE_RALPJ      ----------------------------------------------------------------------
METE_BACHD      ----------------------------------------------------------------------
METE_ACICJ      ----------------------------------------------------------------------
METE_NITWN      ----------------------------------------------------------------------
METE_LACLS      ----------------------------------------------------------------------
METE_CAUCR      ----------------------------------------------------------------------
METE_BURCM      ----------------------------------------------------------------------
METE_BURCC      ----------------------------------------------------------------------
METE_THIDA      ----------------------------------------------------------------------
METE_MYCTU      ----------------------------------------------------------------------
METE_MYCTA      ----------------------------------------------------------------------
METE_MYCBP      ----------------------------------------------------------------------
METE_MYCBO      ----------------------------------------------------------------------
METE_RALEU      ----------------------------------------------------------------------
METE_RALEH      ----------------------------------------------------------------------
METE_LACLM      ----------------------------------------------------------------------
METE_BACSU      PV-TILNWSFPRNDISRKEIAFQIGL------ALRKEVKALEDAGIQIIQVDEPA----LREGLPLKTRD
METE_CYTH3      ----------------------------------------------------------------------
METE_CANAL      ----------------------------------------------------------------------
METE_BURCJ      ----------------------------------------------------------------------
METE_PARL1      ----------------------------------------------------------------------
METE_NITEU      ----------------------------------------------------------------------
METE_BURS3      ----------------------------------------------------------------------
METE_BURP8      ----------------------------------------------------------------------
METE_BRAJA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGDNPDNLQQIYSRVINYAIAERPSDMVITTHVCRGNFRSTWISSGGYEPVAETLLAGINYDGYFLEYDS
YXJG_BACSU      FGTTPDELRQLFAKSINDAIADRPDDLTVTMHICRGNFQSTWTAEGGYDAAAETIFDGLNLDGLFLEYDD
YXJH_BACSU      LGGDPETLPAIFAKTINDAVADRPDDLTITMHICRGNFRSTWAASGGYDAVAETILDGLNLDGLFLEYDD
METE_SULTO      --------------AVNESI--KGINVKVVMHVCYGEY-----------SYLEPYLDKLNVDQINLALKN
METE_PYRAB      --------------AINRAV--KGIKIKVGLHVCYSNY---YLLADYFDDIRVTQFA--------LEFAN
METE_PYRHO      --------------AINKAV--KGIKIKVGLHVCYSNY---YLLADYFDEIRVTQFA--------LEFAN
METE_PYRFU      --------------AINRAV--KGIKMKVGLHVCYSNYN---LLADYFDEIKVTQFA--------LEFAN
METE_SULSO      --------------AVNEAVKGVNAKLVM--HICYGDY------SFVAPYFNEIKVDQINF--------A
METE_CHRVO      ----------------------------------------------------------------------
METE_SULAC      S--------------INESI--KGVNVKVVLHVCYGEY-------SYLEPHLDKLLALKNYN--------
METE_SULIY      --------------AVNEAVKGVNAKLVM--HICYGEY------SFVAPYLNELKVDQINF--------A
METE_SULIM      ----------------------------------------------------------------------
METE_SULIL      ----------------------------------------------------------------------
METE_SULIK      ----------------------------------------------------------------------
METE_SULIA      ----------------------------------------------------------------------
METE_SULIN      ----------------------------------------------------------------------
METE_BIFA0      ----------------------------------------------------------------------
METE_BIFAA      ----------------------------------------------------------------------
METE_PASMU      ----------------------------------------------------------------------
METE_THEP1      ----------------------------------------------------------------------
METE_BIFLO      ----------------------------------------------------------------------
METE_BIFLI      ----------------------------------------------------------------------
METE_BIFLD      ----------------------------------------------------------------------
METE_BURVG      ----------------------------------------------------------------------
METE_ACTPJ      ----------------------------------------------------------------------
METE_ACTP7      ----------------------------------------------------------------------
METE_XYLFT      ----------------------------------------------------------------------
METE_XYLFM      ----------------------------------------------------------------------
METE_XYLF2      ----------------------------------------------------------------------
METE_RHILO      ----------------------------------------------------------------------
METE_HAEIN      ----------------------------------------------------------------------
METE_HAEIG      ----------------------------------------------------------------------
METE_HAEIE      ----------------------------------------------------------------------
METE_ACTP2      ----------------------------------------------------------------------
METE_XYLFA      ----------------------------------------------------------------------
METE_NEIMF      ----------------------------------------------------------------------
METE_NEIMA      ----------------------------------------------------------------------
METE_NEIM0      ----------------------------------------------------------------------
METE_HAHCH      ----------------------------------------------------------------------
METE_ACIF5      ----------------------------------------------------------------------
METE_ACIF2      ----------------------------------------------------------------------
METE_PYRKO      --------------AINRAV--KGVKVKFGLHVCYSNY---------------YLLADYFDDIKVSQFAL
METE_YEAST      ----------------------------------------------------------------------
METE_NEIMB      ----------------------------------------------------------------------
METE_NEIG1      ----------------------------------------------------------------------
METE_CORGL      --DKPAYLQWSVDS-FRLATAGAPDDVQIHTHMCYSEF--------------------------------
METE_CORGB      --DKPAYLQWSVDS-FRLATAGAPDDVQIHTHMCYSEF--------------------------------
METE_MESSB      ----------------------------------------------------------------------
METE_BURXL      ----------------------------------------------------------------------
METE_BURPP      ----------------------------------------------------------------------
METE_THESQ      ----------------------------------------------------------------------
METE_THEMA      ----------------------------------------------------------------------
METE_BACLD      R--DWDEYLKWAAEAFRLSTSSVEDTTQIHTHMCYSNF----------EDIVDA-IEDLDADVITIEHSR
METE_RHOPT      ----------------------------------------------------------------------
METE_RHOPA      ----------------------------------------------------------------------
METE_MYCPA      ----------------------------------------------------------------------
METE_MYCA1      ----------------------------------------------------------------------
METE_METCA      ----------------------------------------------------------------------
METE_TRIEI      ----------------------------------------------------------------------
METE_RALSO      ----------------------------------------------------------------------
METE_RALPJ      ----------------------------------------------------------------------
METE_BACHD      ----------------------------------------------------------------------
METE_ACICJ      ----------------------------------------------------------------------
METE_NITWN      ----------------------------------------------------------------------
METE_LACLS      ----------------------------------------------------------------------
METE_CAUCR      ----------------------------------------------------------------------
METE_BURCM      ----------------------------------------------------------------------
METE_BURCC      ----------------------------------------------------------------------
METE_THIDA      ----------------------------------------------------------------------
METE_MYCTU      ----------------------------------------------------------------------
METE_MYCTA      ----------------------------------------------------------------------
METE_MYCBP      ----------------------------------------------------------------------
METE_MYCBO      ----------------------------------------------------------------------
METE_RALEU      ----------------------------------------------------------------------
METE_RALEH      ----------------------------------------------------------------------
METE_LACLM      ----------------------------------------------------------------------
METE_BACSU      W----DEYLTWAAEAFRLTTSSVKNETQIHTHMCYSNF----------EDIVDT-INDLDADVITIEHSR
METE_CYTH3      ----------------------------------------------------------------------
METE_CANAL      ----------------------------------------------------------------------
METE_BURCJ      ----------------------------------------------------------------------
METE_PARL1      ----------------------------------------------------------------------
METE_NITEU      ----------------------------------------------------------------------
METE_BURS3      ----------------------------------------------------------------------
METE_BURP8      ----------------------------------------------------------------------
METE_BRAJA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ERAGGFEPLRFLPKGNKVVVVGVITSKFGELEKKDDIKRRLDEAAKFAPLAQLALSPQCGFASTEEGNIL
YXJG_BACSU      SRSGGFEPLRYVKRSDLQLVLGLVTSKFGELENPDDVKRRIEEASRYVSLDQLCLSPQCGFASTEEGNKL
YXJH_BACSU      DRSGNFDPLRFVKRKDLQIVLGLITSKYGELENPEDVKRRINEAARFVSLDQLCLSPQCGFASTEEGNLL
METE_SULTO      Y---NYEPVKLFKKWDREIGVGVIDVHNKRIETPEEVANDLKMLLDYFKPEMIWVNPDCG----------
METE_PYRAB      RQ---FRDMDFLKKSGKELGFGVVDVHNPRIETVDEIVRAIKKAFNYLEPEWLYINPDCG----------
METE_PYRHO      RQ---FRDMDFLKKSNKELGFGVVDVHNPRIESVEEIVKAIKKVFEYVEPELLYINPDCG----------
METE_PYRFU      R---NFRDMDFLKKSNKELGFGVVDVHNPRVESVEEIRQAIKKVFTYLEPEWVYINPDCG----------
METE_SULSO      LKIYNYKPLELLKKFDKELGAGVVDVHNRKVETSEEVANDIRKILEYFPPEKVWINPDCGL------KLL
METE_CHRVO      ----------------------------------------------------------------------
METE_SULAC      -----YTPVKLFKKWDREIGVGVIDVHNRKIESVEEVAEDLRKLLEYFKPEMVWVNPDCG----------
METE_SULIY      FKIYNYKPLELLKRFDKELGAGVIDVHNRRIETSEEVANDIRKILEYFTPEKLWINPDCGL------KLL
METE_SULIM      ----------------------------------------------------------------------
METE_SULIL      ----------------------------------------------------------------------
METE_SULIK      ----------------------------------------------------------------------
METE_SULIA      ----------------------------------------------------------------------
METE_SULIN      ----------------------------------------------------------------------
METE_BIFA0      ----------------------------------------------------------------------
METE_BIFAA      ----------------------------------------------------------------------
METE_PASMU      ----------------------------------------------------------------------
METE_THEP1      ----------------------------------------------------------------------
METE_BIFLO      ----------------------------------------------------------------------
METE_BIFLI      ----------------------------------------------------------------------
METE_BIFLD      ----------------------------------------------------------------------
METE_BURVG      ----------------------------------------------------------------------
METE_ACTPJ      ----------------------------------------------------------------------
METE_ACTP7      ----------------------------------------------------------------------
METE_XYLFT      ----------------------------------------------------------------------
METE_XYLFM      ----------------------------------------------------------------------
METE_XYLF2      ----------------------------------------------------------------------
METE_RHILO      ----------------------------------------------------------------------
METE_HAEIN      ----------------------------------------------------------------------
METE_HAEIG      ----------------------------------------------------------------------
METE_HAEIE      ----------------------------------------------------------------------
METE_ACTP2      ----------------------------------------------------------------------
METE_XYLFA      ----------------------------------------------------------------------
METE_NEIMF      ----------------------------------------------------------------------
METE_NEIMA      ----------------------------------------------------------------------
METE_NEIM0      ----------------------------------------------------------------------
METE_HAHCH      ----------------------------------------------------------------------
METE_ACIF5      ----------------------------------------------------------------------
METE_ACIF2      ----------------------------------------------------------------------
METE_PYRKO      EAANNFRDLDYLKKTHQELGFGVVDVHNPRVESPEEVAKAIRKVMEYIEPERLYINPDCG----------
METE_YEAST      ----------------------------------------------------------------------
METE_NEIMB      ----------------------------------------------------------------------
METE_NEIG1      ----------------------------------------------------------------------
METE_CORGL      ----------------------------------------------------------------------
METE_CORGB      ----------------------------------------------------------------------
METE_MESSB      ----------------------------------------------------------------------
METE_BURXL      ----------------------------------------------------------------------
METE_BURPP      ----------------------------------------------------------------------
METE_THESQ      ----------------------------------------------------------------------
METE_THEMA      ----------------------------------------------------------------------
METE_BACLD      SHGGFLDYLEQHPY-LKGLGLGVYDIHSPRVPSSDEMLTIIEDALKVCPADRFWVNPDCGLKTRQ-----
METE_RHOPT      ----------------------------------------------------------------------
METE_RHOPA      ----------------------------------------------------------------------
METE_MYCPA      ----------------------------------------------------------------------
METE_MYCA1      ----------------------------------------------------------------------
METE_METCA      ----------------------------------------------------------------------
METE_TRIEI      ----------------------------------------------------------------------
METE_RALSO      ----------------------------------------------------------------------
METE_RALPJ      ----------------------------------------------------------------------
METE_BACHD      ----------------------------------------------------------------------
METE_ACICJ      ----------------------------------------------------------------------
METE_NITWN      ----------------------------------------------------------------------
METE_LACLS      ----------------------------------------------------------------------
METE_CAUCR      ----------------------------------------------------------------------
METE_BURCM      ----------------------------------------------------------------------
METE_BURCC      ----------------------------------------------------------------------
METE_THIDA      ----------------------------------------------------------------------
METE_MYCTU      ----------------------------------------------------------------------
METE_MYCTA      ----------------------------------------------------------------------
METE_MYCBP      ----------------------------------------------------------------------
METE_MYCBO      ----------------------------------------------------------------------
METE_RALEU      ----------------------------------------------------------------------
METE_RALEH      ----------------------------------------------------------------------
METE_LACLM      ----------------------------------------------------------------------
METE_BACSU      SHGGFLDYLKNHPY-LKGLGLGVYDIHSPRVPSTEEMYNIIVDALAVCPTDRFWVNPDCGLKTRQQ----
METE_CYTH3      ----------------------------------------------------------------------
METE_CANAL      ----------------------------------------------------------------------
METE_BURCJ      ----------------------------------------------------------------------
METE_PARL1      ----------------------------------------------------------------------
METE_NITEU      ----------------------------------------------------------------------
METE_BURS3      ----------------------------------------------------------------------
METE_BURP8      ----------------------------------------------------------------------
METE_BRAJA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SEQEQWDKLRLAVEVAQDVWGR
YXJG_BACSU      TEEQQWAKLRHVVEIANDVW--
YXJH_BACSU      TEEQQWAKLRHVIDIANDVW--
METE_SULTO      ----------------------
METE_PYRAB      ----------------------
METE_PYRHO      ----------------------
METE_PYRFU      ----------------------
METE_SULSO      SRKIAYQKLVSMVE--------
METE_CHRVO      ----------------------
METE_SULAC      ----------------------
METE_SULIY      SRKIAYQKLVSMVE--------
METE_SULIM      ----------------------
METE_SULIL      ----------------------
METE_SULIK      ----------------------
METE_SULIA      ----------------------
METE_SULIN      ----------------------
METE_BIFA0      ----------------------
METE_BIFAA      ----------------------
METE_PASMU      ----------------------
METE_THEP1      ----------------------
METE_BIFLO      ----------------------
METE_BIFLI      ----------------------
METE_BIFLD      ----------------------
METE_BURVG      ----------------------
METE_ACTPJ      ----------------------
METE_ACTP7      ----------------------
METE_XYLFT      ----------------------
METE_XYLFM      ----------------------
METE_XYLF2      ----------------------
METE_RHILO      ----------------------
METE_HAEIN      ----------------------
METE_HAEIG      ----------------------
METE_HAEIE      ----------------------
METE_ACTP2      ----------------------
METE_XYLFA      ----------------------
METE_NEIMF      ----------------------
METE_NEIMA      ----------------------
METE_NEIM0      ----------------------
METE_HAHCH      ----------------------
METE_ACIF5      ----------------------
METE_ACIF2      ----------------------
METE_PYRKO      ----------------------
METE_YEAST      ----------------------
METE_NEIMB      ----------------------
METE_NEIG1      ----------------------
METE_CORGL      ----------------------
METE_CORGB      ----------------------
METE_MESSB      ----------------------
METE_BURXL      ----------------------
METE_BURPP      ----------------------
METE_THESQ      ----------------------
METE_THEMA      ----------------------
METE_BACLD      -PEETIAALKNMVEAAKQARGK
METE_RHOPT      ----------------------
METE_RHOPA      ----------------------
METE_MYCPA      ----------------------
METE_MYCA1      ----------------------
METE_METCA      ----------------------
METE_TRIEI      ----------------------
METE_RALSO      ----------------------
METE_RALPJ      ----------------------
METE_BACHD      ----------------------
METE_ACICJ      ----------------------
METE_NITWN      ----------------------
METE_LACLS      ----------------------
METE_CAUCR      ----------------------
METE_BURCM      ----------------------
METE_BURCC      ----------------------
METE_THIDA      ----------------------
METE_MYCTU      ----------------------
METE_MYCTA      ----------------------
METE_MYCBP      ----------------------
METE_MYCBO      ----------------------
METE_RALEU      ----------------------
METE_RALEH      ----------------------
METE_LACLM      ----------------------
METE_BACSU      ----------------------
METE_CYTH3      ----------------------
METE_CANAL      ----------------------
METE_BURCJ      ----------------------
METE_PARL1      ----------------------
METE_NITEU      ----------------------
METE_BURS3      ----------------------
METE_BURP8      ----------------------
METE_BRAJA      ----------------------