[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39200.1

[Show Plain Result]


## Summary of Sequence Search
    1::95
    1::81      5e-09  38%   82 aa  Y2523_STAHJ RecName: Full=UPF0213 protein SH2523;
    1::80      1e-08  38%   85 aa  Y776_NATPD RecName: Full=UPF0213 protein NP0776A;
   16::82      7e-08  37%   89 aa  Y3675_HALWD RecName: Full=UPF0213 protein HQ3675A;
    1::80      1e-07  32%  105 aa  Y972_PSEPK RecName: Full=UPF0213 protein PP_0972;
    4::77      3e-07  36%   93 aa  Y1444_CLOPE RecName: Full=UPF0213 protein CPE1444;
    3::81      8e-07  34%   82 aa  Y530_STAAC RecName: Full=UPF0213 protein SACOL0530;
    3::81      8e-07  34%   82 aa  Y489_STAAR RecName: Full=UPF0213 protein SAR0489;
    3::81      8e-07  34%   82 aa  Y488_STAAM RecName: Full=UPF0213 protein SAV0488;
    3::81      8e-07  34%   82 aa  Y485_STAA1 RecName: Full=UPF0213 protein SAHV_0485;
    3::81      8e-07  34%   82 aa  Y465_STAA3 RecName: Full=UPF0213 protein SAUSA300_0465;
    3::81      8e-07  34%   82 aa  Y458_STAA8 RecName: Full=UPF0213 protein SAOUHSC_00458;
    3::81      8e-07  34%   82 aa  Y446_STAAN RecName: Full=UPF0213 protein SA0446;
    3::81      8e-07  34%   82 aa  Y445_STAAS RecName: Full=UPF0213 protein SAS0445;
    3::81      8e-07  34%   82 aa  Y443_STAAW RecName: Full=UPF0213 protein MW0443;
    3::81      8e-07  34%   82 aa  Y437_STAAB RecName: Full=UPF0213 protein SAB0437;
   16::84      8e-07  33%   98 aa  Y019_BACP2 RecName: Full=UPF0213 protein BPUM_0019;
   14::81      1e-06  32%   82 aa  Y2295_STAES RecName: Full=UPF0213 protein SE_2295;
    1::81      1e-06  33%   82 aa  Y2268_STAS1 RecName: Full=UPF0213 protein SSP2268;
   14::81      1e-06  32%   82 aa  Y126_STAEQ RecName: Full=UPF0213 protein SERP0126;
    1::85      1e-06  39%   87 aa  Y1043_SYNAS RecName: Full=UPF0213 protein SYNAS_10430;
    7::76      2e-06  34%   99 aa  Y1535_STRPN RecName: Full=UPF0213 protein SP_1535;
    1::81      4e-06  32%   86 aa  Y043_OCEIH RecName: Full=UPF0213 protein OB0043;
    7::76      5e-06  33%   99 aa  Y1390_STRR6 RecName: Full=UPF0213 protein spr1390;
    7::76      5e-06  33%   99 aa  Y1364_STRP2 RecName: Full=UPF0213 protein SPD_1364;
   15::82      6e-06  32%   87 aa  Y709_STRSV RecName: Full=UPF0213 protein SSA_0709;
    3::85      6e-06  31%   90 aa  Y5558_RALEJ RecName: Full=UPF0213 protein Reut_B5558;
    5::95      8e-06  30%  101 aa  Y1228_XANOM RecName: Full=UPF0213 protein XOO1228;
    3::83      8e-06  31%   99 aa  Y044_BACA2 RecName: Full=UPF0213 protein RBAM_000440;
   24::91      1e-05  34%  110 aa  Y2720_DESPS RecName: Full=UPF0213 protein DP2720;
   16::83      1e-05  32%   88 aa  Y903_STRA1 RecName: Full=UPF0213 protein SAK_0903;
   16::83      1e-05  32%   88 aa  Y798_STRA3 RecName: Full=UPF0213 protein gbs0798;
   16::83      1e-05  32%   88 aa  Y778_STRA5 RecName: Full=UPF0213 protein SAG0778;
   19::83      2e-05  34%   99 aa  YAZA_BACSU RecName: Full=UPF0213 protein yazA;
   21::76      2e-05  39%   77 aa  Y2274_HALSA RecName: Full=UPF0213 protein VNG_2274C;
    3::83      3e-05  31%   97 aa  Y536_BACLD RecName: Full=UPF0213 protein BLi00048/BL00536;
    5::83      3e-05  30%  102 aa  Y3202_XANAC RecName: Full=UPF0213 protein XAC3202;
    5::80      3e-05  31%   88 aa  Y2693_ENTFA RecName: Full=UPF0213 protein EF_2693;
   11::79      5e-05  32%  104 aa  Y1257_PSEA7 RecName: Full=UPF0213 protein PSPA7_1257;
   17::82      7e-05  39%   92 aa  Y708_STRPG RecName: Full=UPF0213 protein SpyM50708;
    3::89      7e-05  28%   89 aa  Y1587_LACC3 RecName: Full=UPF0213 protein LSEI_1587;
   20::85      7e-05  37%   90 aa  Y147_LISW6 RecName: Full=UPF0213 protein lwe0147;
   17::82      7e-05  39%   92 aa  Y1420_STRP8 RecName: Full=UPF0213 protein spyM18_1420;
   17::82      7e-05  39%   92 aa  Y1412_STRP1 RecName: Full=UPF0213 protein SPy_1412/M5005_Spy1151;
   17::82      7e-05  39%   92 aa  Y1258_STRPF RecName: Full=UPF0213 protein MGAS10750_Spy1258;
   17::82      7e-05  39%   92 aa  Y1222_STRPD RecName: Full=UPF0213 protein MGAS10270_Spy1222;
   17::82      7e-05  39%   92 aa  Y1218_STRPB RecName: Full=UPF0213 protein MGAS2096_Spy1218;
   17::82      7e-05  39%   92 aa  Y1198_STRPC RecName: Full=UPF0213 protein MGAS9429_Spy1198;
   17::82      7e-05  39%   92 aa  Y1178_STRP6 RecName: Full=UPF0213 protein M6_Spy1178;
   17::82      7e-05  39%   92 aa  Y1146_STRPM RecName: Full=UPF0213 protein M28_Spy1146;
   17::82      7e-05  39%   92 aa  Y1077_STRP3 RecName: Full=UPF0213 protein SpyM3_1077/SPs0786;
   25::73      7e-05  50%  299 aa  SLX1_DROAN RecName: Full=Structure-specific endonuclease subunit
    5::83      9e-05  29%  102 aa  Y3072_XANCP RecName: Full=UPF0213 protein XCC3072;
   20::82      9e-05  35%   89 aa  Y181_LISMF RecName: Full=UPF0213 protein LMOf2365_0181;
   20::82      9e-05  35%   90 aa  Y166_LISMO RecName: Full=UPF0213 protein lmo0166;
    5::83      9e-05  29%  102 aa  Y1086_XANC8 RecName: Full=UPF0213 protein XC_1086;
   22::70      9e-05  48%  303 aa  SLX1_DROMO RecName: Full=Structure-specific endonuclease subunit
   20::75      1e-04  36%   90 aa  Y209_LISIN RecName: Full=UPF0213 protein lin0209;
   17::52      1e-04  44%  275 aa  SLX1_HUMAN RecName: Full=Structure-specific endonuclease subunit
   16::66      1e-04  48%  286 aa  SLX1_DROGR RecName: Full=Structure-specific endonuclease subunit
   20::91      2e-04  31%  110 aa  Y3309_DESVH RecName: Full=UPF0213 protein DVU_3309;
   24::72      2e-04  48%  298 aa  SLX1_DROSE RecName: Full=Structure-specific endonuclease subunit
   24::72      2e-04  48%  297 aa  SLX1_DROME RecName: Full=Structure-specific endonuclease subunit
   20::86      2e-04  30%   95 aa  Y875_PEDPA RecName: Full=UPF0213 protein PEPE_0875;
    5::85      2e-04  26%  106 aa  Y5222_VIBPA RecName: Full=UPF0213 protein VPA1222;
   11::79      2e-04  30%  104 aa  Y3854_PSEAE RecName: Full=UPF0213 protein PA3854;
   11::79      2e-04  30%  104 aa  Y1415_PSEAB RecName: Full=UPF0213 protein PA14_14150;
    4::53      4e-04  41%  104 aa  YSIG_LACLA RecName: Full=UPF0213 protein ysiG;
   16::83      4e-04  28%   96 aa  Y032_BACAN RecName: Full=UPF0213 protein
   16::83      4e-04  28%   96 aa  Y031_BACHK RecName: Full=UPF0213 protein BT9727_0031;
   16::83      4e-04  28%   96 aa  Y031_BACCZ RecName: Full=UPF0213 protein BCE33L0031;
   17::65      4e-04  48%  291 aa  SLX1_DROPS RecName: Full=Structure-specific endonuclease subunit
   17::65      4e-04  48%  291 aa  SLX1_DROPE RecName: Full=Structure-specific endonuclease subunit
   16::86      6e-04  28%   96 aa  Y033_BACC1 RecName: Full=UPF0213 protein BCE_0033;
   25::69      6e-04  48%  294 aa  SLX1_DROER RecName: Full=Structure-specific endonuclease subunit
   20::87      8e-04  29%   98 aa  Y98_PEDAC RecName: Full=UPF0213 protein in ldhD 5'region;AltName:
    4::74      8e-04  30%   91 aa  Y1266_LACSS RecName: Full=UPF0213 protein LSA1266;
    6::39      8e-04  50%  104 aa  Y079_NPVOP RecName: Full=UPF0213 protein ORF82;
    5::78      8e-04  34%   94 aa  Y048_BACHD RecName: Full=UPF0213 protein BH0048;
  173::217     8e-04  48%  443 aa  SLX1_CAEEL RecName: Full=Structure-specific endonuclease subunit
  168::212     8e-04  48%  439 aa  SLX1_CAEBR RecName: Full=Structure-specific endonuclease subunit
   10::45      8e-04  42%  267 aa  SLX1_BOVIN RecName: Full=Structure-specific endonuclease subunit
    1::95

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSRSYDVYILASRYRGTLYVGVTNDLPRRIAEHKAGAADGFTKKYNIKILVHVEEYSSILEARTREHVLK
Y2523_STAHJ     MAKHY-VYIVKCK-DNSLYTGYTTNVEARIATHNAGKGAKYTKTRRPVVLVYQEMFSSKSEAMRREYEIK
Y776_NATPD      MAADHYVYVLSCADE-TLYTGYTTNVERRVAEHDAGEGAKYTRGRTPVELVHTERFDSKSAAMQREHEIK
Y3675_HALWD     ----------------SLYTGYTTDVERRVREHNAGEGAKYTRGRTPVQLVHFECFDTRSAALSREHEIK
Y972_PSEPK      MGKPWFVYLVRAA-NGSLYCGISDDPQRRFAAHQKGQGARYFKTSPAQALVYVEQWPDKSAALRQERLVK
Y1444_CLOPE     ------VYILKCKDE-SLYTGWTNNLEKRIKAHNNGCGAKYTRGRGPVKLVYFEFFENKREAQSREYYIK
Y530_STAAC      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y489_STAAR      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y488_STAAM      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y485_STAA1      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y465_STAA3      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y458_STAA8      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y446_STAAN      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y445_STAAS      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y443_STAAW      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y437_STAAB      ---SHFVYIVKCS-DGSLYTGYAKDVNARVEKHNRGQGAKYTKVRRPVHLVYQEMYETKSEALKREYEIK
Y019_BACP2      ---------------GSLYAGYTNDLQKRLMTHNSGKGAKYTRARRPVELYYHECFATKREAMQQEYRFK
Y2295_STAES     ---------------GSLYTGYAKDVNARVIKHNNGKGAKYTKIRRPVELVYQETYTTKSEALKREYEIK
Y2268_STAS1     MDKHY-IYIVKCK-DGSLYTGYAKDIEKRIIKHNNGQGAKYTKIRRPVQLVYQEMFDTKSEALKREYEIK
Y126_STAEQ      ---------------GSLYTGYAKDVNARVIKHNNGKGAKYTKIRRPVELVYQETYTTKSEALKREYEIK
Y1043_SYNAS     MSKNY-VYILECSDK-TLYTGWTVNIEKRLQEHNSGKYGAYTKSRRPVKLVHLEMVDSLSGVLKREAQIK
Y1535_STRPN     ------MYVLECR-DGSYYIGYTTDMRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALLK
Y043_OCEIH      MDEQHYVYILRCRDQ-SLYTGYTNNLEHRLQMHETGKGAKYTRGRGPFEVLYVKKFINKSEAMQEEYRIK
Y1390_STRR6     ------MYVLECR-DGSYYIGYTTDMRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALFK
Y1364_STRP2     ------MYVLECR-DGSYYIGYTTDMRRRLAIHNSGKGAKYTRARLPVKLIYAQGFASKEEAMSAEALFK
Y709_STRSV      ---------------GSLYTGYTTDVQARLKKHQAGKGAKYTRARLPVTLLYQEEHPSKPAAMSAEALFK
Y5558_RALEJ     VERQWYLYLLECT-GGSIYTGITTDVARRFAQHQAGKGAKYTRSRKPLRVLGQVAFPSKSEALKAELATK
Y1228_XANOM     --KPWHLYLLLCR-NGSYYAGITNDLERRFQAHLHGTGARYTRANPPVQVLASHRYPDRASASRAECALK
Y044_BACA2      -TNSHFFYVLLCN-DNSLYAGYTNDLQKRLKTHNEGKGAKYTRARRPVSLCHAESFETKREAMQAEYRFK
Y2720_DESPS     ---------------GTLYTGITTNIARRITEHNSSAKGAYTRSRRPVMLVYRETCRDRSEASKREYAIK
Y903_STRA1      ---------------GTLYTGYTTDVKRRLNTHNTGKGAKYTRARLPVKLLYSEAFNSKQEAMRAEALFK
Y798_STRA3      ---------------GTLYTGYTTDVKRRLNTHNTGKGAKYTRARLPVKLLYSEAFNSKQEAMRAEALFK
Y778_STRA5      ---------------GTLYTGYTTDVKRRLNTHNTGKGAKYTRARLPVKLLYSEAFNSKQEAMRAEALFK
YAZA_BACSU      ------------------YAGYTNDLHKRVKTHNDGKGAKYTKVRRPVELIFAESFSTKREAMQAEYYFK
Y2274_HALSA     ------------------------DVQRRVAEHNAGDGAKYTRGRTPVTLRHTESFDSKSEAMRREYRIK
Y536_BACLD      -TNSHYFYVLSCR-DGSLYAGYTNNIEKRLKTHNDGKGAKYTRARLPVKLHYAECFSTKREAMQAEYYFK
Y3202_XANAC     --KPWHLYLLLCR-NGSYYAGITNDLERRFQAHLRGTGARYTRANPPVQMLASHPYPDRASASRAECALK
Y2693_ENTFA     --KSHYFYVLLCQ-DGSFYGGYTTEPERRLTEHNSGTGAKYTRKRRPVIMIHTEKFETRSEATKAEAAFK
Y1257_PSEA7     LGKSWSVYLVRAA-NGALYCGISDDPLRRFDTHCSGKGARFFHSSPARALVYVEACASKGDALRRERAIK
Y708_STRPG      ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1587_LACC3     -TKTYYFYVLLCA-DGSFYGGFTDDVKARVATHNAGKGAKYTQRLPVRLLYH-QAFADKHDALSAEWHFK
Y147_LISW6      ------------------YGGYTTDVTRREAEHNAGIRCKYTKTRRPVKVIHFEKFETRSEATKAEAAFK
Y1420_STRP8     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1412_STRP1     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1258_STRPF     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1222_STRPD     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1218_STRPB     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1198_STRPC     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1178_STRP6     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1146_STRPM     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
Y1077_STRP3     ----------------TLYTGYTTDLKKRLATHNAGKGAKYT-RYRLPVLLYYEVFDSKEAAMSAEALFK
SLX1_DROAN      ----YGVYLLCSRYRGKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSRK----------------------
Y3072_XANCP     --KPWHLYLLLCR-NGSYYAGITNDLERRFQAHLRGTGARYTRANPPLQVLASHPYPDRATASRAEWLLK
Y181_LISMF      ------------------YGGYTTDVIRREAEHNAGIRCKYTKTRRPVKVIHFEKFETRSEATKAEAAFK
Y166_LISMO      ------------------YGGYTTDVLRREAEHNAGIRCKYTKTRRPVKVIHFEKFETRSEATKAEAAFK
Y1086_XANC8     --KPWHLYLLLCR-NGSYYAGITNDLERRFQAHLRGTGARYTRANPPLQVLASHPYPDRATASRAEWLLK
SLX1_DROMO      ----YGVYLLCSRHRGKCYVGFTVNPKRRIRQHNRGSSFGGAKKTSKK----------------------
Y209_LISIN      ------------------YGGYTTDVMRREAEHNAGIRCKYTKTRRPVKVIHFEKFETRSEATKAEAAFK
SLX1_HUMAN      ----YLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKG------------------------------
SLX1_DROGR      --RFYGVYLLCSRYRGKCYVGFTVNPKRRIGQHNRGCDFGGAHKTSRK----------------------
Y3309_DESVH     ---------------GTLYCGVTNNIERRLTQHHXXXXXXXXXXXXPFILLGHAPFPGRGEAQRVEYRIK
SLX1_DROSE      ----YGVYLLCSRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRK----------------------
SLX1_DROME      ----YGVYLLCSRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRK----------------------
Y875_PEDPA      ----------------TLYGGYTINLINRVERHNKGQGAKYTKARRPVQLIYFESFDNQHDAMSAEYQFK
Y5222_VIBPA     VEQHWSVYLIRNN-RNALYCGVTNDIERRFKQHQXXXXXXXXXXXXPLVLEWSTSFDSKVTAMRAEYFIK
Y3854_PSEAE     IGKCWSVYLVRAE-NGALYCGISDDPLRRFDTHCSGKGARFFHSSPARALVYVEACASKGDALRRERAIK
Y1415_PSEAB     IGKCWSVYLVRAE-NGALYCGISDDPLRRFDTHCSGKGARFFHSSPARALVYVEACASKGDALRRERAIK
YSIG_LACLA      ----YFTYILQCSDK-TLYCGYTTDLEKRLATHNSGKGAKYTKRLPVKLLASVD----------------
Y032_BACAN      ---------------GSYYAGYTNHIEKRIGTHNSGRGAKYTRARLPVVLKYVEFHEDKRTAMQAEYYFK
Y031_BACHK      ---------------GSYYAGYTNHIEKRIGTHNSGRGAKYTRARLPVVLKYVEFHEDKRTAMQAEYYFK
Y031_BACCZ      ---------------GSYYAGYTNHIEKRIGTHNSGRGAKYTRARLPVVLKYVEFHEDKRTAMQAEYYFK
SLX1_DROPS      ----YGVYLLCSRYRAKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSKK----------------------
SLX1_DROPE      ----YGVYLLCSRYRAKCYVGFTVNPKRRIKQHNRGCDFGGAKKTSKK----------------------
Y033_BACC1      ---------------GSYYAGYTNHIEKRIETHNSGKGAKYTRARLPVALKYVEFHEDKRTAMQAEYYFK
SLX1_DROER      ----YGVYLLCSRFRGKCYVGFTVNPKRRIRQHNLGCDFGGARK--------------------------
Y98_PEDAC       ----------------TLYTGYTVNLKQRVARHNSGQGAKYTRKRRPVQLLYYESFENQHDAMSAEYFFK
Y1266_LACSS     --KAYYFYVLVCADR-SFYGGFTTDVTKRAATHNAGKGAKYTKLRRPVRLLYYETFADKSSALKAEYAFK
Y079_NPVOP      -SKVWCVYIVR-RDDGQLYTGITSDLSRRLGEHARG----------------------------------
Y048_BACHD      ------VYILECK-DGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVK
SLX1_CAEEL      ----YGVYCLISRYKNRCYIGYTVDPNRRIMQHNGGRDKGGAKK--------------------------
SLX1_CAEBR      ----YGVYCLISRYKNRCYIGYTVDPNRRIMQHNGGRFKGGAKK--------------------------
SLX1_BOVIN      ----YLLYCLNPRHRGRVYVGFTVNPARRVQQHNGGRKKG------------------------------


                         .         .         *         .         .         .         .:140
query           RWRRDWKIALIEKLNPDWRDLSNDx
Y2523_STAHJ     TFSRQQKLKMIEE------------
Y776_NATPD      SLSRAKKERLV--------------
Y3675_HALWD     SYTREKKQQLAEE------------
Y972_PSEPK      RLRKSAKEALV--------------
Y1444_CLOPE     KLTRNQKLQLI--------------
Y530_STAAC      TYTRQKKLRLIKE------------
Y489_STAAR      TYTRQKKLRLIKE------------
Y488_STAAM      TYTRQKKLRLIKE------------
Y485_STAA1      TYTRQKKLRLIKE------------
Y465_STAA3      TYTRQKKLRLIKE------------
Y458_STAA8      TYTRQKKLRLIKE------------
Y446_STAAN      TYTRQKKLRLIKE------------
Y445_STAAS      TYTRQKKLRLIKE------------
Y443_STAAW      TYTRQKKLRLIKE------------
Y437_STAAB      TYTRQKKLRLIKE------------
Y019_BACP2      TWTRKKKDLYIEEM-----------
Y2295_STAES     TYTRQQKLKMIQE------------
Y2268_STAS1     TFSRQKKLKLISE------------
Y126_STAEQ      TYTRQQKLKMIQE------------
Y1043_SYNAS     KMSRAEKLQLI-KQNPE--------
Y1535_STRPN     RKKRPQK------------------
Y043_OCEIH      QLPRFEKLKLIE-------------
Y1390_STRR6     RKKRPQK------------------
Y1364_STRP2     RKKRPQK------------------
Y709_STRSV      KKTRQAKLAYIKE------------
Y5558_RALEJ     RMSSAQKIAFCAKL-----------
Y1228_XANOM     RQPRARKLAWLQAQSSDTESHSAD-
Y044_BACA2      QLTRKKKEQYIEE------------
Y2720_DESPS     QLSPTRKRTLVK-------------
Y903_STRA1      QKTRQAKLTYIKQ------------
Y798_STRA3      QKTRQAKLTYIKQ------------
Y778_STRA5      QKTRQAKLTYIKQ------------
YAZA_BACSU      KLTRKKKELYIEE------------
Y2274_HALSA     QLSRAQKEAL---------------
Y536_BACLD      KLSRKNKERYIEE------------
Y3202_XANAC     RLPRARKLAWLQ-------------
Y2693_ENTFA     KLTRKQK------------------
Y1257_PSEA7     -------------------------
Y708_STRPG      RKTRSQKLAYI--------------
Y1587_LACC3     HQTRHRKEVFLEDHQVEWR------
Y147_LISW6      KLSRKNKDSLIER------------
Y1420_STRP8     RKTRSQKLAYI--------------
Y1412_STRP1     RKTRSQKLAYI--------------
Y1258_STRPF     RKTRSQKLAYI--------------
Y1222_STRPD     RKTRSQKLAYI--------------
Y1218_STRPB     RKTRSQKLAYI--------------
Y1198_STRPC     RKTRSQKLAYI--------------
Y1178_STRP6     RKTRSQKLAYI--------------
Y1146_STRPM     RKTRSQKLAYI--------------
Y1077_STRP3     RKTRSQKLAYI--------------
SLX1_DROAN      -------------------------
Y3072_XANCP     QQPRARKLAWLQ-------------
Y181_LISMF      KLSRKNKDAYL--------------
Y166_LISMO      KLSRKNKDAYL--------------
Y1086_XANC8     QQPRARKLAWLQ-------------
SLX1_DROMO      -------------------------
Y209_LISIN      KLSR---------------------
SLX1_HUMAN      -------------------------
SLX1_DROGR      -------------------------
Y3309_DESVH     RQPTDQKLACLATIGGD--------
SLX1_DROSE      -------------------------
SLX1_DROME      -------------------------
Y875_PEDPA      QRTRSSKIKFLKK------------
Y5222_VIBPA     QLTKSKKEQLVE-------------
Y3854_PSEAE     -------------------------
Y1415_PSEAB     -------------------------
YSIG_LACLA      -------------------------
Y032_BACAN      QLNRKQKEEYMQK------------
Y031_BACHK      QLNRKQKEEYMQK------------
Y031_BACCZ      QLNRKQKEEYMQK------------
SLX1_DROPS      -------------------------
SLX1_DROPE      -------------------------
Y033_BACC1      QLNRKQKEEYMQKGEP---------
SLX1_DROER      -------------------------
Y98_PEDAC       KQSRKEKLKYLK-------------
Y1266_LACSS     HQSR---------------------
Y079_NPVOP      -------------------------
Y048_BACHD      HLSRRKKEQLV--------------
SLX1_CAEEL      -------------------------
SLX1_CAEBR      -------------------------
SLX1_BOVIN      -------------------------