[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39246.1

[Show Plain Result]


## Summary of Sequence Search
    1::526
   49::511     e-121  54%  513 aa  DEGP_BRUME RecName: Full=Probable serine protease do-like;       
   52::511     e-120  54%  513 aa  DEGP_BRUSU RecName: Full=Probable serine protease do-like;       
   52::511     e-120  54%  513 aa  DEGP_BRUAB RecName: Full=Probable serine protease do-like;       
   52::511     e-120  54%  513 aa  DEGP_BRUA2 RecName: Full=Probable serine protease do-like;       
  127::502     e-109  53%  504 aa  DEGP_RHIME RecName: Full=Probable serine protease do-like;       
   32::503     1e-94  44%  503 aa  DEGP_BARHE RecName: Full=Probable periplasmic serine protease
   24::465     2e-71  37%  466 aa  HTOA_HAEIN RecName: Full=Probable periplasmic serine protease
   37::472     5e-69  44%  475 aa  DEGP_SALTY RecName: Full=Protease do;         EC=3.4.21.-;Flags:
   36::471     4e-67  41%  474 aa  DEGP_ECOLI RecName: Full=Protease do;         EC=3.4.21.-;Flags:
   36::471     4e-67  41%  474 aa  DEGP_ECO57 RecName: Full=Protease do;         EC=3.4.21.-;Flags:
   47::507     8e-66  37%  508 aa  DEGP_RICCN RecName: Full=Probable serine protease do-like;       
  130::493     2e-65  40%  497 aa  DEGP_CHLMU RecName: Full=Probable serine protease do-like;       
   50::484     3e-64  35%  488 aa  DEGP_CHLPN RecName: Full=Probable serine protease do-like;       
   56::493     1e-62  35%  497 aa  DEGP_CHLTR RecName: Full=Probable serine protease do-like;       
   27::457     1e-60  35%  478 aa  DEGP_BUCAI RecName: Full=Probable serine protease do-like;       
   36::443     8e-58  35%  478 aa  DEGP_BUCAP RecName: Full=Probable serine protease do-like;       
  126::513     2e-56  34%  513 aa  DEGP_RICPR RecName: Full=Probable serine protease do-like;       
   47::444     8e-50  32%  465 aa  DEGP_BUCBP RecName: Full=Probable serine protease do-like;       
  128::403     1e-49  42%  406 aa  Y938_SYNP6 RecName: Full=Uncharacterized serine protease syc0938_d;
  160::438     9e-49  43%  439 aa  DEGP1_ARATH RecName: Full=Protease Do-like 1, chloroplastic;       
   31::432     2e-48  34%  455 aa  DEGQ_ECOLI RecName: Full=Protease degQ;         EC=3.4.21.-;Flags:
  143::410     6e-43  42%  413 aa  HTRA_LACHE RecName: Full=Serine protease do-like htrA;       
   81::338     4e-42  35%  340 aa  DEGS_HAEIN RecName: Full=Protease degS;         EC=3.4.21.-;Flags:
  177::449     1e-41  40%  458 aa  YVTA_BACSU RecName: Full=Uncharacterized serine protease yvtA;     
   89::352     1e-41  36%  355 aa  DEGS_ECOLI RecName: Full=Protease degS;         EC=3.4.21.-;Flags:
   89::352     1e-41  36%  355 aa  DEGS_ECO57 RecName: Full=Protease degS;         EC=3.4.21.-;Flags:
  178::426     1e-38  39%  453 aa  HTRA3_HUMAN RecName: Full=Probable serine protease HTRA3;       
  184::422     2e-38  42%  459 aa  DGP14_ARATH RecName: Full=Putative protease Do-like 14;       
  164::443     9e-38  37%  448 aa  DEGP8_ARATH RecName: Full=Protease Do-like 8, chloroplastic;       
  146::452     2e-37  38%  480 aa  HTRA1_HUMAN RecName: Full=Serine protease HTRA1;       
  207::479     8e-37  37%  480 aa  HTRA1_MOUSE RecName: Full=Serine protease HTRA1;       
  184::432     2e-36  38%  459 aa  HTRA3_MOUSE RecName: Full=Probable serine protease HTRA3;       
  205::475     6e-35  36%  476 aa  HTRA4_HUMAN RecName: Full=Probable serine protease HTRA4;       
  123::392     4e-34  36%  400 aa  YYXA_BACSU RecName: Full=Uncharacterized serine protease yyxA;     
  173::443     4e-34  35%  449 aa  HTRA_BACSU RecName: Full=Probable serine protease do-like htrA;    
  119::383     1e-30  35%  408 aa  HTRA_LACLA RecName: Full=Serine protease do-like htrA;       
  185::431     5e-30  36%  458 aa  HTRA2_BOVIN RecName: Full=Serine protease HTRA2, mitochondrial;    
  185::431     7e-30  36%  458 aa  HTRA2_HUMAN RecName: Full=Serine protease HTRA2, mitochondrial;    
  185::431     3e-29  35%  458 aa  HTRA2_MOUSE RecName: Full=Serine protease HTRA2, mitochondrial;    
  149::396     3e-28  36%  427 aa  HTRA2_DROPS RecName: Full=Serine protease HTRA2, mitochondrial;    
  156::408     5e-28  33%  434 aa  HTRA2_DROWI RecName: Full=Serine protease HTRA2, mitochondrial;    
  149::396     5e-28  36%  427 aa  HTRA2_DROPE RecName: Full=Serine protease HTRA2, mitochondrial;    
  144::417     2e-27  31%  422 aa  HTRA2_DROYA RecName: Full=Serine protease HTRA2, mitochondrial;    
  148::395     2e-27  35%  426 aa  HTRA2_DROGR RecName: Full=Serine protease HTRA2, mitochondrial;    
  144::417     2e-27  31%  422 aa  HTRA2_DROER RecName: Full=Serine protease HTRA2, mitochondrial;    
  144::417     3e-27  31%  422 aa  HTRA2_DROSI RecName: Full=Serine protease HTRA2, mitochondrial;    
  144::417     3e-27  31%  422 aa  HTRA2_DROSE RecName: Full=Serine protease HTRA2, mitochondrial;    
  144::417     3e-27  31%  422 aa  HTRA2_DROME RecName: Full=Serine protease HTRA2, mitochondrial;    
  152::399     6e-27  35%  430 aa  HTRA2_DROMO RecName: Full=Serine protease HTRA2, mitochondrial;    
  143::390     7e-27  35%  421 aa  HTRA2_DROVI RecName: Full=Serine protease HTRA2, mitochondrial;    
  325::596     4e-26  31%  597 aa  HTRAL_STAS1 RecName: Full=Serine protease htrA-like;       
  368::638     1e-25  31%  639 aa  HTRAL_STAHJ RecName: Full=Serine protease htrA-like;       
  148::421     1e-25  31%  426 aa  HTRA2_DROAN RecName: Full=Serine protease HTRA2, mitochondrial;    
  314::584     7e-25  31%  585 aa  HTRAL_STAES RecName: Full=Serine protease htrA-like;       
  314::584     7e-25  31%  585 aa  HTRAL_STAEQ RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAAW RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAAS RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAAN RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAAM RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAAC RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  32%  769 aa  HTRAL_STAA8 RecName: Full=Serine protease htrA-like;       
  498::768     2e-24  31%  769 aa  HTRAL_STAA3 RecName: Full=Serine protease htrA-like;       
  498::768     3e-24  31%  769 aa  HTRAL_STAAR RecName: Full=Serine protease htrA-like;       
  498::768     1e-23  31%  769 aa  HTRAL_STAAB RecName: Full=Serine protease htrA-like;       
  140::320     2e-23  42%  323 aa  DEGP5_ARATH RecName: Full=Protease Do-like 5, chloroplastic;       
  147::422     1e-19  34%  607 aa  DEGP2_ARATH RecName: Full=Protease Do-like 2, chloroplastic;       
  432::564     1e-17  42%  630 aa  Y4BJ_RHISN RecName: Full=Uncharacterized protein y4bJ;
  126::403     2e-14  33%  559 aa  DEGP3_ARATH RecName: Full=Putative protease Do-like 3,
  165::387     3e-11  30%  592 aa  DEGP9_ARATH RecName: Full=Protease Do-like 9;         EC=3.4.21.-;
  144::420     4e-11  28%  586 aa  DGP10_ARATH RecName: Full=Protease Do-like 10, mitochondrial;      
  107::386     1e-09  29%  991 aa  NM111_PICGU RecName: Full=Pro-apoptotic serine protease NMA111;    
   96::372     1e-09  27%  979 aa  NM111_CANGA RecName: Full=Pro-apoptotic serine protease NMA111;    
   71::352     1e-09  29%  486 aa  DGP13_ARATH RecName: Full=Putative protease Do-like 13;       
  140::348     4e-09  33%  984 aa  NM111_YARLI RecName: Full=Pro-apoptotic serine protease NMA111;    
   28::200     2e-08  33%  523 aa  NHRF3_RAT RecName: Full=Na(+)/H(+) exchange regulatory cofactor
   28::206     3e-08  27%  518 aa  NHRF3_RABIT RecName: Full=Na(+)/H(+) exchange regulatory cofactor
  106::389     4e-08  30% 1038 aa  NM111_ASPTN RecName: Full=Pro-apoptotic serine protease nma111;    
  105::388     4e-08  29% 1027 aa  NM111_ASPOR RecName: Full=Pro-apoptotic serine protease nma111;    
   28::199     1e-07  32%  520 aa  NHRF3_BOVIN RecName: Full=Na(+)/H(+) exchange regulatory cofactor
  109::392     1e-07  29% 1028 aa  NM111_AJECN RecName: Full=Pro-apoptotic serine protease NMA111;    
   28::228     2e-07  27%  519 aa  NHRF3_HUMAN RecName: Full=Na(+)/H(+) exchange regulatory cofactor
  106::389     3e-07  29% 1028 aa  NM111_ASPNC RecName: Full=Pro-apoptotic serine protease nma111;    
   94::336     4e-07  32%  979 aa  NM111_LODEL RecName: Full=Pro-apoptotic serine protease NMA111;    
   28::200     4e-07  31%  519 aa  NHRF3_MOUSE RecName: Full=Na(+)/H(+) exchange regulatory cofactor
  106::389     6e-07  28% 1028 aa  NM111_NEOFI RecName: Full=Pro-apoptotic serine protease nma111;    
  208::276     8e-07  39%  418 aa  RASP_BACSK RecName: Full=Zinc metalloprotease rasP;       
   35::202     8e-07  26%  402 aa  PDZ1P_HUMAN RecName: Full=Putative PDZ domain-containing protein
  144::219     1e-06  34%  496 aa  CTPAL_STAHJ RecName: Full=Probable ctpA-like serine protease;      
  343::548     1e-06  36%  571 aa  NHRF4_HUMAN RecName: Full=Na(+)/H(+) exchange regulatory cofactor
   28::188     1e-06  29%  519 aa  NHRF3_PONAB RecName: Full=Na(+)/H(+) exchange regulatory cofactor
  106::389     2e-06  28% 1028 aa  NM111_ASPCL RecName: Full=Pro-apoptotic serine protease nma111;    
  106::389     2e-06  28% 1028 aa  NM111_ASPFU RecName: Full=Pro-apoptotic serine protease nma111;    
   94::370     2e-06  27%  976 aa  NM111_ASHGO RecName: Full=Pro-apoptotic serine protease NMA111;    
  104::269     2e-06  31%  518 aa  DEGP4_ARATH RecName: Full=Protease Do-like 4, mitochondrial;       
  112::395     3e-06  26% 1017 aa  NM111_PHANO RecName: Full=Pro-apoptotic serine protease NMA111;    
  202::303     5e-06  31%  421 aa  RASP_GEOKA RecName: Full=Zinc metalloprotease rasP;       
  138::403     7e-06  27%  565 aa  DGP11_ARATH RecName: Full=Putative protease Do-like 11,
  140::212     1e-05  36%  367 aa  Y638_RHILO RecName: Full=Putative zinc metalloprotease mll0638;    
  110::386     1e-05  25%  985 aa  NM111_KLULA RecName: Full=Pro-apoptotic serine protease NMA111;    
  207::289     3e-05  34%  450 aa  Y3649_PSEAE RecName: Full=Putative zinc metalloprotease PA3649;    
  148::226     3e-05  34%  377 aa  Y1380_AGRT5 RecName: Full=Putative zinc metalloprotease Atu1380;   
  217::279     5e-05  35%  428 aa  Y2128_LACLA RecName: Full=Putative zinc metalloprotease LL2128;    
  120::396     5e-05  29% 1034 aa  NM111_COCIM RecName: Full=Pro-apoptotic serine protease NMA111;    
  105::293     6e-05  30%  910 aa  USH1C_MOUSE RecName: Full=Harmonin;AltName: Full=Usher syndrome
  189::288     6e-05  33%  450 aa  RSEP_SALTY RecName: Full=Regulator of sigma E protease;       
  189::288     6e-05  33%  450 aa  RSEP_SALTI RecName: Full=Regulator of sigma E protease;       
 1012::1069    1e-04  36% 1630 aa  SCRIB_HUMAN RecName: Full=Protein scribble homolog;       
  144::210     1e-04  37%  496 aa  CTPAL_STAAW RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAS RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAR RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAN RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAM RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAC RecName: Full=Probable ctpA-like serine protease;      
  144::210     1e-04  37%  496 aa  CTPAL_STAAB RecName: Full=Probable ctpA-like serine protease;      
  152::207     1e-04  38%  379 aa  Y829_BRUME RecName: Full=Putative zinc metalloprotease BMEI0829;   
  152::207     1e-04  38%  379 aa  Y1156_BRUSU RecName: Full=Putative zinc metalloprotease BR1156;    
  194::266     2e-04  30%  420 aa  Y1355_LISIN RecName: Full=Putative zinc metalloprotease Lin1355;   
  139::209     3e-04  32%  491 aa  CTPAL_STAS1 RecName: Full=Probable ctpA-like serine protease;      
  208::258     4e-04  40%  419 aa  Y1689_STRP3 RecName: Full=Putative zinc metalloprotease
  203::298     4e-04  32%  450 aa  RSEP_ECOLI RecName: Full=Regulator of sigma E protease;       
  203::298     4e-04  32%  450 aa  RSEP_ECO57 RecName: Full=Regulator of sigma E protease;       
  555::585     4e-04  55% 1601 aa  RPGF6_HUMAN RecName: Full=Rap guanine nucleotide exchange factor
  314::480     4e-04  35%  548 aa  ILVD_METTP RecName: Full=Dihydroxy-acid dehydratase;       
  157::188     5e-04  53%  404 aa  Y2869_MYCTU RecName: Full=Putative zinc metalloprotease
  126::156     5e-04  55%  446 aa  Y183_NEIMB RecName: Full=Putative zinc metalloprotease NMB0183;    
  194::266     5e-04  29%  420 aa  Y1318_LISMO RecName: Full=Putative zinc metalloprotease Lmo1318;   
  126::156     5e-04  55%  446 aa  Y084_NEIMA RecName: Full=Putative zinc metalloprotease NMA0084;    
  164::290     5e-04  31%  533 aa  F_BPPHM RecName: Full=Capsid protein VP1;         Short=VP1;
  125::194     7e-04  30%  501 aa  Y890_THEMA RecName: Full=Putative zinc metalloprotease TM_0890;    
  208::258     7e-04  40%  419 aa  Y2031_STRP8 RecName: Full=Putative zinc metalloprotease
  208::258     7e-04  40%  419 aa  Y1963_STRP1 RecName: Full=Putative zinc metalloprotease
  208::258     7e-04  40%  419 aa  Y1682_STRP6 RecName: Full=Putative zinc metalloprotease M6_Spy1682;
  998::1055    7e-04  34% 1612 aa  SCRIB_MOUSE RecName: Full=Protein scribble homolog;       
 1245::1327    9e-04  30% 1851 aa  LAP4_DROME RecName: Full=Protein lap4;AltName: Full=Protein
  213::270     9e-04  31%  422 aa  EEP_ENTFA RecName: Full=Probable protease eep;         EC=3.4.24.-;
  335::435     5e-05  31%  439 aa  DEGP1_ARATH RecName: Full=Protease Do-like 1, chloroplastic;       (query 434->525)
  258::321     2e-06  34%  340 aa  DEGS_HAEIN RecName: Full=Protease degS;         EC=3.4.21.-;Flags:(query 444->507)
  381::436     9e-04  35%  458 aa  YVTA_BACSU RecName: Full=Uncharacterized serine protease yvtA;     (query 453->507)
  385::447     4e-04  29%  453 aa  HTRA3_HUMAN RecName: Full=Probable serine protease HTRA3;       (query 453->520)
  369::453     2e-05  29%  459 aa  HTRA3_MOUSE RecName: Full=Probable serine protease HTRA3;       (query 431->520)
  324::394     9e-04  34%  400 aa  YYXA_BACSU RecName: Full=Uncharacterized serine protease yyxA;     (query 452->524)
    1::526

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVDLFSTPAHAQVGNKVNQAQ
DEGP_BRUME      ----------------------------------------------------------------------
DEGP_BRUSU      ----------------------------------------------------------------------
DEGP_BRUAB      ----------------------------------------------------------------------
DEGP_BRUA2      ----------------------------------------------------------------------
DEGP_RHIME      ----------------------------------------------------------------------
DEGP_BARHE      ----------------------------------------------------LWTTKAHAN--SVFSSLM
HTOA_HAEIN      ---------------------------------------------------------AHVAQATLPSFVS
DEGP_SALTY      ---------------------------------------------------------------------Q
DEGP_ECOLI      ---------------------------------------------------------------------Q
DEGP_ECO57      ---------------------------------------------------------------------Q
DEGP_RICCN      ----------------------------------------------------------------KVSEAA
DEGP_CHLMU      ----------------------------------------------------------------------
DEGP_CHLPN      ----------------------------------------------------------------------
DEGP_CHLTR      ----------------------------------------------------------------------
DEGP_BUCAI      ---------------------------------------------------NVFSNTKNSIVSREISPSL
DEGP_BUCAP      -----------------------------------------------------------------VSSVQ
DEGP_RICPR      ----------------------------------------------------------------------
DEGP_BUCBP      ----------------------------------------------------------------------
Y938_SYNP6      ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGQ_ECOLI      --------------------------------------------------------------GQVADQAP
HTRA_LACHE      ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
DEGS_ECOLI      ----------------------------------------------------------------------
DEGS_ECO57      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
DGP14_ARATH     ----------------------------------------------------------------------
DEGP8_ARATH     ----------------------------------------------------------------------
HTRA1_HUMAN     -------------------------------------------------PVIVLQRGACGQGQEDPNSLR
HTRA1_MOUSE     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
HTRA4_HUMAN     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------
HTRA_BACSU      ----------------------------------------------------------------------
HTRA_LACLA      ----------------------------------------------------------------------
HTRA2_BOVIN     ----------------------------------------------------------------------
HTRA2_HUMAN     ----------------------------------------------------------------------
HTRA2_MOUSE     ----------------------------------------------------------------------
HTRA2_DROPS     ----------------------------------------------------------------------
HTRA2_DROWI     ----------------------------------------------------------------------
HTRA2_DROPE     ----------------------------------------------------------------------
HTRA2_DROYA     ----------------------------------------------------------------------
HTRA2_DROGR     ----------------------------------------------------------------------
HTRA2_DROER     ----------------------------------------------------------------------
HTRA2_DROSI     ----------------------------------------------------------------------
HTRA2_DROSE     ----------------------------------------------------------------------
HTRA2_DROME     ----------------------------------------------------------------------
HTRA2_DROMO     ----------------------------------------------------------------------
HTRA2_DROVI     ----------------------------------------------------------------------
HTRAL_STAS1     ----------------------------------------------------------------------
HTRAL_STAHJ     ----------------------------------------------------------------------
HTRA2_DROAN     ----------------------------------------------------------------------
HTRAL_STAES     ----------------------------------------------------------------------
HTRAL_STAEQ     ----------------------------------------------------------------------
HTRAL_STAAW     ----------------------------------------------------------------------
HTRAL_STAAS     ----------------------------------------------------------------------
HTRAL_STAAN     ----------------------------------------------------------------------
HTRAL_STAAM     ----------------------------------------------------------------------
HTRAL_STAAC     ----------------------------------------------------------------------
HTRAL_STAA8     ----------------------------------------------------------------------
HTRAL_STAA3     ----------------------------------------------------------------------
HTRAL_STAAR     ----------------------------------------------------------------------
HTRAL_STAAB     ----------------------------------------------------------------------
DEGP5_ARATH     ----------------------------------------------------------------------
DEGP2_ARATH     ----------------------------------------------------------------------
Y4BJ_RHISN      ----------------------------------------------------------------------
DEGP3_ARATH     ----------------------------------------------------------------------
DEGP9_ARATH     ----------------------------------------------------------------------
DGP10_ARATH     ----------------------------------------------------------------------
NM111_PICGU     ----------------------------------------------------------------------
NM111_CANGA     ----------------------------------------------------------------------
DGP13_ARATH     ----------------------------------------------------------------------
NM111_YARLI     ----------------------------------------------------------------------
NHRF3_RAT       ----------------------------------------------------------------------
NHRF3_RABIT     ----------------------------------------------------------------------
NM111_ASPTN     ----------------------------------------------------------------------
NM111_ASPOR     ----------------------------------------------------------------------
NHRF3_BOVIN     ----------------------------------------------------------------------
NM111_AJECN     ----------------------------------------------------------------------
NHRF3_HUMAN     ----------------------------------------------------------------------
NM111_ASPNC     ----------------------------------------------------------------------
NM111_LODEL     ----------------------------------------------------------------------
NHRF3_MOUSE     ----------------------------------------------------------------------
NM111_NEOFI     ----------------------------------------------------------------------
RASP_BACSK      ----------------------------------------------------------------------
PDZ1P_HUMAN     ----------------------------------------------------------------------
CTPAL_STAHJ     ----------------------------------------------------------------------
NHRF4_HUMAN     ----------------------------------------------------------------------
NHRF3_PONAB     ----------------------------------------------------------------------
NM111_ASPCL     ----------------------------------------------------------------------
NM111_ASPFU     ----------------------------------------------------------------------
NM111_ASHGO     ----------------------------------------------------------------------
DEGP4_ARATH     ----------------------------------------------------------------------
NM111_PHANO     ----------------------------------------------------------------------
RASP_GEOKA      ----------------------------------------------------------------------
DGP11_ARATH     ----------------------------------------------------------------------
Y638_RHILO      ----------------------------------------------------------------------
NM111_KLULA     ----------------------------------------------------------------------
Y3649_PSEAE     ----------------------------------------------------------------------
Y1380_AGRT5     ----------------------------------------------------------------------
Y2128_LACLA     ----------------------------------------------------------------------
NM111_COCIM     ----------------------------------------------------------------------
USH1C_MOUSE     ----------------------------------------------------------------------
RSEP_SALTY      ----------------------------------------------------------------------
RSEP_SALTI      ----------------------------------------------------------------------
SCRIB_HUMAN     ----------------------------------------------------------------------
CTPAL_STAAW     ----------------------------------------------------------------------
CTPAL_STAAS     ----------------------------------------------------------------------
CTPAL_STAAR     ----------------------------------------------------------------------
CTPAL_STAAN     ----------------------------------------------------------------------
CTPAL_STAAM     ----------------------------------------------------------------------
CTPAL_STAAC     ----------------------------------------------------------------------
CTPAL_STAAB     ----------------------------------------------------------------------
Y829_BRUME      ----------------------------------------------------------------------
Y1156_BRUSU     ----------------------------------------------------------------------
Y1355_LISIN     ----------------------------------------------------------------------
CTPAL_STAS1     ----------------------------------------------------------------------
Y1689_STRP3     ----------------------------------------------------------------------
RSEP_ECOLI      ----------------------------------------------------------------------
RSEP_ECO57      ----------------------------------------------------------------------
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      ----------------------------------------------------------------------
Y2869_MYCTU     ----------------------------------------------------------------------
Y183_NEIMB      ----------------------------------------------------------------------
Y1318_LISMO     ----------------------------------------------------------------------
Y084_NEIMA      ----------------------------------------------------------------------
F_BPPHM         ----------------------------------------------------------------------
Y890_THEMA      ----------------------------------------------------------------------
Y2031_STRP8     ----------------------------------------------------------------------
Y1963_STRP1     ----------------------------------------------------------------------
Y1682_STRP6     ----------------------------------------------------------------------
SCRIB_MOUSE     ----------------------------------------------------------------------
LAP4_DROME      ----------------------------------------------------------------------
EEP_ENTFA       ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QPVGFADIVEKVKPSVISVKVNIAEKTAKNEDRAEDSPFQPGSPMERFFRRFXXXXXXXXXXXXXXXXXX
DEGP_BRUME      QQAGFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKAN
DEGP_BRUSU      ---GFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKAN
DEGP_BRUAB      ---GFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKAN
DEGP_BRUA2      ---GFADLVEKVRPAVVSVRVKKDVQETSNRGPQFFGPLPDGHPLKRFFRDFGMEPRGDSRSDNRRGKAN
DEGP_RHIME      ----------------------------------------------------------------------
DEGP_BARHE      QQQGFADIVSQVKPAXXXXXXXXXXXXX--EWFFSDFFSTPGHPLKKFFQDFYNRDKPSNKSLQRSHRLR
HTOA_HAEIN      EQNSLAPMLEKVQPAVVTLSV---EGKAKVDSR---SPFLDDIPEEKFFFGDRFAEQFGGRGESKRNFRG
DEGP_SALTY      QMPSLAPMLEKVMPSVVSI--NVEGSTTVNTPRGDDSPFQDGSPFQN--SPFCXXXXXXXXXXXXXKFMA
DEGP_ECOLI      QMPSLAPMLEKVMPSVVSI--NVEGSTTVNTPRGDDSPFQEGSPFQS--SPFCXXXXXXXXXXXXXKFMA
DEGP_ECO57      QMPSLAPMLEKVMPSVVSI--NVEGSTTVNTPRGDDSPFQEGSPFQS--SPFCXXXXXXXXXXXXXKFMA
DEGP_RICCN      R-YSFADIVEPLIPAVVNIST--IEYVNSKSENAEKDPLQ--EKVNDFLEKLNIPLNLEEVDQTPKSVPL
DEGP_CHLMU      ----------------------------------------------------------------------
DEGP_CHLPN      ---GFSKVATKATPAVVYIESFPKSQAVTHPSPGRRGPYE--NPFDEFFNRFFGLPSQREKPQSKEAVRG
DEGP_CHLTR      ---GFSRVAAKATPGVVYIENNQAIASPGNKRGFQENPFDYFN--DEFFNRFFGLPSHREQQRPQQRDAV
DEGP_BUCAI      APM-----LEKVMPSVISINISAITRTSRLPHQGDNSPFQGNSPF-----RHSPFCHINPDSDDKKEKFR
DEGP_BUCAP      LAPSLAPMLEKVMPSVISI--NIEGSTVVHTSRGHNSPFQGNSP----FRNSPFCRSNPNSNSMHEKFHA
DEGP_RICPR      ----------------------------------------------------------------------
DEGP_BUCBP      -------VLEKVIPSVVSITV---------EGNVTQSTRIPRQFQSSFNKKVLDCFGISRCMTRQGKFHA
Y938_SYNP6      ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGQ_ECOLI      LP-SLAPMLEKVLPAVVSVRV---EGTASQGQKGDDLPDQPAQPFEGL----------------------
HTRA_LACHE      ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
DEGS_ECOLI      ----------------------------------------------------------------------
DEGS_ECO57      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
DGP14_ARATH     ----------------------------------------------------------------------
DEGP8_ARATH     ----------------------------------------------------------------------
HTRA1_HUMAN     HKYNFADVVEKIAPAVVHIELFRKLPFSKRE-----VPVASGS---------------------------
HTRA1_MOUSE     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
HTRA4_HUMAN     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------
HTRA_BACSU      ----------------------------------------------------------------------
HTRA_LACLA      ----------------------------------------------------------------------
HTRA2_BOVIN     ----------------------------------------------------------------------
HTRA2_HUMAN     ----------------------------------------------------------------------
HTRA2_MOUSE     ----------------------------------------------------------------------
HTRA2_DROPS     ----------------------------------------------------------------------
HTRA2_DROWI     ----------------------------------------------------------------------
HTRA2_DROPE     ----------------------------------------------------------------------
HTRA2_DROYA     ----------------------------------------------------------------------
HTRA2_DROGR     ----------------------------------------------------------------------
HTRA2_DROER     ----------------------------------------------------------------------
HTRA2_DROSI     ----------------------------------------------------------------------
HTRA2_DROSE     ----------------------------------------------------------------------
HTRA2_DROME     ----------------------------------------------------------------------
HTRA2_DROMO     ----------------------------------------------------------------------
HTRA2_DROVI     ----------------------------------------------------------------------
HTRAL_STAS1     ----------------------------------------------------------------------
HTRAL_STAHJ     ----------------------------------------------------------------------
HTRA2_DROAN     ----------------------------------------------------------------------
HTRAL_STAES     ----------------------------------------------------------------------
HTRAL_STAEQ     ----------------------------------------------------------------------
HTRAL_STAAW     ----------------------------------------------------------------------
HTRAL_STAAS     ----------------------------------------------------------------------
HTRAL_STAAN     ----------------------------------------------------------------------
HTRAL_STAAM     ----------------------------------------------------------------------
HTRAL_STAAC     ----------------------------------------------------------------------
HTRAL_STAA8     ----------------------------------------------------------------------
HTRAL_STAA3     ----------------------------------------------------------------------
HTRAL_STAAR     ----------------------------------------------------------------------
HTRAL_STAAB     ----------------------------------------------------------------------
DEGP5_ARATH     ----------------------------------------------------------------------
DEGP2_ARATH     ----------------------------------------------------------------------
Y4BJ_RHISN      ----------------------------------------------------------------------
DEGP3_ARATH     ----------------------------------------------------------------------
DEGP9_ARATH     ----------------------------------------------------------------------
DGP10_ARATH     ----------------------------------------------------------------------
NM111_PICGU     ----------------------------------------------------------------------
NM111_CANGA     ----------------------------------------------------------------------
DGP13_ARATH     ----------------------------------------------------------------------
NM111_YARLI     ----------------------------------------------------------------------
NHRF3_RAT       ----------------------------------------------------------------------
NHRF3_RABIT     ----------------------------------------------------------------------
NM111_ASPTN     ----------------------------------------------------------------------
NM111_ASPOR     ----------------------------------------------------------------------
NHRF3_BOVIN     ----------------------------------------------------------------------
NM111_AJECN     ----------------------------------------------------------------------
NHRF3_HUMAN     ----------------------------------------------------------------------
NM111_ASPNC     ----------------------------------------------------------------------
NM111_LODEL     ----------------------------------------------------------------------
NHRF3_MOUSE     ----------------------------------------------------------------------
NM111_NEOFI     ----------------------------------------------------------------------
RASP_BACSK      ----------------------------------------------------------------------
PDZ1P_HUMAN     ----------------------------------------------------------------------
CTPAL_STAHJ     ----------------------------------------------------------------------
NHRF4_HUMAN     ----------------------------------------------------------------------
NHRF3_PONAB     ----------------------------------------------------------------------
NM111_ASPCL     ----------------------------------------------------------------------
NM111_ASPFU     ----------------------------------------------------------------------
NM111_ASHGO     ----------------------------------------------------------------------
DEGP4_ARATH     ----------------------------------------------------------------------
NM111_PHANO     ----------------------------------------------------------------------
RASP_GEOKA      ----------------------------------------------------------------------
DGP11_ARATH     ----------------------------------------------------------------------
Y638_RHILO      ----------------------------------------------------------------------
NM111_KLULA     ----------------------------------------------------------------------
Y3649_PSEAE     ----------------------------------------------------------------------
Y1380_AGRT5     ----------------------------------------------------------------------
Y2128_LACLA     ----------------------------------------------------------------------
NM111_COCIM     ----------------------------------------------------------------------
USH1C_MOUSE     ----------------------------------------------------------------------
RSEP_SALTY      ----------------------------------------------------------------------
RSEP_SALTI      ----------------------------------------------------------------------
SCRIB_HUMAN     ----------------------------------------------------------------------
CTPAL_STAAW     ----------------------------------------------------------------------
CTPAL_STAAS     ----------------------------------------------------------------------
CTPAL_STAAR     ----------------------------------------------------------------------
CTPAL_STAAN     ----------------------------------------------------------------------
CTPAL_STAAM     ----------------------------------------------------------------------
CTPAL_STAAC     ----------------------------------------------------------------------
CTPAL_STAAB     ----------------------------------------------------------------------
Y829_BRUME      ----------------------------------------------------------------------
Y1156_BRUSU     ----------------------------------------------------------------------
Y1355_LISIN     ----------------------------------------------------------------------
CTPAL_STAS1     ----------------------------------------------------------------------
Y1689_STRP3     ----------------------------------------------------------------------
RSEP_ECOLI      ----------------------------------------------------------------------
RSEP_ECO57      ----------------------------------------------------------------------
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      ----------------------------------------------------------------------
Y2869_MYCTU     ----------------------------------------------------------------------
Y183_NEIMB      ----------------------------------------------------------------------
Y1318_LISMO     ----------------------------------------------------------------------
Y084_NEIMA      ----------------------------------------------------------------------
F_BPPHM         ----------------------------------------------------------------------
Y890_THEMA      ----------------------------------------------------------------------
Y2031_STRP8     ----------------------------------------------------------------------
Y1963_STRP1     ----------------------------------------------------------------------
Y1682_STRP6     ----------------------------------------------------------------------
SCRIB_MOUSE     ----------------------------------------------------------------------
LAP4_DROME      ----------------------------------------------------------------------
EEP_ENTFA       ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXFFISADGYAVTNNHVVDGADKVEVTTDDGKTYKAKVIGTDQRTDLALIKAEGRTDFPFAKLSEGK
DEGP_BRUME      KPRPGFVISEDGYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAKRKFVYVAFGDNK
DEGP_BRUSU      KPRPGFVISEDGYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAKRKFVYVAFGDNK
DEGP_BRUAB      KPRPGFVISEDGYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAKRKFVYVAFGDNK
DEGP_BRUA2      KPRPGFVISEDGYVVTNNHVVSDGDAYTVVLDDGTELDAKLIGADPRTDLAVLKINAKRKFVYVAFGDNK
DEGP_RHIME      -----FFITEDGYLVTNNHVVSDGSAFTVIMNDGTELDAKLVGKDSRTDLAVLKVDDKRKFTYVSFADDK
DEGP_BARHE      PIAFGFFISSDGYIVTNNHVISDGTSYAVVLDDGTELNAKLIGTDPRTDLAVLKVNEKRKFSYVDFGDSK
HTOA_HAEIN      LGSGVIINASKGYVLTNNHVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIKFADSK
DEGP_SALTY      LGSGVIIDAAKGYVVTNNHVVDNASVIKVQLSDGRKFDAKVVGKDPRSDIALIQIQNPKNLTAIKLADSD
DEGP_ECOLI      LGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSD
DEGP_ECO57      LGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSD
DEGP_RICCN      GSG--FIIEPNGLIVTNYHVIANVDKINIKLADNTELSAKLIGNDTKTDLALLKIDSEEPLPFVEFGDSN
DEGP_CHLMU      -----FIVSEDGYVVTNHHVVEDAGKIHVTLHDGQKYTAKIIGLDPKTDLAVIKIQAK-NLPFLTFGNSD
DEGP_CHLPN      TG---FLVSPDGYIVTNNHVVEDTGKIHVTLHDGQKYPATVIGLDPKTDLAVIKIKSQ-NLPYLSFGNSD
DEGP_CHLTR      RGTG-FIVSEDGYVVTNHHVVEDAGKIHVTLHDGQKYTAKIVGLDPKTDLAVIKIQAEK-LPFLTFGNSD
DEGP_BUCAI      ALGSGVIINADGYAVTNNHVVENANKIQVQLSDGRRYEARVIGKDSRSDIALIQLKNANNLSEIKIADSD
DEGP_BUCAP      LGSGVIINADKAYAVTNNHVVENANKIQVQLSDGRRYEASIIGKDSRSDIALIQLKNAKNLSAIKIADSD
DEGP_RICPR      -----FIIAPNGLIVTNYHVIANVEKINIKLADNTEFLAKLIGSDSKTDLALLKIDSEEPLPFVEFGDSN
DEGP_BUCBP      LGSGVILDSKNGYIVTNSHVVDRANKIQVQLSNGCKHEAVVIGKDARFDIAIIKLKKVKNLHEIKMSNSD
Y938_SYNP6      -----FVVDGNGLIMTNAHVVANADQVRVTLRDGREFTGRVRGADSVTDLALVEVDTKGELPTARINSSN
DEGP1_ARATH     -----FVWDKQGHIVTNYHVIRGASDLRVTLADQTTFDAKVVGFDQDKDVAVL----RIDAPKNKLRSAD
DEGQ_ECOLI      -GSGVIINASKGYVLTNNHVINQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSK
HTRA_LACHE      -----------GYIVTNNHVISGSDAVQVLLANGKTVNAKVVGKDSTTDLAVLSIDAKYVTQTAQFGDSK
DEGS_HAEIN      -------MSKDGYILTNKHLIQNADQIVVALQNGNIFEASLVGSDDLTDLAVLKIRADNLSTIPQNSARQ
YVTA_BACSU      --------SDKAYIITNNHVVEGANKLTVTLYNGETETAKLVGSDTITDLAVLEISGKNVKKVASFGDSS
DEGS_ECOLI      -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
DEGS_ECO57      -----------GYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARR
HTRA3_HUMAN     -----FIMSEAGLIITNAHVVSGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSA
DGP14_ARATH     -------IDADGTILTCAHVVSSKGRVDVTLQDGRTFEGVVVNADLQSDIALVKIKSKTPLPTAKLGSSK
DEGP8_ARATH     -----------GYIVTNYHVIGNAGRVNILASDGKNFEGKLVGADRAKDLAVLKVDAPETLPIKVGQSNS
HTRA1_HUMAN     ----GFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSS
HTRA1_MOUSE     -----FIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEAIIKDVDEKADIALIKIDHQGKLPVLLLGRSS
HTRA3_MOUSE     -----FIMSEAGLIVTNAHVVSGRQQLKVQLQNGDAYEATIQDIDKKSDIATIVIHPKKKLPVLLLGHSA
HTRA4_HUMAN     -----FIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLAVIKIESNAELPVLMLGRSS
YYXA_BACSU      ------------YVVTNHHVIEGASQIEISLKDGSRVSADLVGSDQLMDLAVLRVKSDKIKAVADFNSDK
HTRA_BACSU      ------------YIITNNHVVEGASSLKVSLYDGTEVTAKLVGSDSLTDLAVLQISDDHVTKVANFGDSS
HTRA_LACLA      ----------DAYVVTNYHVIAGNSSLDVLLSGGQKVKASVVGYDEYTDLAVLKISSEHVKDVATFADSK
HTRA2_BOVIN     -----FVVAADGLIVTNAHXXXXXXXXXXXLPSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSA
HTRA2_HUMAN     -----FVVAADGLIVTNAHXXXXXXXXXXXLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSA
HTRA2_MOUSE     -----FVVASDGLIVTNAHXXXXXXXXXXXLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSA
HTRA2_DROPS     -----FVIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQV-SGLPVMKLGKSS
HTRA2_DROWI     -----FVIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVN-NLPVMRLGKSS
HTRA2_DROPE     -----FVIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIHV-SGLPVMKLGKSS
HTRA2_DROYA     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSST
HTRA2_DROGR     -----FVIEQNGLILTNAHVVINKPNVQVRLSDGRTFPATIEDVDQTSDLATLRIQV-TNLSVMKLGKSS
HTRA2_DROER     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSST
HTRA2_DROSI     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSST
HTRA2_DROSE     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSST
HTRA2_DROME     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSST
HTRA2_DROMO     -----FVIEQNGLILTNAHVVINKPNVQVRLSDGRTFPATIEDVDQTSDLATLRIQVN-NLSVMKLGKSS
HTRA2_DROVI     -----FVIEQNGLILTNAHVVINKPNVQVRLSDGRTFPATIEDVDQTSDLATLRIQVN-NLSVMKLGKSS
HTRAL_STAS1     ------------FIMTNAHVVGDKKEQKITYGNNDTSIGKVIGTDKFSDIAVVKTKIKSGSDVKSIKMGD
HTRAL_STAHJ     ------------FILTNTHIVGSNKRVNITYDDDKTATATVVGRDMWSDIAVLKATIKNNMQPIKIGHSK
HTRA2_DROAN     -----FIIEQNGLILTNAHVVINKPHVQVRLSDGRTFPATIEDVDQTSDLATLRIQV-SNLSVMRLGKSS
HTRAL_STAES     ------------YIFTNAHVVGDQEKQKVTYGNDKSVTGKVIGKDKWSDLAVVKAKVADEKPMTMGDSNN
HTRAL_STAEQ     ------------YIFTNAHVVGDQEKQKVTYGNDKSVTGKVIGKDKWSDLAVVKAKVADEKPMTMGDSNN
HTRAL_STAAW     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAS     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAN     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAM     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAC     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAA8     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAA3     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAR     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
HTRAL_STAAB     ------------YIVTNAHVVGDKENQKITFSNNKSVVGKVLGKDKWSDLAVVKATS-SDSSVKEIAIGD
DEGP5_ARATH     -----------GHIVTNYHVIAGLQRCKVSLVDAKSKEGKIVGLDPDNDLAVLKTEGRELNPVVLGTSND
DEGP2_ARATH     ------FMIGDGKLLTNAHCVEHDTQVKVKRGDDRKYVAKVLVRGVDCDIALLSVESEDFWKGAELRLGH
Y4BJ_RHISN      -----FFISKQGHLVTNHHVIKGCSAIEVRRPGQLRLPANIVAVDPTNDLALLRVESDTG-AYASV-RVE
DEGP3_ARATH     ------FVISGKKILTNAHVVANQTSVKVRKHGSTTYKAKVQAVGHECDLAILEIEGMNPLELGDI----
DEGP9_ARATH     --------------LTNAHSVEHHTQVKLKKRGSDTYLATVLAIGTECDIALLTVEGVSPVEFGDL----
DGP10_ARATH     ------FVISGRKIITNAHVVADHSFVLVRKHGSSIHRAEVQAVGHECDLAILVVDSEVFWEGMNALEDI
NM111_PICGU     --------SERGYILTNRHVVGGPFCGYVVFDNHEEAVVRPIYRDPIHDFGFLQFDPK-DIRYMKIEQLD
NM111_CANGA     -----------GIILTNRHVVGAGPFVGVVFDNHEECDVIPIYRDPVHDFGFLKFDPKTKIHALELKPSL
DGP13_ARATH     ------FVIPGKMIITNAHVVANHILVLVIKRGSKKYKAEVKAIGRECDLAILVIESKEDMNPLELGD-M
NM111_YARLI     ----------------------------------------------------------------RLCPEK
NHRF3_RAT       ----------------------------------------------------------------------
NHRF3_RABIT     ----------------------------------------------------------------------
NM111_ASPTN     -----FVVDAEGYILTNRHVVPGPFWGYVIFDNHEECDVRPVYRDPVHDFGILKFDPKA-IRYLKLTELK
NM111_ASPOR     -----FVVDAEGYILTNRHVVPGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKANLTELKLQPDA
NHRF3_BOVIN     ----------------------------------------------------------------------
NM111_AJECN     -----FVVDAEGYILTNRHVVAGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPAAPVTELKLSPDA
NHRF3_HUMAN     ----------------------------------------------------------------------
NM111_ASPNC     -----FVVDAEGYILTNRHVVPGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKA-IRYMKLRELK
NM111_LODEL     -----FVVDAEGLILTNRHVVGGPFTGYVVFDNHESVDVKPIYRDPVHDFGFLQFDTK-DVKYLKLTQSL
NHRF3_MOUSE     ----------------------------------------------------------------------
NM111_NEOFI     -----FVVDAEGYILTNRHVVAGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKAELTELKLRPEA
RASP_BACSK      ----------------------------------------------------------------------
PDZ1P_HUMAN     ----------------------------------------------------------------------
CTPAL_STAHJ     ----------------------------------------------------------------------
NHRF4_HUMAN     ----------------------------------------------------------------------
NHRF3_PONAB     ----------------------------------------------------------------------
NM111_ASPCL     -----FVVDAEGYILTNRHVVAGPFWGYCIFDNHEECDVRPVYRDPVHDFGILKFDPKAELTELKLRPEA
NM111_ASPFU     -----FVVDAEGYILTNRHVVAGPFWGYCIFDNHEECDVHPVYRDPVHDFGILKFNPKAELTELKLRPEA
NM111_ASHGO     -----------GIILTNRHVVGGPFSGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPSTNVQALELKPAL
DEGP4_ARATH     ------FVISGKKILTNAHVVADHIFLQVRKHGSPTYKAQVRAIGHECDLAILEIDNEEFWEMIPLELGE
NM111_PHANO     -----FVVDAEGYILTNRHVVGAGPFIGYCIDNHEECDVYPVYRDPVHDFGILRFDPKASVSALQLRPDF
RASP_GEOKA      ----------------------------------------------------------------------
DGP11_ARATH     ------FAIAGRKILTNAHVVMAMNDVDVKRHGSQIYKAKVQKISHECDLAILEIDSDEFWKGMNPLEDI
Y638_RHILO      ----------------------------------------------------------------------
NM111_KLULA     -----------GIILTNRHVVG----------PGPFIGYAIFDNHEECDVIPIYRDPVHDFGFLKFDPSK
Y3649_PSEAE     ----------------------------------------------------------------------
Y1380_AGRT5     ----------------------------------------------------------------------
Y2128_LACLA     ----------------------------------------------------------------------
NM111_COCIM     -----------GYILTNRHVVAGPFWGYCIFDNHEECDVTPIYRDPVHDFGILKFDPKAPLTELKLQPES
USH1C_MOUSE     ----------------------------------------------------------------------
RSEP_SALTY      ----------------------------------------------------------------------
RSEP_SALTI      ----------------------------------------------------------------------
SCRIB_HUMAN     ----------------------------------------------------------------------
CTPAL_STAAW     ----------------------------------------------------------------------
CTPAL_STAAS     ----------------------------------------------------------------------
CTPAL_STAAR     ----------------------------------------------------------------------
CTPAL_STAAN     ----------------------------------------------------------------------
CTPAL_STAAM     ----------------------------------------------------------------------
CTPAL_STAAC     ----------------------------------------------------------------------
CTPAL_STAAB     ----------------------------------------------------------------------
Y829_BRUME      ----------------------------------------------------------------------
Y1156_BRUSU     ----------------------------------------------------------------------
Y1355_LISIN     ----------------------------------------------------------------------
CTPAL_STAS1     ----------------------------------------------------------------------
Y1689_STRP3     ----------------------------------------------------------------------
RSEP_ECOLI      ----------------------------------------------------------------------
RSEP_ECO57      ----------------------------------------------------------------------
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      ----------------------------------------------------------------------
Y2869_MYCTU     ----------------------------------------------------------------------
Y183_NEIMB      ----------------------------------------------------------------------
Y1318_LISMO     ----------------------------------------------------------------------
Y084_NEIMA      ----------------------------------------------------------------------
F_BPPHM         ---------------------------------GKIAVPKGDGPDNHADYQLLKAAKPHDYFTSALPW--
Y890_THEMA      ----------------------------------------------------------------------
Y2031_STRP8     ----------------------------------------------------------------------
Y1963_STRP1     ----------------------------------------------------------------------
Y1682_STRP6     ----------------------------------------------------------------------
SCRIB_MOUSE     ----------------------------------------------------------------------
LAP4_DROME      ----------------------------------------------------------------------
EEP_ENTFA       ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PRIGDWVLAVGNPFGLGGTVTAGIVSASGRDIGNGPYDDFIQIDAPVNKGNSGGPAFDTNGEVMGVNTAI
DEGP_BRUME      VRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAI
DEGP_BRUSU      VRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAI
DEGP_BRUAB      VRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAI
DEGP_BRUA2      VRVGDWVVAVGNPFGLGGTVTSGIVSARGRDIGAGPYDDFIQIDAAVNKGNSGGPAFDLSGEVIGINTAI
DEGP_RHIME      VRVGDWVVAVGNPFGLGGTVTAGIISARGRDIGSGPYDDYLQVDAAVNRGNSGGPTFNLSGEVVGINTAI
DEGP_BARHE      LRVGDWVVAIGNPFGLGGTVTAGIVSARGRDIGTGVYDDFIQIDAAVNRGNSGGPTFDLNGKVVGVNTAI
HTOA_HAEIN      LRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSGTYENYIQTDAAVNRGNSGGALVNLNGELIGINTAI
DEGP_SALTY      ARVGDYTVAIGNPFGLGETVTSGIVSALGRSLNVENYENFIQTDAAINRGNSGGALVNLNGELIGINTAI
DEGP_ECOLI      ARVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAEYENFIQTDAAINRGNSGGALVNLNGELIGINTAI
DEGP_ECO57      ARVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAEYENFIQTDAAINRGNSGGALVNLNGELIGINTAI
DEGP_RICCN      DRVGDWVIAIGNPFGLGGTVTSGIISSKGRXXXXXXXXXXXQTDAAINNGNSGGPMFNLDQKVIGVNTAI
DEGP_CHLMU      QQIGDWSIAIGNPFGLQATVTVGVISAKGRNLHIVDFEDFIQTDAAINPGNSGGPLLNIDGQVIGVNTAI
DEGP_CHLPN      HKVGDWAIAIGNPFGLQATVTVGVISAKGRNLHIADFEDFIQTDAAINPGNSGGPLLNIDGQVIGVNTAI
DEGP_CHLTR      QQIGDWAIAIGNPFGLQATVTVGVISAKGRNLHIVDFEDFIQTDAAINPGNSGGPLLNINGQVIGVNTAI
DEGP_BUCAI      NRVGDYTVAIGNPYGLGETVTSGIISALGRSLNIEHYENFIQTDAAINRGNSGGALVNLKGELIGINTAI
DEGP_BUCAP      TRVGDYTVAIGNPYGLGETVTSGIISALGRSLNIEHYENFIQTDAAINRGNSGGALVNLKGELIGINTAI
DEGP_RICPR      DRVGDWVIAIGNPFGLGGTVTSGIISSKGRXXXXXXXXXFIQTDAAINNGNSGGPMFNLDQKVIGVNTAI
DEGP_BUCBP      IKVGDYVIAIGNPYGLGETVTSGIISASGLNIEN--YENFIQTDAAINRGNSGGALVNLKGELIGINTAI
Y938_SYNP6      VEVGDWAIAIGNPLGLDNTVTLGIVSSLGRSSAVGIPDDFIQTDAVINPGNSGGPLVNSRGEVIGINTAI
DEGP1_ARATH     LLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAI
DEGQ_ECOLI      LRVGDFAVAVGNPFGLGQTATSGIVSALGRSLNLEGLENFIQTDASIXXXXXXXXXXXXXXXXXXXXTAI
HTRA_LACHE      HEAGQTVIAVGSPLGYASTVTQGIISAPARTISSGNQQTVIQTDAAINPGNSGGALVNSAGQVIGINSLA
DEGS_HAEIN      AHVGDVVLAIGNPYNLGQSVSQGIISAIGRNVGDSGRQNFIQTDASINRGNSGGALINSAGELVGISTLS
YVTA_BACSU      QRTGEKVIAIGNPLGFSGTVTQGIISGLNRDTTQGTVENVLQTDAAINPGNSGGPLINASGQVIGINSLK
DEGS_ECOLI      PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
DEGS_ECO57      PHIGDVVLAIGNPYNLGQTITQGIISATGR-IGLNPRQNFLQTDASINHGNSGGALVNSLGELMGINTLS
HTRA3_HUMAN     DRPGEFVVAIGSPFALQNTVTTGIVSTAGRELGLRDSDDYIQTDAIINYGNSGGPLVNLDGEVIGINTLK
DGP14_ARATH     LRPGDWVIAVGCPLSLQNTVTAGIVSCVDRDLGGGKHREYLQTDCSINAGNSGGPLVNLDGEVIGVNIMK
DEGP8_ARATH     LKVGQQCLAIGNPFGFDHTLTVGVISGLNRDIFSXXXXXXXXXDAAINPGNSGGPLLDSKGNLIGINTAI
HTRA1_HUMAN     ERPGEFVVAIGSPFSLQNTVTTGIVSTTGKELGLRNSDDYIQTDAIINYGNSGGPLVNLDGEVIGINTLK
HTRA1_MOUSE     ERPGEFVVAIGSPFSLQNTVTTGIVSTTGKELGLRNSDDYIQTDAIINYGNSGGPLVNLDGEVIGINTLK
HTRA3_MOUSE     DRPGEFVVAIGSPFALQNTVTTGIVSTAGKELGLRDSDDYIQTDAIINYGNSGGPLVNLDGEVIGINTLK
HTRA4_HUMAN     DRAGEFVVALGSPFSLQNTATAGIVSTGGKELGMKDSDDYVQIDATINYGNSGGPLVNLDGDVIGVNSLR
YYXA_BACSU      VKSGEPVIAIGNPLGLAGSVTQGVISGTERAIGDGQPDEVLQTDAAINPGNSGGALLNMDGKVIGINSMK
HTRA_BACSU      DRTGETVIAIGDPLGLSRTVTQGIVSGVDRTVSMSTSANVIQTDAAINPGNSGGPLLNTDGKIVGINSMK
HTRA_LACLA      LTIGEPAIAVGSPLGFANTATEGILSATSRQVGQTTNINAIQTDAAINPGNSGGALINIEGQVIGIQSKI
HTRA2_BOVIN     DRQGEFVVAMGSPFALQNTITSGIVSSAQRDLGLPQTNEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMK
HTRA2_HUMAN     DRQGEFVVAMGSPFALQNTITSGIVSSAARDLGLPQTNEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMK
HTRA2_MOUSE     DRQGEFVVAMGSPFALQNTITSGIVSSAARDLGLPQNNEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMK
HTRA2_DROPS     TRSGEWVVALGSPLALSNTVTAGVISATQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROWI     TRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROPE     TRSGEWVVALGSPLALSNTVTAGVISATQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROYA     LRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROGR     TRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROER     LRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROSI     LRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROSE     LRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROME     LRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROMO     TRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRA2_DROVI     TRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRAL_STAS1     SSLGEPIIVVGNPLGVDGSVSEGIVSGLNRHVPDNQYDVLMQMDAPVNPGNSGGGVIDKNGKLIGI-ASL
HTRAL_STAHJ     HKLGESILVVGNPLGFKNTVTKGIISGLNRDNKNDEWVNTFQIDASVNPGNSGGAVVNRVGELVGVSLKI
HTRA2_DROAN     TRSGEWVVALGSPLALSNTVTAGVISSTQRELGLRNRDNYLQTDAAITFGNSGGPLVNLDGEAIGVNSMK
HTRAL_STAES     IKLAEPILVIGNPLGFKGSVSQGIVSGLNRHVKNDNYDALMQIDAPVNPGNSGGAVVDRDGRLIGI-VSL
HTRAL_STAEQ     IKLAEPILVIGNPLGFKGSVSQGIVSGLNRHVKNDNYDALMQIDAPVNPGNSGGAVVDRDGRLIGI-VSL
HTRAL_STAAW     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAS     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAN     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAM     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAC     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAA8     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAA3     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAR     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
HTRAL_STAAB     SNLGEPILVVGNPLGVDGTVTEGIISGLNRNVKDNKYDMLMQIDASVNPGNSGGAVVNREGKLIGVVAAK
DEGP5_ARATH     LRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPNGKISEAIQTDADINSGNSGGPLLDSYGHTIGVNTAT
DEGP2_ARATH     PRLQDSVTVVGYPLG-GDTVTKGVVSREVTSYAHGSSDLLIQIDAAINPGNSGGPAFNDQGECIGVAFQV
Y4BJ_RHISN      TRLGESVAVFGYPLASGGNFTLGNVTALA---GLGNDTRFIQISAPVQPGNSGGPLIDSYGNVIGVVTS-
DEGP3_ARATH     PSMQDTVYVVGYPKG-GDTISVGVVSRVGKYSHSGTELLAIQIDAAINNGNSGGPVIMGN-KVAGVESLC
DEGP9_ARATH     PALQDAVTVVGYPIG-GDTVTSGVVSRMELSYVHGSTELLLQIDAAINSGNSGGPAFNDKGKCVGIAFQS
DGP10_ARATH     PFLQEAVAVVGYPQGGDNSVTKGVVSRPTQYVHGATQLMAIQIDAAINPGNSGGPAIMGN-KVAGV---A
NM111_PICGU     LRVGTEIRVVGNDAGEKLSILAGFISRLDRDYGTLSYNDFIQXXXXXXXXXXXXPVVNKEGYAVALQ---
NM111_CANGA     AKVGSEIRVVGNDAGEKLSILAGFISRIDRDYGELTYNDFIQXXXXXXXXXXXXPVVNVDGYAVALQ---
DGP13_ARATH     PFLQESVNVIGYPTGGENSVTKGVVSRESMDYAHGAINPAIQTDAAMNPGNSGGPVCIGN-KVVGV---A
NM111_YARLI     AQVGTEIRVVGNDNGEKLSILSGFISRLDRDYGDLTYNDFIQXXXXXXXXXXXXPVVDIDGD------AI
NHRF3_RAT       ----------------------------------------------------------------------
NHRF3_RABIT     ----------------------------------------------------------------------
NM111_ASPTN     ARVGSEIRVVGNDAGEKLSILSGVISRLDREYGEG-YSDFIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NM111_ASPOR     ARVGSEIRVVGNDAGEKLSILSGVISRLDREYGEG-YSDFIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NHRF3_BOVIN     ----------------------------------------------------------------------
NM111_AJECN     AKVGVEIRVVGNDAGEKLSILSGVISRLDREYGEG-YSDFIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NHRF3_HUMAN     ----------------------------------------------------------------------
NM111_ASPNC     AKVGSEIRVVGNDAGEKLSILSGVISRLDREYGDG-YSDFIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NM111_LODEL     AKIGTEIRVVGNDNGEKLSILAGIISRIDRDYGALTYNDFIQXXXXXXXXXXXXPVVNEDGKCVALQ---
NHRF3_MOUSE     ----------------------------------------------------------------------
NM111_NEOFI     ARVGCEIRVVGNDAGEKLSILSGVISRLDREYGDGYCDNYIQXXXXXXXXXXXXPVVNIDGHAIALQA--
RASP_BACSK      ----------------------------------------------------------------------
PDZ1P_HUMAN     ----------------------------------------------------------------------
CTPAL_STAHJ     ----------------------------------------------------------------------
NHRF4_HUMAN     ----------------------------------------------------------------------
NHRF3_PONAB     ----------------------------------------------------------------------
NM111_ASPCL     ARVGSEIRVVGNDAGEKLSILSGVISRLDREYGDGYCDNYIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NM111_ASPFU     ARVGCEIRVVGNDAGEKLSILSGVISRLDREYGDGYCDNYIQXXXXXXXXXXXXPVVNIDGHAIALQA--
NM111_ASHGO     AKVGSEIRVVGNDAGEKLSILAGFISRVDRDYGELTYNDFIQXXXXXXXXXXXXPVVNIDGYAVALQ---
DEGP4_ARATH     PSLDESVAVFGYPTGGDSSITKGYVSRVERYAHGGTTLLAIQTDAAINPGNSGGPAIIGN-KMAGV-AFQ
NM111_PHANO     AKVGVEIRVVGNDAGEKLSILSGVISRLDREYGEG-YSDFIQXXXXXXXXXXXXPVVNRDGFAVALQAG-
RASP_GEOKA      ----------------------------------------------------------------------
DGP11_ARATH     PPLQEVVSVVG---GENICITKGLVLRVETRIYDYSDSDLIQIDATINDENSGGPVIMGN-KVVGV---V
Y638_RHILO      ----------------------------------------------------------------------
NM111_KLULA     AKVGSEIRVVGNDAGEKLSILSGFISRLDRDYGELTYNDFIQXXXXXXXXXXXXPVITVEGYAV----AL
Y3649_PSEAE     ----------------------------------------------------------------------
Y1380_AGRT5     ----------------------------------------------------------------------
Y2128_LACLA     ----------------------------------------------------------------------
NM111_COCIM     ARVGVEIRVVGNDAGEKLSILSGVISRLDREYGEG-YSDFIQXXXXXXXXXXXXPVVNIDGHVIALQA--
USH1C_MOUSE     ----------------------------------------------------------------------
RSEP_SALTY      ----------------------------------------------------------------------
RSEP_SALTI      ----------------------------------------------------------------------
SCRIB_HUMAN     ----------------------------------------------------------------------
CTPAL_STAAW     ----------------------------------------------------------------------
CTPAL_STAAS     ----------------------------------------------------------------------
CTPAL_STAAR     ----------------------------------------------------------------------
CTPAL_STAAN     ----------------------------------------------------------------------
CTPAL_STAAM     ----------------------------------------------------------------------
CTPAL_STAAC     ----------------------------------------------------------------------
CTPAL_STAAB     ----------------------------------------------------------------------
Y829_BRUME      ----------------------------------------------------------------------
Y1156_BRUSU     ----------------------------------------------------------------------
Y1355_LISIN     ----------------------------------------------------------------------
CTPAL_STAS1     ----------------------------------------------------------------------
Y1689_STRP3     ----------------------------------------------------------------------
RSEP_ECOLI      ----------------------------------------------------------------------
RSEP_ECO57      ----------------------------------------------------------------------
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      ----------------------------------------------------------------------
Y2869_MYCTU     ----------------------------------------------------------------------
Y183_NEIMB      ----------------------------------------------------------------------
Y1318_LISMO     ----------------------------------------------------------------------
Y084_NEIMA      ----------------------------------------------------------------------
F_BPPHM         PQKG---MAVEMPIGNSAPITYV------PNAGNGPYPHFNWVQTPGGPGNNGALSQVTFGGQKAISAAG
Y890_THEMA      ----------------------------------------------------------------------
Y2031_STRP8     ----------------------------------------------------------------------
Y1963_STRP1     ----------------------------------------------------------------------
Y1682_STRP6     ----------------------------------------------------------------------
SCRIB_MOUSE     ----------------------------------------------------------------------
LAP4_DROME      ----------------------------------------------------------------------
EEP_ENTFA       ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSPSGGSVGIAFSIPASTVKTVVQQLKDKGSVSRGWIGVQIQPVTPEIADSLGLKKPDGALVAEPQPNGP
DEGP_BRUME      FSPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP
DEGP_BRUSU      FSPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP
DEGP_BRUAB      FSPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP
DEGP_BRUA2      FSPSGGSVGIAFAIPSSTAKQVVDQLIKKGSVERGWIGVQIQPVTKDIAASLGLAEEKGAIVASPQDDGP
DEGP_RHIME      FSPSGGNVGIAFAIPASVAKDVVDSLIKDGTVSRGWLGVQIQPVTKDIAESLGLSEANGALVVEPQAGSP
DEGP_BARHE      FSPSGGNVGIAFAIPAATAKQVVQQLIEKGLVQRGWLGVQIQPVTKEISDSIGLKEAKGALITDPL-XXX
HTOA_HAEIN      ISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIKGGELNADLAKAFNVSAQQGAFVSEVLPKSA
DEGP_SALTY      LAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVMPNSS
DEGP_ECOLI      LAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSS
DEGP_ECO57      LAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSS
DEGP_RICCN      FSPLGTNIGIGFAIPSNTAKPIIERLKKDGKVSRGRLGVTIQDLTEDISEGLGLKNTRGVLVAKVQEDGP
DEGP_CHLMU      VXXXXXXXXXXFAIPSLMAKRVIDQLISDGQVTRGFLGVTLQPIDSELAACYKLEKVYGALITDVVKGSP
DEGP_CHLPN      VXXXXXXXXXXFAIPSLMANRIIDQLIRDGQVTRGFLGVTLQPIDAELAACYKLEKVYGALVTDVVKGSP
DEGP_CHLTR      VXXXXXXXXXXFAIPSLMAKRVIDQLISDGQVTRGFLGVTLQPIDSELATCYKLEKVYGALVTDVVKGSP
DEGP_BUCAI      LAPDGGNIGIGFAIPCNMVKNLTAQMVQFGQVRRGELGIMGMELNSDLAQIMKINSQKGAFVSRVLPNSS
DEGP_BUCAP      LAPDGGNIGIGFAIPGNMVKNLTEQMVKFGQVKRGELGIIGMELNSDLAHVMKINAQKGAFVSQVLPNSS
DEGP_RICPR      FSPLGTNIGIGFAIPSNTAKPIIERLKKDGKVSRGRLGVTIQDLTEEISEVLGFKGTNGVLVSKVQENGP
DEGP_BUCBP      LTPDGGNIGIGFAIPINMVNNLTTQILEYGQVKQNELGIVGMELNSDLAKVLKINVHRGAFISQVLSKSP
Y938_SYNP6      RQAPG--AGIGFAIPVNTAKQIETQLLKNGKVSHSYLGVQLLSLTPQMASTVRLPEVQGVLIMGVQRNAP
DEGP1_ARATH     YSPSGASSGVGFSIPVDTVGGIVDQLVRFGKVTRPILGIKFAP--DQSVEQLGV---SGVLVLDAPPSGP
DEGQ_ECOLI      LAPGGGSVGIGFAIPSNMARTLAQQLIDFGEIKRGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPXXX
HTRA_LACHE      QSSDGTSVGMAFAIPSNEVVTIVNELVKKGKITRPQLGVRVQGIPEGYRSRLKIKSKNGIYIAFVSRNGS
DEGS_HAEIN      IGKTANEIGLNFAIPIDIANDVLRKIMRDGRVIRGYFGVQ---------SDISSSSEEGIVITDVSPNSP
YVTA_BACSU      VSESGVE-SLGFAIPSNDVEPIVDQLLQNGKVDRPFLGVQMIDMSPETENTLGLQLGKGVYVKEVQANSP
DEGS_ECOLI      FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXAPLHAQGGGIDQLQGIVVNEVSPDGP
DEGS_ECO57      FDKSNDGEGIGFAIPFQLATKIMDKLXXXXXXXXXXXXXXXXXXAPLHAQGGGIDQLQGIVVNEVSPDGP
HTRA3_HUMAN     V-----TAGISFAIPSDRITRFLTEFQDKKDWKKRFIGIRMRTITPSLVDELKASNPDGIYVQEVAPNSP
DGP14_ARATH     VLAAD---GLGFSVPIDSVSKIIEHFKKSGRVIRPWIGLKMVELNNLIVAQLKERDPRGVLVPTVIPGSP
DEGP8_ARATH     FTQTGTSAGVGFAIPSSTVLKIVPQLIQFSKVLRAGINIELAP--DPVANQLNVR--NGALVLQVPGKSL
HTRA1_HUMAN     V-----TAGISFAIPSDKIKKFLRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDGAYIIEVIPDTP
HTRA1_MOUSE     V-----TAGISFAIPSDKIKKFLRQAKGKAVTKKKYIGIRMMSLTSSKAKELKDRHRDGAYIIEVIPDTP
HTRA3_MOUSE     V-----AAGISFAIPSDRITRFLSEFQNKKDWKKRFIGIRMRTITPSLVEELKAANPDGIYVQEVVPNSP
HTRA4_HUMAN     VTD-----GISFAIPSDRVRQFLHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDGVYVCKVVEGTA
YYXA_BACSU      IAESAVE-GIGLSIPSKLVIPVIEDLERYGKVKRPFLGIEMKSLS-DIAETLKLPKTNGAVVMGVDAFSP
HTRA_BACSU      ISEDDVE-GIGFAIPSNDVKPIAEELLSKGQIERPYIGVSMQNYQEGTLGLFGSQLNKGVYIREVASGSP
HTRA_LACLA      TTTEDGSTGLGFAIPSNDVVNIINKLEADGKISRPALGIRMVDLSQSTNDSSQLKLPXXXXXXXXXXXXP
HTRA2_BOVIN     VTS-----GISFAIPSDRLREFLHRGEKKNSSQRRYIGVMMLTLTPSILAELQLREPSGVLIHKVILDSP
HTRA2_HUMAN     V-----TAGISFAIPSDRLREFLHRGEKKNSSSRRYIGVMMLTLSPSILAELQLREPSGVLIHKVILGSP
HTRA2_MOUSE     V-----TAGISFAIPSDRLREFLHRGEKKNSSQRRYIGVMMLTLTPSILIELQLREPSGVLIHKVILGSP
HTRA2_DROPS     V-----TAGISFAIPIDYVKVFLEERRKKGSAHKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROWI     V-----TAGISFAIPIDYVKVFLERAAERGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROPE     V-----TAGISFAIPIDYVKVFLEERRKKGSAHKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROYA     V-----TAGISFAIPIDYVKVFLERAAEKGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROGR     V-----TAGISFAIPIDYVKLFLERARKKGSAVKRYMGITMLTLTPDILFELKSRTQNGVLVWKVIVGSP
HTRA2_DROER     V-----TAGISFAIPIDYVKVFLERAAEKGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROSI     V-----TAGISFAIPIDYVKVFLERAAEKGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROSE     V-----TAGISFAIPIDYVKVFLERAAEKGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROME     V-----TAGISFAIPIDYVKVFLERAAEKGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRA2_DROMO     V-----TAGISFAIPIDYVKVFLERARKKGSAVKRYMGITMLTLTPDILFELKSRTQNGVLVWKVIVGSP
HTRA2_DROVI     V-----TAGISFAIPIDYVKVFLERARRKGSAVKRYMGITMLTLTPDILFELKSRTQNGVLVWKVIVGSP
HTRAL_STAS1     KIDMDHVEGIAFAIPVNDAESIAKQLEAKGEVKYPNTGIKIANVKDDEATHQSLNLPEGVVIGDVKDNSL
HTRAL_STAHJ     NMPN--IEGMGFAIPIDAAREIAEELEKKGEIQYPNTGIGIKNVSDLMPYERNLLKQNGIVVEKLKENGL
HTRA2_DROAN     V-----TAGISFAIPIDYVKVFLXXXXKTGYPVKRYMGITMLTLTPDILFELKSRSQNGVLVWKVIVGSP
HTRAL_STAES     KIDMHNVEGMAFAIPINDVRKIAKELEHKGKVNYPNTEIKIKNVSERNAINLPAKVNHGVLIGEVKENXX
HTRAL_STAEQ     KIDMHNVEGMAFAIPINDVRKIAKELEHKGKVNYPNTEIKIKNVSERNAINLPAKVNHGVLIGEVKENXX
HTRAL_STAAW     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAAS     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAAN     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAAM     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAAC     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAA8     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNVSLNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAA3     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
HTRAL_STAAR     ISMPNVE-NMSFAIPVNEVQKIVKELETKGKIDYPDVGVKMKNIAERQAXXXXXXXXXXXXXXXXXXXXL
HTRAL_STAAB     ISMPNVE-NMSFAIPVNEVQKIVKDLETKGKIDYPDVGVKMKNIASNSFERQAVKLPXXXXXXXXXXXXX
DEGP5_ARATH     FTGSGMSSGVNFAIPIDTVVRTVPYLIVYGTAYR------------------------------------
DEGP2_ARATH     YR-SEETENIGYVIPTTVVSHFLTDYERNGKYT-GYLGVLLQKLNPALRECLKVPTNEGVLVRRVEPTSD
Y4BJ_RHISN      ----------------------------------------------------------------------
DEGP3_ARATH     YSDS-----IGYIIPTPVIRHFLNAIEESGDVSFGSINLTYQKMDNDRKDFKMSDKMTGILINKINPLSD
DEGP9_ARATH     LKHEDAE-NIGYVIPTPVIVHFIQDY-EKHDKYTGFLGIEWQKMNPDLRKSMGMESQKGVRIRRIEPTAP
DGP10_ARATH     FQNLSGAENIGYIIPTPVIKHFINGVEECGKIGFCSMGVSCQPMNGELRSGFQMSEMTGVLVSKINPLSD
NM111_PICGU     ---AGGSTEASFFLPVYRPLRALQCIQQGQTITRGDIQVQLKPLTPEAEAAARSQFPDGLLVAEVLPEGP
NM111_CANGA     ---AGGSTEASFFLPLDRILRALKCIQADQPITRGTIQTQLKPLTPEHESTSRALFPDGLLVAETILREG
DGP13_ARATH     FQTLGHSNNIGCLIPAPVVKHFITGVEKTGQVGFCSLNLSYQHMDAQTRSHFKMSEMTGILIYNINQHSD
NM111_YARLI     ALQAGGSTDASFFLPLNRGKRALECILRGDKVTRGTIQTHWMLKPFDECRRLGLSASNGMLVAETVPEGP
NHRF3_RAT       ------------------------------------------------------KDTDGHLVRVIEEGSP
NHRF3_RABIT     ------------------------------------------------------KDTEGHLVRVIEKGSP
NM111_ASPTN     ---GGRADGAAYFLPLDRPLRALNCIRRGEPVTRGTIQTQLKPLTPEWEAKVRKAAPTSMLVAEILPEGP
NM111_ASPOR     ---GGRADGAAYFLPLDRPLRALECIRRGEPVTRGTIQTQLKPLTPEWEATVRKAAPTSMLVAEILPEGP
NHRF3_BOVIN     ------------------------------------------------------KDTDGHLVRVIEKGSP
NM111_AJECN     ---GGRADGAAYFLPLDRPLRALECIRKGVPVTRGTIQTQIKPLSPEAAVRKGSPKETGMLVAEVLPEGP
NHRF3_HUMAN     ------------------------------------------------------KDTEGHLVRVVEKCSP
NM111_ASPNC     ---GGRADGAAYFLPLDRPLRALECIRRGEPVTRGTIQTQLKPLTPEWEATVRKAAPTSMLVAEILPEGP
NM111_LODEL     ---AGGSTEASFFLPVSRPKRALQCIQKGLPITRGDIQVQLKPFTAEAEAEARKMFPDGMLVAEVLPEGP
NHRF3_MOUSE     ------------------------------------------------------KDTDGHLIRVIEEGSP
NM111_NEOFI     ---GGRADGAAYFLPLDRPLRALECIRRGEPVARGTIQTQLKPLTPEWEAAVRKASPTSMLVAEILPEGP
RASP_BACSK      -------------------------------------------------------------------NSP
PDZ1P_HUMAN     ----------------------------------------------------------GVYMTDITPQGV
CTPAL_STAHJ     ------------------------------------------------------KKDKQIMITSPMKDSP
NHRF4_HUMAN     -----------------------------------------------LREEKGLDGRPGQFLWEVDPGLP
NHRF3_PONAB     ------------------------------------------------------KDTEGHLVRVVEKGSP
NM111_ASPCL     ---GGRADGAAYFLPLDRPLRALQCIQRGEPVTRGTIQTQLKPLTPEAAVRKAAPQETSMLVAEILPEGP
NM111_ASPFU     ---GGRADGAAYFLPLDRPLRALECIRRGEPVTRGTIQTQLKPLTPEWEAAVRKASPTSMLVAEILPEGP
NM111_ASHGO     ---AGGSTEASFFLPLDRILRALRCIQGSQPITRGTIQTQLKPLSPESEAKAREQFPGGLLVAETLREGP
DEGP4_ARATH     KDPSADNIG--YIIPTPVIKHFLTAVEENG----------------------------------------
NM111_PHANO     ----GRADGAAYFLPLDRPLRALELVRRGEAVTRGTVQTQWILKPFDECRRLGLSKETGMLVAEVVPQGP
RASP_GEOKA      ---------------------------------------------------------DKPVIGELTPEGA
DGP11_ARATH     YE-------IGFVIPTPIIKHFITSVQESRQYSFGSLDLSYQSLNVQIRNHFKMSHEMTGILINKINSSS
Y638_RHILO      ------------------------------------------------------------MVAEVTADSP
NM111_KLULA     QAGGSSEASTDFFLPLDRVVRALQCVQTDKPITRGTIQTQWVLKPFDECRRLGLSEDTGLLVAEAILREG
Y3649_PSEAE     ---------------------------------------------PDPIASLGIRPWRPALLAELDPKGP
Y1380_AGRT5     ------------------------------------------------------------VVAEVRENSA
Y2128_LACLA     -------------------------------------------------------------IGQVEKGTP
NM111_COCIM     ---GGRADGAAYFLPLDRPLRALQCIQKGELVSRGTIQTQIKPLSPEWEAEVRAPKETGMLVAEVLPEGP
USH1C_MOUSE     ----------------------------------------------------GLEFGCGLFISHLIKGGQ
RSEP_SALTY      ------------------------QRQDKTLDLRHWA---FEPDKQDPVSSLGIR-PRGPVLSEVQANSA
RSEP_SALTI      ------------------------QRQDKTLDLRHWA---FEPDKQDPVSSLGIR-PRGPVLSEVQANSA
SCRIB_HUMAN     ----------------------------------GPLGLSIVGGSDHSSHPFGVQEP-GVFISKVLPRGL
CTPAL_STAAW     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAS     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAR     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAN     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAM     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAC     ------------------------------------------------------KKNDQIMVTSPMKGSP
CTPAL_STAAB     ------------------------------------------------------KKNDQIMVTSPMKGSP
Y829_BRUME      ------------------------------------------------------------LIAGVQPGSP
Y1156_BRUSU     ------------------------------------------------------------LIAGVQPGSP
Y1355_LISIN     ----------------------------------------VQGGVPSTDNTLGNIMPDGA----------
CTPAL_STAS1     ------------------------------------------------------KKGNQIQITSPMKQSP
Y1689_STRP3     -----------------------------------------------------------------QENGA
RSEP_ECOLI      -----------------------------------------EPDKEDPVSSLGIR-PRGPQI-EPQPNSA
RSEP_ECO57      -----------------------------------------EPDKEDPVSSLGIR-PRGPQI-EPQPNSA
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      ----------------------------------------VQAVMHRLSSKLDLSKTLGAVLAEFKPVNP
Y2869_MYCTU     --------------------------------------------------------------------GP
Y183_NEIMB      -------------------------------------------------------------VGTVEPDTI
Y1318_LISMO     ----------------------------------------VQGGVPSTDNTLGNVLPDGA----------
Y084_NEIMA      -------------------------------------------------------------VGTVEPDTI
F_BPPHM         YDPQGTLIADLSSATAATINQLRQAM--------------------------------------------
Y890_THEMA      -------------------------------------------------------------IDEVVPGSP
Y2031_STRP8     -----------------------------------------------------------------QENGA
Y1963_STRP1     -----------------------------------------------------------------QENGA
Y1682_STRP6     -----------------------------------------------------------------QENGA
SCRIB_MOUSE     ----------------------------------GPLGLSIVGGSDHSSHPFGVQDP-GVFISKVLPRGL
LAP4_DROME      --------------------------------NQGSLGFSIIGGTDHSCVPFGTREP-GIFISHIVPGGI
EEP_ENTFA       ------------------------------------------------------------------PNGP
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AAKAGIESGDVITAVNGTPVKDARELARTIGGFAPGNTVKLTVVHKGADRELNLTLGQLPNQVEAKVXXX
DEGP_BRUME      AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMPN--DKGKSGS
DEGP_BRUSU      AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMPN--DKGKSGS
DEGP_BRUAB      AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMPN--DKGKSGS
DEGP_BRUA2      AAKAGIKAGDVITAVNGETVQDPRDLARKVANIAPGEKAALTVWRKNKAEEINVTIAAMPN--DKGKSGS
DEGP_RHIME      GEKAGIKNGDVVTALNGEPVKDPRDLARRVAALRPGSTAEVTLWRSGKSETVNLEIGTLPSDAKEPAPAT
DEGP_BARHE      XXXXXXXXXDVIISVNGEKINDVRDLAKRIANMSPGETVTLGVWKSGKEENIKVKLDSMPEDENMKDGSK
HTOA_HAEIN      AEKAGLKAGDIITAMNGQKISSFAEIRAKIATTGAGKEISLTYLRDGKSHDVKMKLADDSSQLSSK----
DEGP_SALTY      AAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKISLGLLREGKAITVNLEL--------XXXXXX
DEGP_ECOLI      AAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELXXXXXXXXXXXXIF
DEGP_ECO57      AAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELXXXXXXXXXXXXIF
DEGP_RICCN      GDKAGIKTGDIIIEFADIPVKNTKKLRVIIADAPIDQEVKVKILRDKKELELPIKITSDNEEVSXXXXXX
DEGP_CHLMU      AEKAGLRQEDVIVAYNGKEVESLSALRNAISLMMPGTRVVLKVVREGKFIEIPVTVTQIPAE--------
DEGP_CHLPN      ADKAGLKQEDVIIAYNGKEVDSLSMFRNAVSLMNPDTRIVLKVVREGKVIEIPVTVSQAPKEDGMSALQR
DEGP_CHLTR      AEKAGLRQEDVIVAYNGKEVESLSALRNAISLMMPGTRVVLKIVREGKTIEIPVTVTQIPTEDGVSALQK
DEGP_BUCAI      AFEAGIKAGDIIISLNRKPISSFSSLRAEIGSLPVATKMELGVFREG--RIKNITV-ELKHSVKHNL---
DEGP_BUCAP      AFHAGIKAGDIIVSLNKKTISSFAALRAEVGSLPVSTKMELGIFRNGITKNVIVELPSLKNSVSLGDIY-
DEGP_RICPR      XXXXXXXXXXXXXXXXDRLVKNTKKLRVIIADTPINQEVKLKILRDAQELELPIKVTADNEEVSTEETNK
DEGP_BUCBP      ADVSGIKPGDVIILLNRKPIASFATLRAEIASFPIKTKIELGILR---NKKVKFIIVELKQKIQSKI---
Y938_SYNP6      AATAGLRRGDVVIATDGQAVTTADEFQRRVEASQVGQSLNLSVIRDGNRQQIAVRTGEL-----------
DEGP1_ARATH     AGKAGLQSGDIITSVNGTKVSNGSDLYRILDQCKVGDEVTVEVLRGDHKEKISVTLEPKPDE--------
DEGQ_ECOLI      XXXXXXXXXDIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDXXXXXXXXXEMI-
HTRA_LACHE      AANAGIKSGDVITKVDGKKVEDVASLHSILYSHKVGDTVNVTVNRNGKDVDMKVKL--------------
DEGS_HAEIN      AAKSGIQVGDVILKLNNQEGISAREMMQIIANTKPNSKVLVTILRLGKILQIPVVIEEFP----------
YVTA_BACSU      AEKAGIKSEDVIVKLNGKDVESSADIRQILKDLKVGDKTTIQVLRKGKTKTLNATL--------------
DEGS_ECOLI      AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
DEGS_ECO57      AANAGIQVNDLIISVDNKPAISALETMDQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYP----------
HTRA3_HUMAN     SQRGGIQDGDIIVKVNGRPLVDSSELQEAV----------------------------------------
DGP14_ARATH     ADRAGFKPGDVVVRFDGKPV--------------------------------------------------
DEGP8_ARATH     AEKAGLHPGDIIVAVDDKPVKNKAELMKILDEYSVGDKVTLKIKRGNEDLELKISL--------------
HTRA1_HUMAN     AEAGGLKENDVIISINGQSVVSANDVSDVI----------------------------------------
HTRA1_MOUSE     AEAGGLKENDVIISINGQSVVTANDVSDVI---KKENTLNM-VVRRGNE---DIVITVIPEEID------
HTRA3_MOUSE     SQRGGIQDGDIIVKVNGRPLADSSELQEAV----------------------------------------
HTRA4_HUMAN     AQSSGLRDHDVIVNINGKPITTTTDVVKAL----DSDSLSMAVL-RGKD---NLLLTVIPETI-------
YYXA_BACSU      AGKAGLKELDVITEFDGYKVNDIVDLRKRLYQKKVGDRVKVKFYRGGKEKSVDIKL--------------
HTRA_BACSU      AEKAGLKAEDIIIGLKGKEIDTGSELRNILYKDAKGDTVEVKILRNGKEMTKKIKLDQ------------
HTRA_LACLA      AASAGLKAGDVITKVGDTAVTSSTDLQSALYSHNINDTVKVTYYRDG-----------------------
HTRA2_BOVIN     AHRAGLRPGDVILAIGEQLVQNAEDIYEAV----------------------------------------
HTRA2_HUMAN     AHRAGLRPGDVILAIGEQMVQNAEDVYEAV----------------------------------------
HTRA2_MOUSE     AHRAGLRPGDVILAIGEKLAQNAEDVYEAV----------------------------------------
HTRA2_DROPS     AHSGGLQPGDIVTHINKKEIKNSSDV--------------------------------------------
HTRA2_DROWI     AHSGGLQPGDIVTHINKKEIKNSSDVYDALG---------------------------------------
HTRA2_DROPE     AHSGGLQPGDIVTHINKKEIKNSSDV--------------------------------------------
HTRA2_DROYA     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKNLDIVILRGVKQMHVTI--------------
HTRA2_DROGR     AHSGGLQPGDIVTHINKKEIKNSSDV--------------------------------------------
HTRA2_DROER     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKNLDIVILRGVKQMHVTI--------------
HTRA2_DROSI     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKTLDIVILRGVKQMHVTI--------------
HTRA2_DROSE     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKTLDIVILRGVKQMHVTI--------------
HTRA2_DROME     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKTLDIVILRGVKQMHVTI--------------
HTRA2_DROMO     AHSGGLQPGDIVTHINKKEIKNSSDV--------------------------------------------
HTRA2_DROVI     AHSGGLQPGDIVTHINKKEIKNSSDV--------------------------------------------
HTRAL_STAS1     GEKSGLQKNDVIVELDGKEVEDNLRYRQIIFSHKDDDTLPAKIYRDGKEQDIKIKL--------------
HTRAL_STAHJ     GKKSGLKIGDVVVELDSKSIQNNLQYRQIIFNHRQDKTLSAKIYREGKSQEIRIKL--------------
HTRA2_DROAN     AHSGGLQPGDIVTHINKKEIKNSSDVYDALA----DNSKHLDIVILRGVKQMHVTI--------------
HTRAL_STAES     XXXXXXXXXXVIVELDGKKIEDNLRYRQVISHYDDQKTITAKIYRNGAEKNIKIKL--------------
HTRAL_STAEQ     XXXXXXXXXXVIVELDGKKIEDNLRYRQVISHYDDQKTITAKIYRNGAEKNIKIKL--------------
HTRAL_STAAW     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAS     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAN     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAM     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAC     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAA8     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAA3     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAR     ADQSGLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
HTRAL_STAAB     ADQSSLKKGDVITELDGKLLEDDLRFRQIIFSHKDDKSITAKIYRDGKEKEINIKL--------------
DEGP5_ARATH     ----------------------------------------------------------------------
DEGP2_ARATH     ASKV-LKEGDVIVSFDGTPFRSSERIAYLISQKFAGDIAEIGIIRAGEHKKVQVVL--------------
Y4BJ_RHISN      ----------------------------------------------------------------------
DEGP3_ARATH     VHKV-LKKDDIILAIDGVPIKERITFKHLVSMKKPCETALLKVLREGKEYEFNSSLKSVP----------
DEGP9_ARATH     ESQV-LKPSDIILSFDGVNI--------------------------------------------------
DGP10_ARATH     AHKI-LKKDDVLLAFDGVPIRERITFDHLVSMKKPDETALVKVLREGKEHEFSITLRPL-----------
NM111_PICGU     A-DGKLKEGDTLISINGTPIASFISVDEILDE-QVGQSLKFVIQRNGHEVSFDIVVGDL-----------
NM111_CANGA     PSDGKIKEGDILIAINGQRISTFIQVDDILDSNV-GNNVEFTVQRGGTDINVTCTIGDL-----------
DGP13_ARATH     ALNI-LKKYDVILSIDGVPNRERTRLDDLVSLKQLGETILLKILREGKMHEFNITLRPVQRLVPA-----
NM111_YARLI     SAVAATE-GDILLSVNSTPISSFITL-DSILDEAVGDIVKVTVERNGAE---------------------
NHRF3_RAT       AEKAGLLDGDRVLRINGVFV-DKEEHAQVVDLVRKGNSVTLLVLEKAVKHQVDLKLDQSPREPALNEKKP
NHRF3_RABIT     AEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNAVTLLVLEKAVKKQVDLKLGQSRQEADLRDENV
NM111_ASPTN     -ADGKLEEGDVLLQVNGELLTQFIRLDDILDS-SVGKTVRLLVQRGGQNVELECEVGDL-----------
NM111_ASPOR     -ADGKLEEGDVLLQVNGELLTQFIRLDDILDS-SVGQTVRLLVQRGGQDVEIECQVGDL-----------
NHRF3_BOVIN     AEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNSVTLLVLEKAMKKQVDLALGQSPSLNDKKAPSV
NM111_AJECN     -GDGKLQEGDVLIKVNGELLTQFVKLDAILDS-SVGKDVHLLVQRGGEDLEVSCTVGDL-----------
NHRF3_HUMAN     AEKAGLQDGDRVLRINGVFVDKEEHMQVVDLVRKSGNSVTLLVLEKAVKTRVDLKLGQSQKEQGLSDNIL
NM111_ASPNC     -ADGKLEEGDVLLQVNGVLLTQFIRLDDILDS-SVGQTVRLLVQRGGQNVEIECQVGDL-----------
NM111_LODEL     -ADGLIKEGDTLISIQG-----------------------------------------------------
NHRF3_MOUSE     AEKAGLLDGDRVLRINGVFV-DKEEHAQVVELVRKGNSVTLLVLEKAVKNQVDLKLDQSQREAALNDKKP
NM111_NEOFI     -ADGKLEEGDVLLQVNGELLTQFIRLDDILDS-SVGKTVRLLVQRGGQNVEVECEVGDL-----------
RASP_BACSK      AEAAGLQDGDVITAVNGVEVDSWKEMTTEVKKY-PGEEVSIDYERNGEALQTNATLSQMPDEYE------
PDZ1P_HUMAN     AMRAGVLADDHLIEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDRHVEQKIQFKRETASLKLLPH
CTPAL_STAHJ     AEKAGIQPKDVVTKVDGKSVKPLDQVVKLVRG-KEGTTVKLTIKRGSQEKEIKIKRGKI-----------
NHRF4_HUMAN     AKKAGMQAGDRLVAVAGESVEGLEETVSRIQG--QGSCVSLTVVDPEADRFFSMVLLFLENTEXXXXXXX
NHRF3_PONAB     AEKAGLQDGDRVLRINDVFVDKEEHMQVVDLVRKSGNSVTLLVLEKAVKTRVDLKLGQRQKEQGLSDNTL
NM111_ASPCL     -ADGKLEEGDVLLQVNGELLTQFIRLDDILDS-SVGKPVRLLVQRGGQNVEVECEVGDL-----------
NM111_ASPFU     -ADGKLEEGDVLLQVNGELLTQFIRLDDILDS-SVGKTVRLLVQRGGQNVEVECEVGDL-----------
NM111_ASHGO     ADKS-IKEGDILISINGQMICSFIQVDAILDENV-GKPITLVVQRSGIDITVECTVGDL-----------
DEGP4_ARATH     ----------------------------------------------------------------------
NM111_PHANO     ASTK-VEEGDILIKVNGEFITQFVRLDSILDDNV-GKTISVTIQRAGENLEVELDVGNL-----------
RASP_GEOKA      ARAAGLKQGDKVIAINGERMETWTEIVNTIRAH-PGEPLQFQIERNGKERSVTVT-------PEAKT---
DGP11_ARATH     GAYKILRKDDIILAIDGVPIKRRIDFSYLVSMKKPGEKALVKVLRNGKEYEYNISL--------------
Y638_RHILO      AAKAGIQPGDRFVSVDGSKVETFGDVQRLVSGRA-GDTITFVMLRDGKEVTVTAT-PQLMEQQDA-----
NM111_KLULA     PAYNKVQEGDTLISINGTPICSFIQVDNILDS-SVGDEIIIVVQRGSKDISFRCTVGDL-----------
Y3649_PSEAE     AQAAGLKLGDRLQSIDGIAVDDWQQVVDSVRA-RPGQRVQLKVLRDGEVLDVALEL--------------
Y1380_AGRT5     AATAGVKPGDRLVAIDGEKVMTFEDVRRYV-GIRPGTPITVTVERAGEELKLPMTTDQFGNKLE------
Y2128_LACLA     AYNAGLKAGDKIEAVNGTKTADWNNVVTEISG-SKGKELKLEVSRSGKSETLSVT---------------
NM111_COCIM     -GDGKLQEGDVLIKANGELLTQFVRLDDILDS-SVGGDVHLLVQRGGEDLEVTCKVQDL-----------
USH1C_MOUSE     ADSVGLQVGDEIVRINGYSISSCTH-EEVINLIRTKKTVSIKVRHIGSSPEESLKWQYVDQFVXXXXXXX
RSEP_SALTY      ASKAGLQAGDRIVKVDGQPLTQWMKFV-TFVRDNPGKPLALEIERQGSALSLTLT---------------
RSEP_SALTI      ASKAGLQAGDRIVKVDGQPLTQWMKFV-TFVRDNPGKPLALEIERQGSALSLTLT---------------
SCRIB_HUMAN     AARSGLRVGDRILAVNGQDVRDA-----------------------------------------------
CTPAL_STAAW     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAS     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAR     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAN     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAM     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAC     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
CTPAL_STAAB     AERAGIRPKDVITKVNGKSIKGKAEVVKDVRG--KENTEVTLTVQRGSEEK-------------------
Y829_BRUME      AAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRA-GDKLNFTVERDG-----------------------
Y1156_BRUSU     AAEAGFEPGDRFVSVEGEKITTFADVQRIVSGRA-GDKLNFTVERDG-----------------------
Y1355_LISIN     AAQAGLEKGDEVLSINGKETKSWTDIVQSVSE-NPGKTLDFKIDRDGKTQDIDV----------------
CTPAL_STAS1     AEKAGIQPKDVVTKVNGKSIKPLEAIVKKVRG-KQGTKVTLTIERGGQAHDITI----------------
Y1689_STRP3     AAKAGLRDNDQIVAINGYKVNSWNDLTEAVNDLGPSQTIKVT----------------------------
RSEP_ECOLI      ASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRD-NPGKSLALEIERQGSPLSLTLIPESKPGNGKA-----
RSEP_ECO57      ASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRD-NPGKSLALEIERQGSPLSLTLIPESKPGNGKA-----
RPGF6_HUMAN     ----------------------------------------------------------------------
ILVD_METTP      KANA-----EVIATLE-RPVHPEGGIAILKGSLAPGSVVKQTLVHKGPDSEEESMKGILSGEVKA--GDV
Y2869_MYCTU     AALAGIRSGDVVVKVGDTPVSSFDEMAAAV----------------------------------------
Y183_NEIMB      AARAGFQSGDKIQSVNGTPVAD------------------------------------------------
Y1318_LISMO     AAEAGLKKGDEVLSINGKETKSWTDIVQNVSE-NPGKTLDFKIERDGKTQDIDV----------------
Y084_NEIMA      AARAGFQSGDKIQSVNGTPVAD------------------------------------------------
F_BPPHM         ----------------------------------------------------------------------
Y890_THEMA      AEEAGLRRGDIIYSINDKIAFDTSIISNEI---QKGLPVELVIIRNGEKKSLRLTPRMYPETYE------
Y2031_STRP8     AAKAGLRDNDQIVAINGYKVTSWNDLTEAVDDLGPSQTIKVT----------------------------
Y1963_STRP1     AAKAGLRDNDQIVAINGYKVTSWNDLTEAVDDLGPSQTIKVT----------------------------
Y1682_STRP6     AAKAGLRDNDQIVAINGYKVTSWNDLTEAVDDLGPSQTIKVT----------------------------
SCRIB_MOUSE     AARCGLRVGDRILAVNGQDVREA-----------------------------------------------
LAP4_DROME      ASKCGLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQH-------------------------
EEP_ENTFA       AAEAGLKENDKVLSINNQKIKKYEDFT-TIVQKNPEKPLTFVVERNGKEEQLTVT---------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXRGTEVPRLGLTVAPASSVAGAGKDGVVVTDVDPKSAAADRGFKEGDVILEVAGKNVASPGDV
DEGP_BRUME      QSNDNDGGQGETLDSYGLTVVPSED----GK-GVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDI
DEGP_BRUSU      QSNDNDGGQGETLDSYGLTVVPSED----GK-GVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDI
DEGP_BRUAB      QSNDNDGGQGETLDSYGLTVVPSED----GK-GVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDI
DEGP_BRUA2      QSNDNDGGQGETLDSYGLTVVPSED----GK-GVVVTDVDPDSDAADRGIRSGDVIVSVNNQTVKTAGDI
DEGP_RHIME      GEAQPDEGQAGELADLGLTVTPSED----GK-GVTIASVDPDSDAGDRGLKEGEKIVSVNNQEVKSADDV
DEGP_BARHE      YSNEHGNSDET-LEDYGLIVAPS-----XXXXXXXXXXXXXXSDAADKGIRPGDVIVTXXXXXXXXXXDI
HTOA_HAEIN      ----------TELP--ALDGATLKDYDAKGVKGIEITKIQPNSLAAQRGLKSGDIII---GINRQMIENI
DEGP_SALTY      XXXXXTIFSGIE----------GAEMSNKGQDGVVVSSVKANSPAAQIGLKKGDVIIGANQQPVKNIAEL
DEGP_ECOLI      --------NGIE----------GAEMSNKGKDGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
DEGP_ECO57      --------NGIE----------GAEMSNKGKDGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAEL
DEGP_RICCN      XXXXXXXXXXLSITKNNITFGNLTETIPQDKMGIVITNIDEEESS----FKIGDLITNINQKSIDDISKL
DEGP_CHLMU      DGVSALQKMGVRVQNLTPEICKKLGLASDTR-GIFVVSVEAGSPAASAGVVPGQLILAVNRQRVSSVEEL
DEGP_CHLPN      VGIRVQNLTPETAKKLG--IAPETK-------GILIISVEPGSVAASSGIAPGQLILAVNRQKVSSIEDL
DEGP_CHLTR      MGVRVQNITPEICKKLGL---------AADTRGILXXXXXXXXXXXXXXXXXXQLILAVNRQRVASVEEL
DEGP_BUCAI      ---------NSENDYIGIEGVDLSDYIFNEQKVIKVDNVKPHTPASKIGFKKDDIILNVNQKLISNVDEL
DEGP_BUCAP      ---------------TGIEGADLSDCSLNGQKGVKIENIKLNTQASKIGFKKDDIIVEVNQK--------
DEGP_RICPR      AVIINKKENNLSITKNNITFSNLTEEIPQDKTGIVIINIDEEESV----FKLGDLITNINHDSIDDIRKL
DEGP_BUCBP      ---------DSSVLCKLISGASLSNFRIHGQNGICVNYVNNGTPAYRTGLRKNDIIFEVNKYQVSSLSNF
Y938_SYNP6      ----------------------------------------------------------------------
DEGP1_ARATH     ----------------------------------------------------------------------
DEGQ_ECOLI      ------------TPALEGATLSDGQLKDGGK-GIKIDEVVKGSPAAQAGLQKDDVIIGVNRDRVNSIAEM
HTRA_LACHE      ----------------------------------------------------------------------
DEGS_HAEIN      ----------------------------------------------------------------------
YVTA_BACSU      ----------------------------------------------------------------------
DEGS_ECOLI      ----------------------------------------------------------------------
DEGS_ECO57      ----------------------------------------------------------------------
HTRA3_HUMAN     ----------------------------------------------------------------------
DGP14_ARATH     ----------------------------------------------------------------------
DEGP8_ARATH     ----------------------------------------------------------------------
HTRA1_HUMAN     ----------------------------------------------------------------------
HTRA1_MOUSE     ----------------------------------------------------------------------
HTRA3_MOUSE     ----------------------------------------------------------------------
HTRA4_HUMAN     ----------------------------------------------------------------------
YYXA_BACSU      ----------------------------------------------------------------------
HTRA_BACSU      ----------------------------------------------------------------------
HTRA_LACLA      ----------------------------------------------------------------------
HTRA2_BOVIN     ----------------------------------------------------------------------
HTRA2_HUMAN     ----------------------------------------------------------------------
HTRA2_MOUSE     ----------------------------------------------------------------------
HTRA2_DROPS     ----------------------------------------------------------------------
HTRA2_DROWI     ----------------------------------------------------------------------
HTRA2_DROPE     ----------------------------------------------------------------------
HTRA2_DROYA     ----------------------------------------------------------------------
HTRA2_DROGR     ----------------------------------------------------------------------
HTRA2_DROER     ----------------------------------------------------------------------
HTRA2_DROSI     ----------------------------------------------------------------------
HTRA2_DROSE     ----------------------------------------------------------------------
HTRA2_DROME     ----------------------------------------------------------------------
HTRA2_DROMO     ----------------------------------------------------------------------
HTRA2_DROVI     ----------------------------------------------------------------------
HTRAL_STAS1     ----------------------------------------------------------------------
HTRAL_STAHJ     ----------------------------------------------------------------------
HTRA2_DROAN     ----------------------------------------------------------------------
HTRAL_STAES     ----------------------------------------------------------------------
HTRAL_STAEQ     ----------------------------------------------------------------------
HTRAL_STAAW     ----------------------------------------------------------------------
HTRAL_STAAS     ----------------------------------------------------------------------
HTRAL_STAAN     ----------------------------------------------------------------------
HTRAL_STAAM     ----------------------------------------------------------------------
HTRAL_STAAC     ----------------------------------------------------------------------
HTRAL_STAA8     ----------------------------------------------------------------------
HTRAL_STAA3     ----------------------------------------------------------------------
HTRAL_STAAR     ----------------------------------------------------------------------
HTRAL_STAAB     ----------------------------------------------------------------------
DEGP5_ARATH     ----------------------------------------------------------------------
DEGP2_ARATH     ----------------------------------------------------------------------
Y4BJ_RHISN      ----------------------------------------------------------------------
DEGP3_ARATH     ----------------------------------------------------------------------
DEGP9_ARATH     ----------------------------------------------------------------------
DGP10_ARATH     ----------------------------------------------------------------------
NM111_PICGU     ----------------------------------------------------------------------
NM111_CANGA     ----------------------------------------------------------------------
DGP13_ARATH     ----------------------------------------------------------------------
NM111_YARLI     ----------------------------------------------------------------------
NHRF3_RAT       DLGMNGGVETCAQPRLCYLVKEGNSFGFSGKKGVFLTDITPQGVAMKAGVLADDHLIEVNGENVASHEEV
NHRF3_RABIT     APVMNGGVETWTQPRLCYLEKQGNSYGFSGKKGVYMTDIIPQSVAMKAGVLADDHLIEVNGENVEDASHE
NM111_ASPTN     ----------------------------------------------------------------------
NM111_ASPOR     ----------------------------------------------------------------------
NHRF3_BOVIN     MNGGAQMWMQ---PRLCYLVKEGGSYGFSGKNGVYMTDIKPQGVAMKAGVLADDHLIEVNGENVASHEEV
NM111_AJECN     ----------------------------------------------------------------------
NHRF3_HUMAN     SPVMNGGVQTWTQPRLCYLVKEGGSYGFSGKKGVYMTDITPQGVAMRAGVLADDHLIEVNGENVEDASH-
NM111_ASPNC     ----------------------------------------------------------------------
NM111_LODEL     ----------------------------------------------------------------------
NHRF3_MOUSE     GPGMNGAVEPCAQPRLCYLVKEGNSFGFSGKKGVYLTDIMPQGVAMKAGVLADDHLIEVNGENVASHEEV
NM111_NEOFI     ----------------------------------------------------------------------
RASP_BACSK      ----------------------------------------------------------------------
PDZ1P_HUMAN     QPRIVEMKKGSN--GYGFYLRAGSEQKGWGRVGQIIKDIDSGSPAEEAGLKNNDLVVAVNG---------
CTPAL_STAHJ     ----------------------------------------------------------------------
NHRF4_HUMAN     XXXXXLVE--TEDPSLEDTSVPSVPLGSASGPRLFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDL
NHRF3_PONAB     SPVMNGGVQTWTQPRLCYLVKEGGSYGFSGKKGVYMTDITPQGVAMKAGVLADDHLIEVNGENV------
NM111_ASPCL     ----------------------------------------------------------------------
NM111_ASPFU     ----------------------------------------------------------------------
NM111_ASHGO     ----------------------------------------------------------------------
DEGP4_ARATH     ----------------------------------------------------------------------
NM111_PHANO     ----------------------------------------------------------------------
RASP_GEOKA      -------VQGETIGLIGVYQPMEKSVLGSIKQGLVET---------------------------------
DGP11_ARATH     ----------------------------------------------------------------------
Y638_RHILO      ----------------------------------------------------------------------
NM111_KLULA     ----------------------------------------------------------------------
Y3649_PSEAE     ----------------------------------------------------------------------
Y1380_AGRT5     ----------------------------------------------------------------------
Y2128_LACLA     ----------------------------------------------------------------------
NM111_COCIM     ----------------------------------------------------------------------
USH1C_MOUSE     XXXXXXXNRTTKEKKVFISLVGSRSSGPIQKPGIFVSHVKPGSLSAEVGLETGDQIVEVNGIDFTNL-DH
RSEP_SALTY      ----------------------------------------------------------------------
RSEP_SALTI      ----------------------------------------------------------------------
SCRIB_HUMAN     ----------------------------------------------------------------------
CTPAL_STAAW     ----------------------------------------------------------------------
CTPAL_STAAS     ----------------------------------------------------------------------
CTPAL_STAAR     ----------------------------------------------------------------------
CTPAL_STAAN     ----------------------------------------------------------------------
CTPAL_STAAM     ----------------------------------------------------------------------
CTPAL_STAAC     ----------------------------------------------------------------------
CTPAL_STAAB     ----------------------------------------------------------------------
Y829_BRUME      ----------------------------------------------------------------------
Y1156_BRUSU     ----------------------------------------------------------------------
Y1355_LISIN     ----------------------------------------------------------------------
CTPAL_STAS1     ----------------------------------------------------------------------
Y1689_STRP3     ----------------------------------------------------------------------
RSEP_ECOLI      ----------------------------------------------------------------------
RSEP_ECO57      ----------------------------------------------------------------------
RPGF6_HUMAN     --------------------------------GIFVEGVEPGSEAADSGLKRGDQIMEVNGQN-------
ILVD_METTP      VVIRYEGPKGG--PGMRETLAPTSAIAGAGLSESVALITDGRFSGGTRGPCIGHVSPEAA----------
Y2869_MYCTU     ----------------------------------------------------------------------
Y183_NEIMB      ----------------------------------------------------------------------
Y1318_LISMO     ----------------------------------------------------------------------
Y084_NEIMA      ----------------------------------------------------------------------
F_BPPHM         ----------------------------------------------------------------------
Y890_THEMA      ----------------------------------------------------------------------
Y2031_STRP8     ----------------------------------------------------------------------
Y1963_STRP1     ----------------------------------------------------------------------
Y1682_STRP6     ----------------------------------------------------------------------
SCRIB_MOUSE     ----------------------------------------------------------------------
LAP4_DROME      ----------------------------------------------------------------------
EEP_ENTFA       ----------------------------------------------------------------------
DEGP1_ARATH     -------------PILGIKFAPDQSVEQLGVSGVLVLDAPPSGPAGKAGLQSGDIITSVNGTKVSNGSDL
DEGS_HAEIN      -----------------------SDISSSSEEGIVITDVSPNSPAAKSGIQVGDVILKLNNQEGISAREM
YVTA_BACSU      --------------------------------GVYVKEVQANSPAEKAGIKSEDVIVKLNGKDVESSADI
HTRA3_HUMAN     --------------------------------GIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSEL
HTRA3_MOUSE     ----------TITPSLVEELKAANPDFPAVSSGIYVQEVVPNSPSQRGGIQDGDIIVKVNGRPLADSSEL
YYXA_BACSU      -------------------------------NGAVVMGVDAFSPAGKAGLKELDVITEFDGYKVNDIVDL


                         *         .         .         .         .         +         .:560
query           REAINTAKADNKNSVLIRVRSGGSSRFVAVPISAKx
DEGP_BRUME      NKAITAAEKSGRKAVLLQLQSNDQSRFVALPIN---
DEGP_BRUSU      NKAITAAEKSGRKAVLLQLQSNDQSRFVALPIN---
DEGP_BRUAB      NKAITAAEKSGRKAVLLQLQSNDQSRFVALPIN---
DEGP_BRUA2      NKAITAAEKSGRKAVLLQLQSNDQSRFVALPIN---
DEGP_RHIME      LKVINNAKKDGRSKALFQIEAQEGSRFVALPIT---
DEGP_BARHE      TDTIKNAQKLGRKAILLQVRTNDQNRFVALPIFKK-
HTOA_HAEIN      RE-LNKVLETEPSAVALNILRGDSNFYLLV------
DEGP_SALTY      RKIL-----DSKPSVLLNIQRGDSSIYL--------
DEGP_ECOLI      RKVL-----DSKPSVLLNIQRGDSTIYL--------
DEGP_ECO57      RKVL-----DSKPSVLLNIQRGDSTIYL--------
DEGP_RICCN      EELYENAKKSDKKNILLLIERGSSNMFVPLQV----
DEGP_CHLMU      NQVLKNAKGEN---VLLMVSQGEVIRFVVL------
DEGP_CHLPN      N---RTLKDSNNENILLMVSQGDVIRFIAL------
DEGP_CHLTR      NQVLKNSKGEN---VLLMVSQGDVVRFIVL------
DEGP_BUCAI      KKFLHS------------------------------
DEGP_BUCAP      ------------------------------------
DEGP_RICPR      EVLYENAKKLEKQNILLLIERGDTSVFIPLSVS---
DEGP_BUCBP      QKVLKT------------------------------
Y938_SYNP6      ------------------------------------
DEGP1_ARATH     ------------------------------------
DEGQ_ECOLI      RKVL--------------------------------
HTRA_LACHE      ------------------------------------
DEGS_HAEIN      ------------------------------------
YVTA_BACSU      ------------------------------------
DEGS_ECOLI      ------------------------------------
DEGS_ECO57      ------------------------------------
HTRA3_HUMAN     ------------------------------------
DGP14_ARATH     ------------------------------------
DEGP8_ARATH     ------------------------------------
HTRA1_HUMAN     ------------------------------------
HTRA1_MOUSE     ------------------------------------
HTRA3_MOUSE     ------------------------------------
HTRA4_HUMAN     ------------------------------------
YYXA_BACSU      ------------------------------------
HTRA_BACSU      ------------------------------------
HTRA_LACLA      ------------------------------------
HTRA2_BOVIN     ------------------------------------
HTRA2_HUMAN     ------------------------------------
HTRA2_MOUSE     ------------------------------------
HTRA2_DROPS     ------------------------------------
HTRA2_DROWI     ------------------------------------
HTRA2_DROPE     ------------------------------------
HTRA2_DROYA     ------------------------------------
HTRA2_DROGR     ------------------------------------
HTRA2_DROER     ------------------------------------
HTRA2_DROSI     ------------------------------------
HTRA2_DROSE     ------------------------------------
HTRA2_DROME     ------------------------------------
HTRA2_DROMO     ------------------------------------
HTRA2_DROVI     ------------------------------------
HTRAL_STAS1     ------------------------------------
HTRAL_STAHJ     ------------------------------------
HTRA2_DROAN     ------------------------------------
HTRAL_STAES     ------------------------------------
HTRAL_STAEQ     ------------------------------------
HTRAL_STAAW     ------------------------------------
HTRAL_STAAS     ------------------------------------
HTRAL_STAAN     ------------------------------------
HTRAL_STAAM     ------------------------------------
HTRAL_STAAC     ------------------------------------
HTRAL_STAA8     ------------------------------------
HTRAL_STAA3     ------------------------------------
HTRAL_STAAR     ------------------------------------
HTRAL_STAAB     ------------------------------------
DEGP5_ARATH     ------------------------------------
DEGP2_ARATH     ------------------------------------
Y4BJ_RHISN      ------------------------------------
DEGP3_ARATH     ------------------------------------
DEGP9_ARATH     ------------------------------------
DGP10_ARATH     ------------------------------------
NM111_PICGU     ------------------------------------
NM111_CANGA     ------------------------------------
DGP13_ARATH     ------------------------------------
NM111_YARLI     ------------------------------------
NHRF3_RAT       VEKV--------------------------------
NHRF3_RABIT     EVVEKVKKSGNR------------------------
NM111_ASPTN     ------------------------------------
NM111_ASPOR     ------------------------------------
NHRF3_BOVIN     VEKV--------------------------------
NM111_AJECN     ------------------------------------
NHRF3_HUMAN     EEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFK-
NM111_ASPNC     ------------------------------------
NM111_LODEL     ------------------------------------
NHRF3_MOUSE     VEKV--------------------------------
NM111_NEOFI     ------------------------------------
RASP_BACSK      ------------------------------------
PDZ1P_HUMAN     -ESVETLDHD---SVVEMIRKGGDQTSLLV------
CTPAL_STAHJ     ------------------------------------
NHRF4_HUMAN     ERLQQLPEAEPPLCLKLAARS---------------
NHRF3_PONAB     ------------------------------------
NM111_ASPCL     ------------------------------------
NM111_ASPFU     ------------------------------------
NM111_ASHGO     ------------------------------------
DEGP4_ARATH     ------------------------------------
NM111_PHANO     ------------------------------------
RASP_GEOKA      ------------------------------------
DGP11_ARATH     ------------------------------------
Y638_RHILO      ------------------------------------
NM111_KLULA     ------------------------------------
Y3649_PSEAE     ------------------------------------
Y1380_AGRT5     ------------------------------------
Y2128_LACLA     ------------------------------------
NM111_COCIM     ------------------------------------
USH1C_MOUSE     KEAVNVLKSSRSLTISIVAGAG--------------
RSEP_SALTY      ------------------------------------
RSEP_SALTI      ------------------------------------
SCRIB_HUMAN     ------------------------------------
CTPAL_STAAW     ------------------------------------
CTPAL_STAAS     ------------------------------------
CTPAL_STAAR     ------------------------------------
CTPAL_STAAN     ------------------------------------
CTPAL_STAAM     ------------------------------------
CTPAL_STAAC     ------------------------------------
CTPAL_STAAB     ------------------------------------
Y829_BRUME      ------------------------------------
Y1156_BRUSU     ------------------------------------
Y1355_LISIN     ------------------------------------
CTPAL_STAS1     ------------------------------------
Y1689_STRP3     ------------------------------------
RSEP_ECOLI      ------------------------------------
RSEP_ECO57      ------------------------------------
RPGF6_HUMAN     ------------------------------------
ILVD_METTP      ------------------------------------
Y2869_MYCTU     ------------------------------------
Y183_NEIMB      ------------------------------------
Y1318_LISMO     ------------------------------------
Y084_NEIMA      ------------------------------------
F_BPPHM         ------------------------------------
Y890_THEMA      ------------------------------------
Y2031_STRP8     ------------------------------------
Y1963_STRP1     ------------------------------------
Y1682_STRP6     ------------------------------------
SCRIB_MOUSE     ------------------------------------
LAP4_DROME      ------------------------------------
EEP_ENTFA       ------------------------------------
DEGP1_ARATH     YRILDQCKVGDE--VTVEVLRGDHKEKISVTLEPK-
DEGS_HAEIN      MQIIANTKPNSKVLVTI-------------------
YVTA_BACSU      RQILKDLKVGDKTTIQV-------------------
HTRA3_HUMAN     QEAVLT-----ESPLLLEVRRGNDDLLFSI------
HTRA3_MOUSE     QEAVL-----NESSLLLEVRRGNDDLLFSI------
YYXA_BACSU      RKRLYQKKVGDR--VKVKFYRGGKEKSVDIKLSS--