[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39379.1

[Show Plain Result]


## Summary of Sequence Search
    1::1070
    1::1034      0.0  61% 1052 aa  HELA_LEGPN RecName: Full=Protein helA;
    1::1018      0.0  59% 1063 aa  CZCA_ALCSC RecName: Full=Cation efflux system protein czcA;
    1::1018      0.0  58% 1063 aa  CZCA_RALME RecName: Full=Cobalt-zinc-cadmium resistance protein
    1::1055      0.0  48% 1076 aa  NCCA_ALCXX RecName: Full=Nickel-cobalt-cadmium resistance protein
    1::1033      0.0  47% 1076 aa  CNRA_RALME RecName: Full=Nickel and cobalt resistance protein cnrA;
    1::1037    e-150  34% 1047 aa  CUSA_ECOL6 RecName: Full=Cation efflux system protein cusA;
    1::1035    e-150  34% 1045 aa  CUSA_ECO57 RecName: Full=Cation efflux system protein cusA;
    1::1037    e-150  34% 1047 aa  CUSA_ECOLI RecName: Full=Cation efflux system protein cusA;
    1::1037    e-144  32% 1048 aa  SILA_SALTY RecName: Full=Putative cation efflux system protein silA;
    3::993     3e-60  24% 1065 aa  NOLG_RHIME RecName: Full=Nodulation protein nolG;Flags: Precursor;
   25::1026    4e-45  25% 1052 aa  MDTB_YERPE RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    5e-45  25% 1052 aa  MDTB_YERPS RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    5e-45  24% 1040 aa  MDTB_SHISS RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    3e-44  23% 1040 aa  MDTB_ECOSE RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    4e-44  24% 1040 aa  MDTB_ECO5E RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    4e-44  24% 1040 aa  MDTB_ECO57 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    4e-44  24% 1040 aa  MDTB_ECO24 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    5e-44  24% 1040 aa  MDTB_ECO8A RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    5e-44  24% 1040 aa  MDTB_ECO7I RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    6e-44  24% 1040 aa  MDTB_SHIB3 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    8e-44  24% 1040 aa  MDTB_ECOL5 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1025    1e-43  24% 1039 aa  MDTB_SHIFL RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  23% 1040 aa  MDTB_SHIBS RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECOUT RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECOSM RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECOL6 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECOK1 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECO81 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECO55 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    1e-43  24% 1040 aa  MDTB_ECO45 RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1036    3e-42  23% 1046 aa  MEXB_PSEAE RecName: Full=Multidrug resistance protein mexB;AltName:
   25::1026    6e-41  23% 1040 aa  MDTB_ECOLU RecName: Full=Multidrug resistance protein mdtB;AltName:
   13::1024    1e-40  25% 1050 aa  TTGB_PSEPU RecName: Full=Toluene efflux pump membrane transporter
   13::1024    1e-40  25% 1050 aa  TTGB_PSEPK RecName: Full=Probable efflux pump membrane transporter
   13::1024    1e-40  25% 1050 aa  MEPB_PSEPU RecName: Full=Multidrug/solvent efflux pump membrane
   13::1024    1e-40  25% 1050 aa  ARPB_PSEPU RecName: Full=Antibiotic efflux pump membrane transporter
   25::1026    4e-40  24% 1039 aa  MDTB_SERP5 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    9e-40  23% 1040 aa  MDTB_ECO27 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    2e-39  23% 1040 aa  MDTB_ESCF3 RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    3e-39  23% 1040 aa  MDTB_ECOLI RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    3e-39  23% 1040 aa  MDTB_ECOLC RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    3e-39  23% 1040 aa  MDTB_ECODH RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    3e-39  23% 1040 aa  MDTB_ECOBW RecName: Full=Multidrug resistance protein mdtB;AltName:
   34::1024    4e-39  23% 1040 aa  MDTB_SALAR RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1026    4e-39  23% 1040 aa  MDTB_ECOHS RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1022    6e-39  22% 1040 aa  MDTB_ENT38 RecName: Full=Multidrug resistance protein mdtB;AltName:
   38::1027    2e-37  23% 1040 aa  MDTB_ERWCT RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1024    3e-36  22% 1040 aa  MDTB_CITK8 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    4e-36  22% 1040 aa  MDTB_SALTI RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1024    4e-36  22% 1040 aa  MDTB_KLEP7 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    6e-36  22% 1040 aa  MDTB_SALPB RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    6e-36  22% 1040 aa  MDTB_SALEP RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    6e-36  22% 1040 aa  MDTB_SALDC RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    8e-36  22% 1040 aa  MDTB_SALHS RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    8e-36  22% 1040 aa  MDTB_SALA4 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    1e-35  22% 1040 aa  MDTB_SALG2 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    1e-35  22% 1040 aa  MDTB_SALSV RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    1e-35  22% 1040 aa  MDTB_SALNS RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1024    1e-35  22% 1040 aa  MDTB_KLEP3 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    5e-35  22% 1040 aa  MDTB_SALPK RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    5e-35  22% 1040 aa  MDTB_SALPA RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    1e-34  22% 1040 aa  MDTB_SALTY RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    1e-34  22% 1040 aa  MDTB_SALPC RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1024    2e-34  24% 1040 aa  MDTB_ENTS8 RecName: Full=Multidrug resistance protein mdtB;AltName:
   41::1024    6e-34  22% 1040 aa  MDTB_SALCH RecName: Full=Multidrug resistance protein mdtB;AltName:
   25::1041    4e-33  23% 1048 aa  MDTB_PHOLL RecName: Full=Multidrug resistance protein mdtB;AltName:
   17::1028    1e-27  28% 1037 aa  ACRD_ECOLI RecName: Full=Probable aminoglycoside efflux
   25::1026    4e-27  26% 1026 aa  MDTC_PECCP RecName: Full=Multidrug resistance protein mdtC;AltName:
   14::1021    2e-25  27% 1032 aa  Y895_HAEIN RecName: Full=Uncharacterized transporter HI0895;
    2::993     2e-25  24% 1036 aa  MDTC_PHOLL RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    2e-24  26% 1024 aa  MDTC_YERPY RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    2e-24  26% 1024 aa  MDTC_YERPS RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    2e-24  26% 1024 aa  MDTC_YERPB RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    2e-24  26% 1024 aa  MDTC_YERP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
   19::993     3e-24  25% 1026 aa  MDTC_SERP5 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1026    4e-24  26% 1026 aa  MDTC_ERWCT RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    5e-24  26% 1024 aa  MDTC_YERPN RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    5e-24  26% 1024 aa  MDTC_YERPG RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    5e-24  26% 1024 aa  MDTC_YERPE RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::1010    5e-24  26% 1024 aa  MDTC_YERPA RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     8e-23  25% 1024 aa  MDTC_YERE8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::1030    4e-22  27% 1034 aa  ACRF_ECOLI RecName: Full=Acriflavine resistance protein F;AltName:
   25::993     4e-20  25% 1025 aa  MDTC_ENT38 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::389     1e-19  26% 1029 aa  MDTC_ENTS8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   19::993     2e-19  25% 1025 aa  MDTC_KLEP7 RecName: Full=Multidrug resistance protein mdtC;AltName:
   19::993     2e-19  26% 1025 aa  MDTC_KLEP3 RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::1000    5e-19  23% 1049 aa  ACRB_ECOLI RecName: Full=Acriflavine resistance protein B;
    4::116     7e-19  23% 1052 aa  SWRC_BACSU RecName: Full=Swarming motility protein swrC;
   29::993     9e-19  24% 1026 aa  MDTC_SALAR RecName: Full=Multidrug resistance protein mdtC;AltName:
   15::1006    9e-19  25% 1024 aa  MDTC_ERWT9 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     9e-19  25% 1025 aa  MDTC_ECOSE RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     9e-19  25% 1025 aa  MDTC_ECO8A RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     1e-18  25% 1025 aa  MDTC_SHIBS RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     1e-18  23% 1026 aa  MDTC_SALPC RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     1e-18  23% 1026 aa  MDTC_SALCH RecName: Full=Multidrug resistance protein mdtC;AltName:
   14::1026    3e-18  28% 1037 aa  MDTF_ECO57 RecName: Full=Multidrug resistance protein mdtF;
   25::993     3e-18  25% 1025 aa  MDTC_ESCF3 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_ECOLU RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_ECO5E RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_ECO57 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_ECO55 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_ECO24 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     3e-18  25% 1025 aa  MDTC_SHIB3 RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     3e-18  25% 1026 aa  MDTC_SALNS RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::587     4e-18  25% 1049 aa  TTGH_PSEPU RecName: Full=Toluene efflux pump membrane transporter
   13::587     4e-18  25% 1049 aa  SRPB_PSEPU RecName: Full=Solvent-resistant pump membrane transporter
   25::993     4e-18  25% 1025 aa  MDTC_SHISS RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::989     4e-18  24% 1021 aa  MDTC_SHIFL RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::989     4e-18  25% 1021 aa  MDTC_SHIF8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALTY RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALTI RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALSV RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALPK RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALPB RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALPA RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALEP RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALDC RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     4e-18  25% 1026 aa  MDTC_SALA4 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::346     6e-18  28% 1046 aa  SEPB_PSEP1 RecName: Full=Probable efflux pump membrane transporter
   14::1026    6e-18  28% 1037 aa  MDTF_ECOL6 RecName: Full=Multidrug resistance protein mdtF;
   29::993     6e-18  25% 1026 aa  MDTC_SALHS RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     6e-18  25% 1025 aa  MDTC_ECOSM RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     6e-18  25% 1025 aa  MDTC_ECOLC RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     6e-18  25% 1025 aa  MDTC_ECOL5 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     6e-18  25% 1025 aa  MDTC_ECOHS RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     6e-18  25% 1025 aa  MDTC_ECO81 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     7e-18  25% 1025 aa  MDTC_ECOUT RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     7e-18  25% 1025 aa  MDTC_ECOL6 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     7e-18  25% 1025 aa  MDTC_ECOK1 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     7e-18  25% 1025 aa  MDTC_ECO45 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     7e-18  25% 1025 aa  MDTC_ECO27 RecName: Full=Multidrug resistance protein mdtC;AltName:
   29::993     1e-17  25% 1026 aa  MDTC_SALG2 RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     1e-17  25% 1025 aa  MDTC_ECOLI RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     1e-17  25% 1025 aa  MDTC_ECODH RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::993     1e-17  25% 1025 aa  MDTC_ECOBW RecName: Full=Multidrug resistance protein mdtC;AltName:
   25::389     2e-17  24% 1025 aa  MDTC_ECO7I RecName: Full=Multidrug resistance protein mdtC;AltName:
   14::346     5e-17  27% 1037 aa  MDTF_ECOLI RecName: Full=Multidrug resistance protein mdtF;
   16::993     1e-16  24% 1028 aa  MDTC_CITK8 RecName: Full=Multidrug resistance protein mdtC;AltName:
   13::348     1e-16  27% 1048 aa  TTGE_PSEPU RecName: Full=Toluene efflux pump membrane transporter
   46::104     3e-06  37%  163 aa  YCBL_BACUN RecName: Full=Uncharacterized 17.3 kDa protein in cblS
    1::1070

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIEKLLAFSVRQRWLVMIGVLMMAAFGAWNFTRLPIDAVPDITNVQVQINTNAPGYSPLEVEQRITFPIE
HELA_LEGPN      MLEKIIRFSLKHRWFVLLFTLVIAILGVYNFQRLPIDAVPDITNVQVQINTQASGYSPFEVEQRITFPIE
CZCA_ALCSC      MFERIISFAIQQRWLVLLAVFGMAGLGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRVTYPIE
CZCA_RALME      MFERIISFAIQQRWLVLLAVFGMAGLGIFSYNRLPIDAVPDITNVQVQVNTSAPGYSPLETEQRATYPIE
NCCA_ALCXX      MIESILSGAVRFRWLVLFLTAVVGAIGAWQLNLLPIDVTPDITNKQVQINTVVPTLSPVEVEKRVTYPIE
CNRA_RALME      MIESILSGSVRYRWLVLFLTAVVAVIGAWQLNLLPIDVTPDITNKQVQINSVVPTMSPVEVEKRVTYPIE
CUSA_ECOL6      MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLT
CUSA_ECO57      MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLT
CUSA_ECOLI      MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLT
SILA_SALTY      MIEWIIRRSVANRFLVMMGALFLSIWGTWTIINTPVDALPDLSDVQVIIKTSYPGQAPQIVENQVTYPLT
NOLG_RHIME      ----LTRISINHPVFATMMMVMILVLGLFSYGRLGVDHYPETDLPVVVVATTYTGASPESVESEISRPIE
MDTB_YERPE      --------------LFMIAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVVTSSITAPLE
MDTB_YERPS      --------------LFMIAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVVTSSITAPLE
MDTB_SHISS      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOSE      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO5E      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO57      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO24      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO8A      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO7I      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SHIB3      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOL5      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SHIFL      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SHIBS      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOUT      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOSM      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOL6      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOK1      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO81      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO55      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECO45      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MEXB_PSEAE      -------------WVIAL-VIMLA--GGLSILSLPVNQYXXXXXXXXXVQVSYPGASAETVQDTVVQVIE
MDTB_ECOLU      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
TTGB_PSEPU      -------------WVIALVIMLV---GALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIE
TTGB_PSEPK      -------------WVIALVIMLV---GALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIE
MEPB_PSEPU      -------------WVIALVIMLV---GALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIE
ARPB_PSEPU      -------------WVIALVIMLV---GALSILKLPINQYXXXXXXXXXXXVTYPGASAQTVQDTVVQVIE
MDTB_SERP5      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLE
MDTB_ECO27      --------------LLMVAILLAGIIG---YQALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ESCF3      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOLI      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOLC      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECODH      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOBW      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALAR      --------------------------GIIGYRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ECOHS      --------------LLMVAILLAGIIG---YRALPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ENT38      --------------LLMVAILIAGIIG---YRFLPVSALPEVDYPTIQVITLYPGASPDVVTSAITAPLE
MDTB_ERWCT      ------------------------------YRALPVSALPEVDYPTIQVITLYPGASPDVVTSAITAPLE
MDTB_CITK8      --------------LLMVAILLAGIIG---YRFLPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALTI      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLE
MDTB_KLEP7      --------------LLMVAILLAGIIG---YRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLE
MDTB_SALPB      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALEP      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALDC      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALHS      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALA4      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALG2      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALSV      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALNS      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_KLEP3      --------------LLMVAILLAGIIG---YRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLE
MDTB_SALPK      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLE
MDTB_SALPA      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSSVTAPLE
MDTB_SALTY      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_SALPC      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_ENTS8      --------------LLMVAILLAGIIG---YRFLPVSALPEVDYPTIQVVTLYPGASPDVVTSAITAPLE
MDTB_SALCH      ---------------------------------LPVAALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
MDTB_PHOLL      --------------LFMAAILLAGIIG---YRMLPVSALPEVDYPTIQVVTLYPGASPDVMTSAVTAPLE
ACRD_ECOLI      --------------------ILLCLTGTLAIFSLPVEQYPDLAPPNVRVTANYPGASAQTLENTVTQVIE
MDTC_PECCP      --------------------------GVLGFRLLPVSPLPQVDFPVISVSASLPGASPETMASAVATPLE
Y895_HAEIN      ---------IRRPVLAVSISLLMIILGLQAISKLAVREYPKMTTTVITVSTAYPGADANLIQAFVTSKLE
MDTC_PHOLL      ---KFFALFIQRPVATTLLSLAITLCGVLGFTLLPVSPLPQVDFPVISVYASLPGASPETMASSVATPLE
MDTC_YERPY      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERPS      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERPB      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERP3      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_SERP5      --------------------LAIAISGVISFSLLPVSPLPQVDYPVISISASLPGADPETMASSVATPLE
MDTC_ERWCT      --------------------------GVLGFRLLPVSPLPQVDFPVISVSASLAGASPETMASAVATPLE
MDTC_YERPN      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERPG      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERPE      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERPA      --------------------------GIIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSVATPLE
MDTC_YERE8      --------------------------GVIGFSLLPVSPLPQVDYPVIMVSASMPGADPETMASSIATPLE
ACRF_ECOLI      --------------------------------QLPVAQYPTIAPPAVSVSANYPGADAQTVQDTVTQVIE
MDTC_ENT38      --------------------------GVLGFRLLPVAPLPQVDFPVIMISASLPGASPETMASSVATPLE
MDTC_ENTS8      --------------------------GVLGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_KLEP7      --------------------LAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_KLEP3      --------------------LAITLCGILGFRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
ACRB_ECOLI      --------------------------------KLPVAQYPTIAPPAVTISASYPGADAKTVQDTVTQVIE
SWRC_BACSU      ----VINFVLKNKFAVWLMTIIVTAAGLYAGMNMKQESIPDVNMPYLTISTTYPGATPSQVADEVTKPVE
MDTC_SALAR      ------------------------------FRLLPVAPLPQVDFPVIMVRASLPGASPETMASSVATPLE
MDTC_ERWT9      -------------WLLTLTIVLAGFLG---FRLLPVAPLPQVDFPVIVVTASLPGASPEIMASSVATPLE
MDTC_ECOSE      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO8A      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SHIBS      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALPC      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALCH      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTF_ECO57      ----------------VLAIIMMLA-GGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIE
MDTC_ESCF3      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOLU      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO5E      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO57      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO55      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO24      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SHIB3      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALNS      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
TTGH_PSEPU      -------------WVLAI-VAMLA--GALSLAKMPISQYPNIAAPAVSIQVSYPGASAQTVQDTVVQVIE
SRPB_PSEPU      -------------WVLAI-VAMLA--GALSLAKMPISQYPNIAAPAVSIQVSYPGASAQTVQDTVVQVIE
MDTC_SHISS      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SHIFL      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SHIF8      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALTY      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALTI      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALSV      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALPK      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALPB      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALPA      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALEP      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALDC      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALA4      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
SEPB_PSEP1      -------------WVLAI-IAMLA--GALSLTKMPISQYPNIAAPAVSIQVVYPGASAKTVQDTVVQVIE
MDTF_ECOL6      ----------------VLAIIMMLA-GGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIE
MDTC_SALHS      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOSM      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOLC      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOL5      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOHS      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO81      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOUT      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOL6      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOK1      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO45      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECO27      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_SALG2      ------------------------------FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
MDTC_ECOLI      --------------------------GILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLE
MDTC_ECODH      --------------------------GILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLE
MDTC_ECOBW      --------------------------GILGFRMLPVAPLPQVDFPVIIVSASLPGASPETMASSVATPLE
MDTC_ECO7I      --------------------------GILGFRMLPVAPLPQVDFPVIMVSASLPSASPETMASSVATPLE
MDTF_ECOLI      ----------------VLAIIMMLA-GGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDSVTQVIE
MDTC_CITK8      --------------LISIAITLCGVLG---FRLLPVAPLPQVDFPVIMVSASLPGASPETMASSVATPLE
TTGE_PSEPU      -------------WVLAI-IAMLA--GALSLTKMPISQYPNIAAPAVSIQVVYPGASAKTVQDTVVQVIE
YCBL_BACUN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TAMGGLPNLVNTRSLSRYGLSQVTVVFKDGTDIYFARQLVNERVQRVKDILPVGIETAMGPVSTGLGEIY
HELA_LEGPN      LAMSGLPSLDYTRSLSRYGLSQVTVVFKDGTNIYFARQLINERLQEVKDKLPPGVETTLGPISTGLGEIF
CZCA_ALCSC      VVMAGLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIY
CZCA_RALME      VVMAGLPGLEQTRSLSRYGLSQVTVIFKDGTDVYFARQLVNQRIQEAKDNLPEGVVPAMGPISTGLGEIY
NCCA_ALCXX      TAIAGLNGVENMRSLSRNGFSQVTVIFKESSNLYFMRQQVTERLAQARPNLPAGVEPQMGPVSTGLGEVF
CNRA_RALME      TAIAGLNGVESTRSMSRNGFSQVTVIFKESANLYFMRQQVSERLAQARPNLPENVEPQMGPVSTGLGEVF
CUSA_ECOL6      TTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIY
CUSA_ECO57      TTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIY
CUSA_ECOLI      TTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPYWARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIY
SILA_SALTY      TTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDLYWARSRVLEYLNQVQGKLPAGVSSEIGPDATGVGWIF
NOLG_RHIME      AALNTIGGIDTITSESYEGRSIVVVQFEVDVDSQDAAQEVRDRVARLETKFPDGVATP---------QVT
MDTB_YERPE      RQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDL-----PYPPIYNKVN
MDTB_YERPS      RQFGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDL-----PYPPIYNKVN
MDTB_SHISS      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOSE      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO5E      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO57      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO24      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO8A      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO7I      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SHIB3      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOL5      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SHIFL      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLNVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SHIBS      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOUT      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOSM      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOL6      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOK1      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO81      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO55      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECO45      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MEXB_PSEAE      QQMNGIDNLRYISSESNSGSMTITVTFEQGTDPDIAQVQVQNKLQLATPLLPQEVQRQGIRVTKAVKNFL
MDTB_ECOLU      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
TTGB_PSEPU      QQLNGIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFL
TTGB_PSEPK      QQLNGIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFL
MEPB_PSEPU      QQLNGIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFL
ARPB_PSEPU      QQLNGIDNLRYVSSESNSGSMTITATFEQGTNPDTAQVQVQNKLNLATPLLPQEVQQQGIRVTKAVKNFL
MDTB_SERP5      RQFGQMSGLKQMASQSSGGASVVTLQFQLELPLDVAEQEVQAAINSATNLLPSDL-----PYPPIYSKVN
MDTB_ECO27      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ESCF3      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOLI      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOLC      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECODH      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ECOBW      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SALAR      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_ECOHS      RQFGQMSGLKQMSSQSSGGASVITLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ENT38      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_ERWCT      RQFGQMSGLKQMSTQSAGGASVITLQFQLELSLDVAEQDVQAAINAASNLLPNDLPYPPTYSKVNPADPP
MDTB_CITK8      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SALTI      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_KLEP7      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SALPB      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALEP      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALDC      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALHS      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALA4      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALG2      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINADTNLLPSDLPNPPIYSKVNPADPP
MDTB_SALSV      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALNS      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_KLEP3      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPVYSKVNPADPP
MDTB_SALPK      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALPA      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALTY      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_SALPC      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_ENTS8      RQFGQMSGLKQMASQSAGGASVVTLQFQLTLPLDVAEQEVQAAINAATXXXXXXVNPADPPIMTTSSALP
MDTB_SALCH      RQFGQMSGLKQMSSQSSGGASVVTLQFQLTLPLDVAEQEVQAAINAATNLLPSDLPNPPIYSKVNPADPP
MDTB_PHOLL      RQLGQMSGLKQMASQSSGGASVITLQFQLTLPLDVAEQEVQAAINAASNLLPNDLPPIYSKVNPADPPIL
ACRD_ECOLI      QNMTGLDNLMYMSSQSSTGQASVTLSFKAGTDPDEAVQQVQNQLQSAMRKLPQAVQNQGVTVKTGDTNIL
MDTC_PECCP      RALGRIAGVSEMTSTSSLGSTRVILVFNLDRDINGAARDVQAAINAAQNLLPSGMSSTYRKVNPSDAPVM
Y895_HAEIN      ESIAQADNIDYMXXXXXXXXXXXXXKMKLNTDPAGALADVLAKVNAVKSALPNGIEDPXXXXXXXXXXIM
MDTC_PHOLL      HALGRIAGVNEMTSSSSLGSTNITLEFDLNRDINSAARDVQAALNAAQSLLPSGMPSRPHYYKVNPTDAP
MDTC_YERPY      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERPS      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERPB      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERP3      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_SERP5      RALGRIAGVNEMTSMSSLGSTRVILQFDLDRDINGAARDVQAAINAAQSLLPTGMPSSYRKVNPSDAPIM
MDTC_ERWCT      RALGRIAGVSEMTSTSSLGSTRVILVFNLDRDINGAARDVQAAINAAQNLLPSGMSSTYRKVNPSDAPVM
MDTC_YERPN      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERPG      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERPE      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERPA      RALGRIAGVNEMTSTSSLGSTRIILQFDLNRDINGAARDVQAALNAAQSLLPSGMPSTYRKMNPSDAPIM
MDTC_YERE8      RALGRIAGVNEMTSTSSLGSTRIILQFDLSRDINGAARDVQAALNAAQSLLPSGMPNTYRKMNPSDAPIM
ACRF_ECOLI      QNMNGIDNLMYMSSTSSAGSVTITLTFQSGTDPDIAQVQVQNKLQLATPLLPQEVQQQGISVEKSSSSYL
MDTC_ENT38      RSLGRIAGVNEMTSSSSLGSTRIILEFNFNRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ENTS8      RSLGRIAGVNEMTSTSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_KLEP7      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_KLEP3      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
ACRB_ECOLI      QNMNGIDNLMYMSSNSSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFL
SWRC_BACSU      QAVQNLDGVSVVTSTSYENASSVMIEYDYEKDMDKAKTEAAEALENV-----------------------
MDTC_SALAR      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ERWT9      RALGRIAGVXXXXXXXXXXXTHVILLFDFDRDINGAARDVQGAINAAQSLLPSGMPNSYRKVNPSDAPIM
MDTC_ECOSE      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO8A      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SHIBS      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SALPC      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALCH      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTF_ECO57      QNMNGLDGLMYMSSTSAAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNIL
MDTC_ESCF3      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOLU      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO5E      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO57      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO55      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO24      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SHIB3      RSLGRIVGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SALNS      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
TTGH_PSEPU      QQLSGLDGFMSAESASD-GSMTIIVTFEQGTDPDIAQVQVQNKLQLATPRLPEEVQRGLRVVKYQMNFFL
SRPB_PSEPU      QQLSGLDGFMSAESASD-GSMTIIVTFEQGTDPDIAQVQVQNKLQLATPRLPEEVQRGLRVVKYQMNFFL
MDTC_SHISS      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SHIFL      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SHIF8      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SALTY      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALTI      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALSV      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALPK      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALPB      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALPA      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALEP      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALDC      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_SALA4      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
SEPB_PSEP1      QQLNGLDGFRYMAAESASGSMNIIVTFEQGTNPDIAQVQVQNKLQLATPRLPEEVQ------RQGLRVVY
MDTF_ECOL6      QNMNGLDGLMYMSSTSAAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNIL
MDTC_SALHS      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRRANPSDAPIM
MDTC_ECOSM      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOLC      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOL5      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOHS      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO81      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOUT      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOL6      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOK1      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO45      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO27      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_SALG2      RSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLPGGMPSTYRKANPSDAPIM
MDTC_ECOLI      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECODH      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECOBW      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTC_ECO7I      RSLGRIAGVXXXXXXXXXXXTRIILQFDFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
MDTF_ECOLI      QNMNGLDGLMYMSSTSAAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPEAVQQQGISVDKSSSNIL
MDTC_CITK8      RSLGRIAGVXXXXXXXXXXXTRIILQFNFDRDINGAARDVQAAINAAQSLLPSGMPSTYRKANPSDAPIM
TTGE_PSEPU      QQLNGLDGFRYMAAESASGSMNIIVTFEQGTNPDIAQVQVQNKLQLATPRLPEEVQ------RQGLRVVY
YCBL_BACUN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           MYTVEAKEGAKNAEGKPYTPSDLRTAQDWIIKPQLRNVAGVNEVNTIGGFEKQFHVLPDPARLMAYRLSF
HELA_LEGPN      MYTVTNKPNVPISQH--YNPTELRTIQDWIIKPQLRNVEGVAEVNTIGGYEKQFHITPDPSKLVRYRLSL
CZCA_ALCSC      LWTVEAEEGARKADGTAYTPTDLREIQDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTL
CZCA_RALME      LWTVEAEEGARKADGTAYTPTDLREIQDWVVRPQLRNVPGVTEINTIGGFNKQYLVAPSLERLASYGLTL
NCCA_ALCXX      HYSVEYEKGAKVKDGEPGWQSDLRTVQDWIIRPQLRTTAGVADVDSLGGYVKQFVVEPDAAKMAAYGISF
CNRA_RALME      HYSVEYQTGASIKDGEPGWQSDLRTVQDWIIRPQLRTTPGVADVDSLGGYVKQFVVEPDTGKMAAYGVSY
CUSA_ECOL6      EYALVDRSGKHDL-------ADLRSLQDWFLKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISL
CUSA_ECO57      EYALVDRSGKHDL-------ADLRSLQDWFLKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISL
CUSA_ECOLI      EYALVDRSGKHDL-------ADLRSLQDWFLKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISL
SILA_SALTY      EYALVDRSGKHDL-------SELRSLQDWFLKFELKTIPNVAEVASVGGVVKQYQIQVNPVKLSQYGISL
NOLG_RHIME      RYKPEGQAILSVASSTSRTLPEITTLATRVINNRLSVISGVGQVSLIGSSERQVLVVVDPDRLGAYGLAV
MDTB_YERPE      PADPPILTLAVTATAIPMT--QVEDMVETRIAQKISQXXXXXXXXXXXXQRPAVRVKLNAPAVAALGLDS
MDTB_YERPS      PADPPILTLAVTATAIPMT--QVEDMVETRIAQKISQXXXXXXXXXXXXQRPAVRVKLNAPAVAALGLDS
MDTB_SHISS      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOSE      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO5E      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO57      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO24      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO8A      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO7I      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_SHIB3      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOL5      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_SHIFL      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_SHIBS      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOUT      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOSM      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOL6      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOK1      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO81      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO55      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECO45      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MEXB_PSEAE      MVV-----GVVSTDGS-MTKEDLSNYIVSNIQDPLSRTKGVGDFQVFGS-QYSMRIWLDPAKLNSYQLTP
MDTB_ECOLU      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
TTGB_PSEPU      LVI-----GLVSEDGS-MTKDDLANYIVSNMQDPISRTAGVGDFQVFGA-QYAMRIWLDPAKLNKFQLTP
TTGB_PSEPK      LVI-----GLVSEDGS-MTKDDLANYIVSNMQDPISRTAGVGDFQVFGA-QYAMRIWLDPAKLNKFQLTP
MEPB_PSEPU      LVI-----GLVSEDGS-MTKDDLANYIVSNMQDPISRTAGVGDFQVFGA-QYAMRIWLDPAKLNKFQLTP
ARPB_PSEPU      LVI-----GLVSEDGS-MTKDDLANYIVSNMQDPISRTAGVGDFQVFGA-QYAMRIWLDPAKLNKFQLTP
MDTB_SERP5      PADPPILTLAVTSSAMPMT--QVEDMVETRVAQKISQVTGVGLVTISGGQRPAVRVKLNAAAVAAYGLDS
MDTB_ECO27      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ESCF3      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOLI      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOLC      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECODH      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOBW      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALAR      IMTLAVTSNATQVEGMVET----RVAQ------KISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_ECOHS      IMTL-----AVTSIAMPMT--QVEDMVETRVAQKISQISGVGLVTLSGGQRPAVRVKLNAQAIAALGLTS
MDTB_ENT38      IMTL-----AVTSSAMPMT--QVEDMVETRVAQKIXXXXXXXXXXXXXXXRPAVRVKLNAQAIAALGLTS
MDTB_ERWCT      IMTLAVTSSAMSM-------TQVQDMVDNRIAQKISQXXXXXXXXXXXXQRPAVRVRLNAPALAAYGLTS
MDTB_CITK8      IMTL-----AVTSTAMPMT--QVEDMVETRVAQKIXXXXXXXXXXXXXXXRPAVRVKLNAQAIAALGLTS
MDTB_SALTI      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_KLEP7      IMTL-----AVTSSAIPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALPB      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALEP      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALDC      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALHS      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_SALA4      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_SALG2      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALSV      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_SALNS      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_KLEP3      IMTL-----AVTSSAIPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAIAALGLTS
MDTB_SALPK      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTS
MDTB_SALPA      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAIRVKLNAQAIAALGLTS
MDTB_SALTY      IMTL-----AVTSNSMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_SALPC      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_ENTS8      MTQVEDMVETRVAQRISQXXXXXXXXXXXXQRPAVRVKLNAQALASLG-------------------IDS
MDTB_SALCH      IMTL-----AVTSNAMPMT--QVEDMVETRVAQKISQVSGVGLVTLAGGQRPAVRVKLNAQAVAALGLTS
MDTB_PHOLL      MLAV-------TSDAMPMT--QIQDMVETRIAQKISQVNGVGLVTLAGGQRPAVRVKLNAQAVAAQGLDS
ACRD_ECOLI      TIAFVSTDGSMDKQDADYVASN--------IQDPLSRVNGVGDIDAYGS-QYSMRIWLDPAKLNSFQMTA
MDTC_PECCP      ILTLTSDT---YSQGQLYDFASTQLSQ------KISQMEGVGDVSIGGSSLPAVRVALNPVALFNQGISL
Y895_HAEIN      YISFRSKK---------LDSSQVTDYINRVVKPQFFTIEGVAEVQVFGAAEYALRIWLDPQKMAAQNLSV
MDTC_PHOLL      IMILTLTSDTYN-QGQLYDFASTQLAQ------KIAQXXXXXXXXXXXXXLPAVRVELNPGVLFHQGVSL
MDTC_YERPY      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERPS      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERPB      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERP3      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_SERP5      ILTLTSDT---YSQGQLYDFASTQLAQ------KIAQTEXXXXXXXXXXXLPAVRVELNPSALFNQGISL
MDTC_ERWCT      ILTLTSDT---YSQGQLYDFASTQLSQ------KISQMEGVGDVSIGGSSLPAVRVALNPVALFNQGISL
MDTC_YERPN      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERPG      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERPE      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERPA      IMTLTSDTFS---QGQLYDYASTKLAQ------KIAQTEGVSDVTVGGSSLPAVRVELNPSALFNQGVSL
MDTC_YERE8      IMTLTSDTFS---QGQLYDFASTQLAQ------KIAQTEXXXXXXXXXXXLPAVRVELNPSALFNQGVSL
ACRF_ECOLI      MVAVSDNPGTTQDDISDYVASN--------VKDTLSRLNGVGDVQLFGA-QYAMRIWLDADLLNKYKLTP
MDTC_ENT38      ILTLTSDT---YSQGELYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPEALFNQGVSL
MDTC_ENTS8      ILTLTSDTFS---QGELYDYASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVALNPQALFNQGVSL
MDTC_KLEP7      ILTLTSDT---YSQGELYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSL
MDTC_KLEP3      ILTLTSDT---YSQGELYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSL
ACRB_ECOLI      MVV-----GVINTDGT-MTQEDISDYVAANMKDAISRTSGVGDVQLFGS-QYAMRIWMNPNELNKFQLTP
SWRC_BACSU      ----------------------------------------------------------------------
MDTC_SALAR      ILTLTSDSWS---QGELYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRIGLNPQALFNQGVSL
MDTC_ERWT9      IMTLTSDT---------YSPGQLYDYASTKLAQRLAQIXXXXXXXXXXSSLPAVRVDLNPQALFNQGVSL
MDTC_ECOSE      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO8A      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SHIBS      ILTLTSDT---YSQGKLY---DFASTQ---LAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALPC      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALCH      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTF_ECO57      MVAAFISD---NGSLNQYDIADYVASN---IKDPLSRTAGVGSVQLFGS-EYAMRIWLDPQKLNKYNLVP
MDTC_ESCF3      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOLU      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO5E      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO57      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO55      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO24      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SHIB3      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALNS      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
TTGH_PSEPU      VMSLVDRSGKLDN----FDLGNLIASQ---LQDPISRIPGVGDFQLFGS-PYAMRIWLDPGKLNSYQLTP
SRPB_PSEPU      VMSLVDRSGKLDN----FDLGNLIASQ---LQDPISRIPGVGDFQLFGS-PYAMRIWLDPGKLNSYQLTP
MDTC_SHISS      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SHIFL      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLTPQALFNQGVSL
MDTC_SHIF8      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLTPQALFNQGVSL
MDTC_SALTY      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALTI      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALSV      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALPK      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALPB      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALPA      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALEP      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALDC      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALA4      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
SEPB_PSEP1      QMNFFMVVGLVDKTGK-MTNFDLGN----LIASQLQD--PISRINGVGDFPYAMRIWLDPGKLNSYQLTP
MDTF_ECOL6      MVAAFISD---NGSLNQYDIADYVASN---IKDPLSRTAGVGSVQLFGS-EYAMRIWLDPQKLNKYNLVP
MDTC_SALHS      ILTLTSESWS---QGKLYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOSM      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOLC      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOL5      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOHS      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO81      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOUT      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOL6      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOK1      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO45      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO27      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_SALG2      ILTLTSESWS---QGKLYDFASTQLAQT------IAQXXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOLI      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECODH      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECOBW      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTC_ECO7I      ILTLTSDT---------YSQGELYDFASTQLAPTISQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
MDTF_ECOLI      MVAAFISD---NGSLNQYDIADYVASN---IKDPLSRTAGVGSVQLFGS-EYAMRIWLDPQKLNKYNLVP
MDTC_CITK8      ILTLTSDTWS---QGELYDFASTQLAQT------IAQIXXXXXXXXXXSSLPAVRVGLNPQALFNQGVSL
TTGE_PSEPU      QMNFFMVVGLVDKTGK-MTNFDLGN----LIASQLQD--PISRINGVGDFPYAMRIWLDPGKLNSYQLTP
YCBL_BACUN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RDVMTSLASNNANVGAGYIEKNGEQYLVRTPGQVANVEDIRQIVIGSRNGVPVRIMDVAEVKEGTDLRTG
HELA_LEGPN      NDVVEALERNNANVGAGYIETNGEQNLIRVPGQVQNMADIENIVIASFEGTPVRIRDVAEVALGKELRTG
CZCA_ALCSC      TDVVNALNKNNDNVGAGYIERRGEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIGDVEIGKELRTG
CZCA_RALME      TDVVNALNKNNDNVGAGYIERRGEQYLVRAPGQVASEDDIRNIIVGTAQGQPIRIRDIGDVEIGKELRTG
NCCA_ALCXX      EELAQALEDANLSVGANFIRRSGESYLVRADARIKSADEIARAVIAQRQGVPITVGQVANINVGGELRSG
CNRA_RALME      ADLARALEDTNLSVGANFIRRSGESYLVRADARIKSADEISRAVIAQRQNVPITVGQVARVKIGGELRSG
CUSA_ECOL6      AEVKSALDASNQEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKVQVGPEMRRG
CUSA_ECO57      AEVKSALDASNQEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKIQVGPEMRRG
CUSA_ECOLI      AEVKSALDASNQEAGGSSIELAEAEYMVRASGYLQTLDDFNHIVLASENGVPVYLRDVAKVQIGPEMRRG
SILA_SALTY      PEVKQALESSNQEAGGSSVEIAEAEYMVRASGYLQSIDDFNNIVLKTENGVPVYLRDVARVQTGPEMRRG
NOLG_RHIME      STVIEAIRGENQDRAAGTLISGINQRIVTVEGRIANTSGFNRIIVAQRNGYPVYLSEVATILDTGAEVTS
MDTB_YERPE      ETIRTAISNANVNSAKGSLDGPTRSVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKL
MDTB_YERPS      ETIRTAISNANVNSAKGSLDGPTRSVTLSANDQMKSAEEYRDLIIAYQNGAPIRLQDVATIEQGAENNKL
MDTB_SHISS      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOSE      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO5E      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO57      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO24      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO8A      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO7I      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNSAPIRLGDVATVEQGAENSWL
MDTB_SHIB3      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOL5      ESVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_SHIFL      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_SHIBS      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOUT      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOSM      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOL6      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOK1      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO81      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO55      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECO45      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MEXB_PSEAE      GDVSSAIQAQNVQISSGQLAVKGQQLNATIIGKLQTAEQFENILLKNPDGSQVRLKDVADVGLGGQDYSI
MDTB_ECOLU      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
TTGB_PSEPU      VDVKTAVAAQNVQVSSGQLALPGTQLNATIIGKLQTAEQFESILLKNKDGSQVRLGDVAQVGLGGENYAV
TTGB_PSEPK      VDVKTAVAAQNVQVSSGQLALPGTQLNATIIGKLQTAEQFESILLKNKDGSQVRLGDVAQVGLGGENYAV
MEPB_PSEPU      VDVKTAVAAQNVQVSSGQLALPGTQLNATIIGKLQTAEQFESILLKNKDGSQVRLGDVAQVGLGGENYAV
ARPB_PSEPU      VDVKTAVAAQNVQVSSGQLALPGTQLNATIIGKLQTAEQFESILLKNKDGSQVRLGDVAQVGLGGENYAV
MDTB_SERP5      ETIRTAISNANVNSAKGSLDGPTRSVTLSANDQMKSADDYRQLIVAYQNGAAIRLQDIATIEQGAENTRL
MDTB_ECO27      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ESCF3      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOLI      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOLC      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECODH      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ECOBW      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_SALAR      ETIRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYKNGAPVRLGDVATVEQGAENSWL
MDTB_ECOHS      ETVRTAITGANVNSAKGSLDGPSRAVTLSANDQMQSAEEYRQLIIAYQNGAPIRLGDVATVEQGAENSWL
MDTB_ENT38      ETIRTAIVSANVNSAKGSLDGPTRAVTLSANDQMQSADEYRQLIVAYQNGAPIRLGDVATVEQGAENRWL
MDTB_ERWCT      ETIRTAITAANVNSAKGSLDGPTRSVTLSANDQMKSVDDYRKLIVAWKNGAPVRLQDVATIEQAAENIYL
MDTB_CITK8      ETVRAAITSANVNSAKGSLDGPTRAVTLSANDQMQSVDEYRQLIIAWQNGAPVRLGDVATVEQGAENSWL
MDTB_SALTI      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_KLEP7      ETVRTAITSANVNSAKGSLDGPARAVTLSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWL
MDTB_SALPB      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALEP      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALDC      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALHS      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALA4      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALG2      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALSV      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADDYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALNS      ETIRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_KLEP3      ETVRTAITSANVNSAKGSLDGPARAVTLSANDQMQSAEDYRRLIIAYQNGAPIRLGDVASVEQGAENSWL
MDTB_SALPK      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALPA      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRKLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALTY      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_SALPC      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_ENTS8      ETVRTAITSANVNSAKGSFDGPERAVTLSANDQMKSADEYRNLIIAYKNGAPVRLGDVATVEQGAENAWL
MDTB_SALCH      ETVRTAITGANVNSAKGSLDGPERAVTLSANDQMQSADEYRRLIIAYQNGAPVRLGDVATVEQGAENSWL
MDTB_PHOLL      ETIRTAINNANVNSAKGSLDGPTRSVTLSANDQMKSVNDYRNLIIAYKNGSPVRLQDVATIEQGAENTKL
ACRD_ECOLI      KDVTDAIESQNAQIAVGQVDKQALNATINAQSLLQTPEQFRDITLRNQDGSEVRLGDVATVEMGAEKYDY
MDTC_PECCP      DEVRQAIAQANVRQPLGNVENSQKSWQIKTNDELKTADAYAPLIIHYNNGAAVRLSDVATVEDSVQNSRN
Y895_HAEIN      PTVMSALSANNVQTAAGNDNGYYVSYRNKVETTTKSVEQLSNLIISSNGDDLVRLRDIATVELNKENDNS
MDTC_PHOLL      DAVRKAISNANVRRPQGYVDSEQQHWQIQMNDELKTAENYRPIIVHYNNNSPVRLQDVANVKDSVQNVRA
MDTC_YERPY      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERPS      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERPB      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERP3      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_SERP5      DAVRQTISNANVRRPQGSVENQQQRWQIQANDELKTAEVYRPLIIHYNNGSAVRLSDVAEVNDSVQDVRN
MDTC_ERWCT      DEVRQAIAQANVRQPLGNVENSQKRWQIQTNDELKTADAYAPLIIHYSNGAAVRLSDVATVEDSVQNSRN
MDTC_YERPN      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERPG      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERPE      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERPA      DAVRQAISAANVRRPQGSVDAAETHWQVQANDEIKTAEGYRPLIVHYNNGSPVRLQDVANVIDSVQDVRN
MDTC_YERE8      DAVRQAISAANVRRPQGSIDSSEQHWQVQANDEIKTAEGYRPLIIHYNNGSPVRLQDVANIVDSVQDVRN
ACRF_ECOLI      VDVINQLKVQNDQIAAGQLGGTGQQLNASIIAQTRNPEEFGKVTLRNSDGSVVRLKDVARVELGGENYNV
MDTC_ENT38      DDVRSAISNANVRKPQGAIEDSSHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLSDVASVTDSVQDVRN
MDTC_ENTS8      DTVRSAISNANVRRPQGAIEDAQRRWQLQTNDELKTAAEYEPLIVHYNNGAAVHLRDVATVTDSVQDVRN
MDTC_KLEP7      DAVRTAISDANVRKPQGALEDSAHRWQVQTNDELKTAADYQPLIVHYQNGAAVRLGDVATVSDSVQDVRN
MDTC_KLEP3      DAVRTAISDANVRKPQGALEDSAHRWQVQTNDELKTAADYQPLIVHYQNGAAVRLGDVATVSDSVQDVRN
ACRB_ECOLI      VDVITAIKAQNAQVAAGQLPVKGQQLNASIIAQLTSTEEFGKILLKNQDGSRVLLRDVAKIELGGENYDI
SWRC_BACSU      ----------------------------------------------------VKLSDIATIKDVKKAESV
MDTC_SALAR      DEVRKAIDSANVRRPQGAIEDNVHRWQIQTNDELKTAAEYQPLIIHYKNGAAVRLDDVASVTDSVQDVRN
MDTC_ERWT9      DAVRSTIANANVRKPQGAIEDSQLRWWIKTNDELHTAAEYRPLVIHYRNGAAVRLQDVATVTDSVQDVRN
MDTC_ECOSE      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO8A      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SHIBS      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SALPC      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALCH      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTF_ECO57      SDVISQIKVQNNQISGGQLQQLNASIIVQT--RLQTPEEFGKILLKQQDGSQVLLRDVARVELGAEDYST
MDTC_ESCF3      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOLU      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO5E      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO57      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO55      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO24      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SHIB3      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SALNS      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
TTGH_PSEPU      TDVASAIREQNVQVSSGQLTRSGVQLNATVLGKMTTPSQFDEILVKNPDGSQVRVKDVGRAELGADSFAI
SRPB_PSEPU      TDVASAIREQNVQVSSGQLTRSGVQLNATVLGKMTTPSQFDEILVKNPDGSQVRVKDVGRAELGADSFAI
MDTC_SHISS      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SHIFL      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SHIF8      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SALTY      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALTI      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALSV      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALPK      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALPB      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALPA      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALEP      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALDC      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_SALA4      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
SEPB_PSEP1      GDVAQAIREQNVQVSSGQLTRSGVQLNATVVGKTAEFEEI--LVKVKADGSQVRVKDLGRVVLASENFAI
MDTF_ECOL6      SDVISQIKVQNNQISGGQLQQLNASIIVQT--RLQTPEEFGKILLKQQDGSQVLLRDVARVELGAEDYST
MDTC_SALHS      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_ECOSM      DDVRTAISNANVRKPQGVLEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOLC      DDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOL5      DDVRTAISNANVRKPQGALEDDTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOHS      DDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO81      DDVRTAISNANVRKPQGALEDDTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOUT      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOL6      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOK1      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO45      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO27      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_SALG2      DEVREAIDSANVRRPQGAIEDSVHRWQIQTNDELKTAAEYQPLIIHYNNGAAVRLGDVASVTDSVQDVRN
MDTC_ECOLI      DDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECODH      DDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECOBW      DDVRTAVSNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTC_ECO7I      DDVRTAISNANVRKPQGALEDGTHRWQIQTNDELKTAAEYQPLIIHYNNGGAVRLGDVATVTDSVQDVRN
MDTF_ECOLI      SDVISQIKVQNNQISGGQLQQLNASIIVQT--RLQTPEEFGKILLKQQDGSQVLLRDVARVELGAEDYST
MDTC_CITK8      DDVRSAISNANVRKPQGAIDDKTHRWQVQTNDELKTATEYQPLIIHYNNGAAVRLGDVATVTDSVQDVRN
TTGE_PSEPU      GDVAQAIREQNVQVSSGQLTRSGVQLNATVVGKTAEFEEI--LVKVKADGSQVRVKDLDRVVLASENFAI
YCBL_BACUN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AATVSGKEVVLGTAMLLIGENGRTVAQRVAAKLEQIQKSLPEGISLRAIYDRTHLIDATIATVEKNLIEG
HELA_LEGPN      AATENSKEVVLGTVFILMGENSRTVSERVAAKMKDINKTLPEGVEAITVYNRTTLVNATINTVKNNLLEG
CZCA_ALCSC      AATENGKEVVLGTVFMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEG
CZCA_RALME      AATENGKEVVLGTVFMLIGENSRAVSKAVDEKVASINRTMPEGVKIVTVYDRTRLVDKAIATVKKNLLEG
NCCA_ALCXX      AASRNGYETVVGSALMLVGANSRTVAQAVGDKLEEIKKTLPPGVVIVPTLNRSQLVMATIKTVAKNLVEG
CNRA_RALME      AASRNGNETVVGSALMLVGANSRTVAQAVGDKLEQISKTLPPGVVIVPTLNRSQLVIATIETVAKNLIEG
CUSA_ECOL6      IAELNGEEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEE
CUSA_ECO57      IAELNG-EVVGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEE
CUSA_ECOLI      IAELNGEEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSGKLLEE
SILA_SALTY      IAELNGQEVAGGVVILRSGKNARDVITAVRDKLETLKASLPEGVEIVTTYDRSQLIDRAIDNLSSKLLEE
NOLG_RHIME      LANYQG-QTTLGLHIVKVGANTVEVASAVRREVSALNAELKDNVQLTITRDNSRPIASQVSQVQRTLVEG
MDTB_YERPE      AAWANTQSAIVLNIQRQPGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFEXXXX
MDTB_YERPS      AAWANTQSAIVLNIQRQPGVNVIATADSIREMLPELIKSLPKSVDVKVLTDRTSTIRASVNDVQFEXXXX
MDTB_SHISS      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOSE      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO5E      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO57      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO24      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO8A      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMA
MDTB_ECO7I      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_SHIB3      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVEVTVLSDRTTNIRASVDDTQCELMMA
MDTB_ECOL5      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_SHIFL      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_SHIBS      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOUT      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOSM      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOL6      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOK1      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO81      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO55      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECO45      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MEXB_PSEAE      NAQFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHEVVKTLGEA
MDTB_ECOLU      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMA
TTGB_PSEPU      SAQFNGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEA
TTGB_PSEPK      SAQFNGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEA
MEPB_PSEPU      SAQFNGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEA
ARPB_PSEPU      SAQFNGKPASGLAVKLATGANALDTAKALRETIKGLEPFFPPGVKAVFPYDTTPVVTESISGVIHTLIEA
MDTB_SERP5      AAWANKQPAIVLNIQRQPGVNVITTADSIREMLPQLIKSLPKSVDVKVLTDRTTTIRASVSDVQFEXXXX
MDTB_ECO27      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ESCF3      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVNDTQFELMMA
MDTB_ECOLI      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOLC      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECODH      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ECOBW      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_SALAR      GAWANKAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_ECOHS      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVDDTQFELMMA
MDTB_ENT38      GAWANKEQAIVMNVQRQPGANIIDTADSIRAMLPQLIESLPKSVNVKVLSDRTTNIRASVSDTQFELMLA
MDTB_ERWCT      GAWANRQQAIIINVQRQPGANVITTTDSINKMLPALKASLPNSVEVATLTDRTTSIRASVKDVQFEXXXX
MDTB_CITK8      GAWANKEQAIVMNVQRQPGANIISTADSIRQMLPQLTESLPKSVNVTVLSDRTTNIRASVTDTQFELMLA
MDTB_SALTI      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_KLEP7      GAWANQQRAIVMNVQRQPGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLA
MDTB_SALPB      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALEP      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALDC      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALHS      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALA4      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALG2      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALSV      GAWANQAPANVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALNS      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_KLEP3      GAWANQQRAIVMNVQRQPGANIIDTADSIRQMLPQLTESLPKSVKVQVLSDRTTNIRASVRDTQFELMLA
MDTB_SALPK      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALPA      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALTY      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_SALPC      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRTSVRDTQFELMLA
MDTB_ENTS8      GAWANKQPAIVMNVQRQPGANIITTAETIQKLLPQLTESLPKSVQVKVLTDRTTNISASVNDTQFELMLA
MDTB_SALCH      GAWANQAPAIVMNVQRQPGANIIATADSIRQMLPQLTESLPKSVKVTVLSDRTTNIRASVRDTQFELMLA
MDTB_PHOLL      GAWSNNTQAIVINVQRQPGANVIETTDNIRQMLPELISSLPKSVDMKILTDRTTTIRASVKDVQFEXXXX
ACRD_ECOLI      LSRFNGKPASGLGVKLASGANEMATAELVLNRLDELAQYFPHGLEYKVAYETTSFVKASIEDVVKTLLEA
MDTC_PECCP      AGMANAKPAILVMIRRAPDANIITTVDNIRAAMPELRASLPAEIQLDVAQDRSPTIRASLAEVEQSXXXX
Y895_HAEIN      RATANGAESVVLAINPTSTANPLTVAEKIRPLYESIKTQLPDSMESDILYDRTIAINSSIHEVIKTIGEA
MDTC_PHOLL      AGMSGGEPAILLIIRREAGANIIATVNRIREQLPALHESIPASIQLKVAQDRTPTIRASIVEVERXXXXX
MDTC_YERPY      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERPS      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERPB      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERP3      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_SERP5      AGMTNAKPAIILTISRAPDANIIETVDRIRAELPTLQNNIPASIQLNIAQDRSPTIRASLAEVEQSXXXX
MDTC_ERWCT      AGMANSKPAILVMIRRAPDANIITTVDNIRAAMPELRASLPAEIQLDVAQDRSPTIRASLAEVEQSXXXX
MDTC_YERPN      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERPG      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERPE      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERPA      AGMSAGQPAVLLVISREPGANIIATVDRIRAELPALRASIPASIQLNIAQDRSPTIRASLDEVERSXXXX
MDTC_YERE8      AGMSDGKPAVLLVISREPGANIIATVDRIRAELPALRASIPASIELNIAQDRSPTIRASLDEVERSXXXX
ACRF_ECOLI      IARINGKPAAGLGIKLATGANALDTAKAIKAKLAELQPFFPQGMKVLYPYDTTPFVQLSIHEVVKTLFEA
MDTC_ENT38      AGMTNAKPAILLMIRKLPEANIIQTVNSIRARLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ENTS8      AGMTNAKPAILLMIRKLPEANIIETVDRIRAALPELRDTIPAAIDMQIAQDRSPTIRASLAEVEQSLAIS
MDTC_KLEP7      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQQTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_KLEP3      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQQTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
ACRB_ECOLI      IAEFNGQPASGLGIKXXXXXXXXXXXXXIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEVVKTLVEA
SWRC_BACSU      SRT-NGKDSIGINIVKANDANTVEVADDVKAELKKFKED-HKGFNYSATLDMAEPITQSVDTMLSKXXXX
MDTC_SALAR      AGMTNAKPAILLMIRKLPETNIIQTVDSIRAKLPELQAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_ERWT9      AGMSNARPAVLLVIRKSPQANIIDTVDRIRGEVPELRNTLPASIGLDIAQDSSRTIRASLHEVEQXXXXX
MDTC_ECOSE      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO8A      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SHIBS      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SALPC      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETLAIS
MDTC_SALCH      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETLAIS
MDTF_ECO57      VARYNGKPAAGIAIKLATGANALDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIEISIQEVFKTLVE-
MDTC_ESCF3      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOLU      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO5E      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO57      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO55      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO24      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SHIB3      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SALNS      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
TTGH_PSEPU      SAQYKDSPTASLALRLSTGGNLLETVDAVKKLMEQQKAYLPDGVEVIYPYDTTPVVEASIESVVHTIFEA
SRPB_PSEPU      SAQYKDSPTASLALRLSTGGNLLETVDAVKKLMEQQKAYLPDGVEVIYPYDTTPVVEASIESVVHTIFEA
MDTC_SHISS      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SHIFL      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SHIF8      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SALTY      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALTI      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALSV      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALPK      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALPB      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALPA      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALEP      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALDC      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_SALA4      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
SEPB_PSEP1      SAKYRGQDXXXXXXXXXXXXXXXETVKAVKAELEKQKAYLPEGVEVIYPYDTSPVVEASIDSVVHTILE-
MDTF_ECOL6      VARYNGKPAAGIAIKLATGANALDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIKISIQEVFKTLVE-
MDTC_SALHS      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_ECOSM      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOLC      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOL5      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOHS      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO81      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOUT      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOL6      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOK1      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO45      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO27      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_SALG2      AGMTNAKPAILLMIRKLPEANIIQTVDGIRAKLPELRAMIPAAIDLQIAQDRSPTIRASLQEVEETXXXX
MDTC_ECOLI      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECODH      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECOBW      AGMTNAKPAILLMIRKLPEANIIQTVDSIRAKLPELQETIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTC_ECO7I      AGMTNAKPAILLMIRKLPEANIIQTVDSIRARLPELQSTIPAAIDLQIAQDRSPTIRASLEEVEQTXXXX
MDTF_ECOLI      VARYNGKPXXXXXXXXXXXXXXXDTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIEISIQEVFKTLVE-
MDTC_CITK8      AGMTNAKPAILLMIRKLPEANIIQTVDSIREKLPELQTLIPASIDLQIAQDRSPTIRASLEEVEQTXXXX
TTGE_PSEPU      SAKYRGQDXXXXXXXXXXXXXXXETVKAVKAELEKQKAYLPEGVEVIYPYDTSPVVEASIDSVVHTILE-
YCBL_BACUN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXXXXXGNIKAAFATALVIPLSMLFTITGMFENKVSANLMSLGXXXXXXXXXXXXXXXENCLRL
HELA_LEGPN      ALLVCVILFLFLGNIRAALITAMVIPLSMLLTITGMVENQISANLMSLGALDFGLIVDGAVIIVENCIKH
CZCA_ALCSC      AXXXXXXXXXXXGNXXXXXXXXXXXXXXMLFTFTGMVNYKISANLMSLGALDFGIIIDGAVVIVENCVRR
CZCA_RALME      AXXXXXXXXXXXGNXXXXXXXXXXXXXXMLFTFTGMVNYKISANLMSLGALDFGIIIDGAVVIVENCVRR
NCCA_ALCXX      XXXXXXXXXXXXGNWRAAVIAALVIPLSLLISAIGMNGLNISGNLMSLGALDFGLIIDGAVIIVENSLRR
CNRA_RALME      XXXXXXXXXXXXGNWRAATIAALVIPLSLLVSAIGMNQFHISGNLMSLGALDFGLIIDGAVIIVENSLRR
CUSA_ECOL6      FIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGAIAVGAMVDAAIVMIENAKRL
CUSA_ECO57      FIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGAIAVGAMVDAAIVMIENAKRL
CUSA_ECOLI      FIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGAIAVGAMVDAAIVMIENAKRL
SILA_SALTY      FFVVAIVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGAIAVGAMVDAAIVMIENAKRL
NOLG_RHIME      GVLSVLIVFIFLNSWRSTVITGLTLPISVIGTFAAIYALGFTLNIMTLMALSLSIGILIDD-------AI
MDTB_YERPE      XXXXXXXXXXFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVENISRY
MDTB_YERPS      XXXXXXXXXXFLRNAAATIIPSIAVPLSLVGTFAAMYFLGFSINNLTLMALTIATGFVVDDAIVENISRY
MDTB_SHISS      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOSE      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO5E      ITLVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO57      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO24      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO8A      IALVVMIIYLFLRNIPATIIPGFAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO7I      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SHIB3      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOL5      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SHIFL      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SHIBS      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOUT      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOSM      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOL6      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOK1      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO81      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO55      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO45      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MEXB_PSEAE      ILLVFLVMYLFLQNFRATLIPTIAVPVVLLFGVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERV
MDTB_ECOLU      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
TTGB_PSEPU      XXXXXXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVENVERV
TTGB_PSEPK      XXXXXXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVENVERV
MEPB_PSEPU      XXXXXXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVENVERV
ARPB_PSEPU      XXXXXXXXXXXXQNFRATIITTMTVPVVLLGTFGILAAAGFSINTLTMFAMVLAIGLLVDDAIVENVERV
MDTB_SERP5      XXXXXXXXXXXXRNVPATIIPSVAVPLSLIGTFAAMYFLGFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECO27      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ESCF3      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOLI      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOLC      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECODH      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOBW      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALAR      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ECOHS      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ENT38      MALVVMIIYVFLRNVPATIIPAVAVPLSLVGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ERWCT      XXXXXXXXXXFLRNAVATLIPSIAVPLSLVGTFAAMYFLGFSINLMAL-TIATGFVVDDAIVVIENIARY
MDTB_CITK8      IALVVMIIYLFLRNVPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALTI      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_KLEP7      IALVVMIIYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALPB      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALEP      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALDC      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALHS      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALA4      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALG2      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALSV      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALNS      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_KLEP3      IALVVMIIYLFLRNVPATIIPGVAVPLSLVGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALPK      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALPA      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALTY      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALPC      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_ENTS8      IALVVMIIYLFLRNIPATIIPAVAVPLSLVGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_SALCH      IALVVMIIYLFLRNIPATIIPGVAVPLSLIGTFAVMVFLDFSINLMAL-TIATGFVVDDAIVVIENISRY
MDTB_PHOLL      XXXXXXXXXXFLRNGIATLIPSIAVPLSLIGTFAVMYFCGFSVNLMAL-TIATGFVVDDAIVVIENISRY
ACRD_ECOLI      IALVFLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFGYSVNTLTM----------------------
MDTC_PECCP      XXXXXXXXXXXXRSGRATAIPALAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
Y895_HAEIN      TLIVLVVILMFIGSFRXXXXXXXXXXXXXXGVLMLLQSFNFSINLMT-----XXXXXXXXXXXXDDAIVV
MDTC_PHOLL      XXXXXXXXXXXXRSGRATLIPAIAVPVSLIGTFTAMYLCGFSLNNLSL-----MALTVATGFVVDDAIVV
MDTC_YERPY      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERPS      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERPB      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERP3      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_SERP5      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGSFTAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_ERWCT      XXXXXXXXXXXXRSWRATAIPALAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_YERPN      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERPG      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERPE      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERPA      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
MDTC_YERE8      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFTAMYLCGFSLNNLSL-----MALTIATGFVVDDAIVV
ACRF_ECOLI      IMLVFLVMYLFLQNMRATLIPTIAVPVVLLGTFAILAAFGYSINTLTM----------------------
MDTC_ENT38      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ENTS8      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_KLEP7      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_KLEP3      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
ACRB_ECOLI      IILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTM----------------------
SWRC_BACSU      XXXXXXXXXXXXRDIKSTXXXXXXXXXXXXXXXXXXXXXDITLNIMTLGAMTVAIGRVVDDSIVENIYRR
MDTC_SALAR      XXXXXXXXXXXXRSGRATLIPAVAVPVSLISTFAAMYLCGFSLNNLSL----------------------
MDTC_ERWT9      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSLMTVATGFVVDDAIVVLENISR-
MDTC_ECOSE      XXXXXXXXXXXXRSGRATIIPAVVVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO8A      XXXXXXXXXXXXRSGRATIIPAVVVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SHIBS      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALPC      VALVIMVVFLFLRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALCH      VALVIMVVFLFLRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTF_ECO57      ----------------------------------------------------------------------
MDTC_ESCF3      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOLU      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO5E      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO57      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO55      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO24      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SHIB3      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALNS      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
TTGH_PSEPU      XXXXXXXXXXXXQSFRATLIPTLAVPVVLLFALLPYFGLNINVLTMYAMVLAIGLLVDDAIVVVENVERL
SRPB_PSEPU      XXXXXXXXXXXXQSFRATLIPTLAVPVVLLFALLPYFGLNINVLTMYAMVLAIGLLVDDAIVVVENVERL
MDTC_SHISS      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SHIFL      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SHIF8      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALTY      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALTI      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALSV      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALPK      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALPB      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALPA      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALEP      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALDC      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALA4      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
SEPB_PSEP1      ----------------------------------------------------------------------
MDTF_ECOL6      ----------------------------------------------------------------------
MDTC_SALHS      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOSM      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOLC      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOL5      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOHS      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO81      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOUT      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOL6      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOK1      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO45      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO27      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_SALG2      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOLI      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECODH      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECOBW      XXXXXXXXXXXXRSGRATIIPAVSVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTC_ECO7I      XXXXXXXXXXXXRSGRATIIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
MDTF_ECOLI      ----------------------------------------------------------------------
MDTC_CITK8      XXXXXXXXXXXXRSGRATLIPAVAVPVSLIGTFAAMYLCGFSLNNLSL----------------------
TTGE_PSEPU      ----------------------------------------------------------------------
YCBL_BACUN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LAHEQQRRGRLLTREERFETIIAGAREVIKPSLFGTLIIAVVYLPVLTLTGVEGKMFTPMAXXXXXXXXX
HELA_LEGPN      LAEQQHALHRVLNLEERLKVISYATTEVIRPSIFGVFIITVVYLPILTLTGVEGKMFLPMAQTVIIALLA
CZCA_ALCSC      LAHAQEHHGRPLTRSERFHEVFAAAKEARRPLIFGQLIIMIVYLPIFALTGVEGKMFHPMAFTVVLALLG
CZCA_RALME      LAHAQEHHGRPLTRSERFHEVFAAAKEARRPLIFGQLIIMIVYLPIFALTGVEGKMFHPMAFTVVLALLG
NCCA_ALCXX      LAERQHHEGRLLTLKERLEEVILSSREMVRPTVYGQLVIFMVFLPCLTFQGVEGKMFSPMVITLMLALAS
CNRA_RALME      LAERQHREGRLLTLDERLQEVVQSSREMVRPTVYGQLVIFMVFLPCLTFQGVEGKMFSPMVITLMLALAS
CUSA_ECOL6      EEWQHQHPDATLDNKTRWQVITDASVEVGPAXXXXXXXXXXXXXXXXXXEGQEGRLFGPLAFTKTYAMAG
CUSA_ECO57      EEWQHQHPDATLDNKTRWQVITNASVEVGPAXXXXXXXXXXXXXXXXXXEGQEGRLFGPLAFTKTYAMAG
CUSA_ECOLI      EEWQHQHPDATLDNKTRWQVITDASVEVGPAXXXXXXXXXXXXXXXXXXEGQEGRLFGPLAFTKTYAMAG
SILA_SALTY      EEWDHRHPGEQIDNVTRWKVITDASVEVGPAXXXXXXXXXXXXXXXXXXEGQEGRLFGPLAFTKTYSMXX
NOLG_RHIME      VVRENITR-HLQMGKDPVRAALDGTNEIGLAVLSTTLCIVAVFLPVAFMGGLIGRFFLQFGVTVAVAVVI
MDTB_YERPE      I-----EKG-----EKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLAVAILI
MDTB_YERPS      I-----EKG-----EKPLDAALKGAGEIGFTIISLTFSLIAVLIPLLFMEDIVGRLFREFAVTLAVAILI
MDTB_SHISS      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOSE      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO5E      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO57      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO24      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO8A      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO7I      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_SHIB3      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOL5      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_SHIFL      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_SHIBS      I-----EKG-----EKPLAAALKGAGEIGFTIISLIFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOUT      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOSM      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOL6      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOK1      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO81      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO55      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECO45      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MEXB_PSEAE      MAEEG-----LSPREAARKSM-----GQIQGALVGAMVLSAVFLPMAFFGGSTGVIYRQFSITIVSAMAL
MDTB_ECOLU      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
TTGB_PSEPU      MSEEGLPPKEATKR----------SMEQIQGALVGALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
TTGB_PSEPK      MSEEGLPPKEATKR----------SMEQIQGALVGALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
MEPB_PSEPU      MSEEGLPPKEATKR----------SMEQIQGALVGALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
ARPB_PSEPU      MSEEGLPPKEATKR----------SMEQIQGALVGALVLSAVLLPMAFFGGSTGVIYRQFSITIVSAMGL
MDTB_SERP5      I-----EKG-----EKPLDAALKGAGEIGFTIISLTFSLVAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_ECO27      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ESCF3      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOLI      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOLC      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECODH      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ECOBW      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_SALAR      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_ECOHS      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAITLAVAILI
MDTB_ENT38      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_ERWCT      I-----EKG-----EKPLNAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVSILI
MDTB_CITK8      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALTI      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_KLEP7      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALPB      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALEP      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALDC      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALHS      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALA4      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALG2      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALSV      I-----EKG-----EKPLAAALKGAGEIGFTIISLTFSLIAVLIPLLFMGDIVGRLFREFAVTLAVAILI
MDTB_SALNS      I-----EKG