[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39396.1

[Show Plain Result]


## Summary of Sequence Search
    1::313
  460::747     1e-19  29%  759 aa  Y963_MYCBO RecName: Full=Putative DNA ligase-like protein Mb0963;
  460::747     1e-19  29%  759 aa  Y938_MYCTU RecName: Full=Putative DNA ligase-like protein
  243::489     7e-17  33%  582 aa  DNLI_DICTD RecName: Full=Probable DNA ligase;       
  243::489     3e-16  32%  582 aa  DNLI_DICT6 RecName: Full=Probable DNA ligase;       
  210::424     6e-16  34%  503 aa  DNLI_RHOOB RecName: Full=Probable DNA ligase;       
  211::446     4e-15  33%  533 aa  DNLI_SORC5 RecName: Full=Probable DNA ligase;       
  315::428     7e-15  40%  523 aa  DNLI_NOCFA RecName: Full=Probable DNA ligase;       
  300::447     1e-14  37%  509 aa  DNLI_NOCSJ RecName: Full=Probable DNA ligase;       
  294::424     9e-14  38%  503 aa  DNLI_RHOSR RecName: Full=Probable DNA ligase;       
  215::441     5e-13  30%  519 aa  DNLI_MYCPA RecName: Full=Probable DNA ligase;       
  222::448     5e-13  30%  526 aa  DNLI_MYCA1 RecName: Full=Probable DNA ligase;       
  207::412     8e-13  28%  520 aa  DNLI_MYCSS RecName: Full=Probable DNA ligase;       
  207::412     8e-13  28%  520 aa  DNLI_MYCSK RecName: Full=Probable DNA ligase;       
  207::412     8e-13  28%  520 aa  DNLI_MYCSJ RecName: Full=Probable DNA ligase;       
  208::444     4e-12  37%  512 aa  DNLI_STRAW RecName: Full=Probable DNA ligase;       
  186::449     5e-12  27%  512 aa  DNLI_BEUC1 RecName: Full=Probable DNA ligase;       
    2::195     7e-12  28%  270 aa  LIGB_BACSU RecName: Full=SPBc2 prophage-derived DNA ligase-like
  248::494     1e-11  28%  588 aa  DNLI_THEVO RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  207::446     1e-11  26%  534 aa  DNLI_MYCVP RecName: Full=Probable DNA ligase;       
  342::480     2e-11  39%  589 aa  DNLI_CENSY RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  212::441     3e-11  29%  503 aa  DNLI_KINRD RecName: Full=Probable DNA ligase;       
  244::461     4e-11  30%  550 aa  DNLI_METB6 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  339::472     7e-11  33%  561 aa  DNLI_PYRFU RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  341::481     2e-10  35%  548 aa  DNLI_NATPD RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  247::472     2e-10  26%  559 aa  DNLI_PYRAB RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  206::428     2e-10  28%  509 aa  DNLI_MYCS2 RecName: Full=Probable DNA ligase;       
  215::449     2e-10  28%  513 aa  DNLI_ANADE RecName: Full=Probable DNA ligase;       
  233::485     2e-10  28%  576 aa  DNLI_ACIBL RecName: Full=Probable DNA ligase;       
  323::469     3e-10  33%  541 aa  DNLI1_KORCO RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  203::444     4e-10  29%  512 aa  DNLI_STRCO RecName: Full=Probable DNA ligase;       
  339::483     5e-10  32%  559 aa  DNLI_THEFM RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  209::435     6e-10  25%  513 aa  DNLI_MYCMM RecName: Full=Probable DNA ligase;       
  329::413     1e-09  38%  546 aa  DNLI_METLZ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  248::494     2e-09  26%  588 aa  DNLI_THEAC RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  244::461     2e-09  29%  547 aa  DNLI_METHJ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  337::485     2e-09  34%  583 aa  DNLI_PYRCJ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  203::429     2e-09  26%  507 aa  DNLI_MYCTU RecName: Full=Probable DNA ligase;       
  203::429     2e-09  26%  507 aa  DNLI_MYCTA RecName: Full=Probable DNA ligase;       
  203::429     2e-09  26%  507 aa  DNLI_MYCBT RecName: Full=Probable DNA ligase;       
  203::429     2e-09  26%  507 aa  DNLI_MYCBP RecName: Full=Probable DNA ligase;       
  203::429     2e-09  26%  507 aa  DNLI_MYCBO RecName: Full=Probable DNA ligase;       
  247::472     3e-09  26%  559 aa  DNLI_PYRHO RecName: Full=Probable thermostable DNA ligase;       
  337::469     3e-09  33%  555 aa  DNLI_ARCFU RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  215::449     3e-09  29%  513 aa  DNLI_ANAD2 RecName: Full=Probable DNA ligase;       
  243::432     7e-09  24%  584 aa  DNLI_PYRAR RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  213::431     7e-09  25%  519 aa  DNLI_ANADF RecName: Full=Probable DNA ligase;       
  310::457     7e-09  27%  531 aa  DNLI1_THEPD RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  339::472     9e-09  32%  559 aa  DNLI_PYRKO RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  334::480     9e-09  30%  552 aa  DNLI_METTP RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  247::494     2e-08  27%  585 aa  DNLI_PICTO RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  295::406     2e-08  33%  507 aa  DNLI_ARTCA RecName: Full=Probable DNA ligase;       
  342::490     3e-08  36%  561 aa  DNLI_HALSA RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  342::490     3e-08  36%  561 aa  DNLI_HALS3 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  337::479     3e-08  37%  584 aa  DNLI_AQUAE RecName: Full=Probable DNA ligase;       
  209::396     8e-08  25%  513 aa  DNLI_MYCUA RecName: Full=Probable DNA ligase;       
  328::409     1e-07  33%  510 aa  DNLI_SACEN RecName: Full=Probable DNA ligase;       
  337::475     1e-07  36%  567 aa  DNLI_NANEQ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  337::477     2e-07  35%  582 aa  DNLI_PERMH RecName: Full=Probable DNA ligase;       
  334::468     2e-07  32%  548 aa  DNLI_METMJ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  346::483     2e-07  31%  568 aa  DNLI2_METAC RecName: Full=DNA ligase 2;         EC=6.5.1.1;AltName:
  341::482     3e-07  33%  594 aa  DNLI2_KORCO RecName: Full=DNA ligase 2;         EC=6.5.1.1;AltName:
  243::432     4e-07  26%  584 aa  DNLI_PYRIL RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  346::483     4e-07  32%  568 aa  DNLI2_METMA RecName: Full=DNA ligase 2;         EC=6.5.1.1;AltName:
  811::954     7e-07  35% 1070 aa  DNLI1_XENLA RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  658::801     7e-07  36%  919 aa  DNLI1_HUMAN RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  346::483     9e-07  34%  568 aa  DNLI2_METBF RecName: Full=DNA ligase 2;         EC=6.5.1.1;AltName:
  337::492     1e-06  28%  568 aa  DNLI_UNCMA RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  215::449     1e-06  25%  513 aa  DNLI_ANASK RecName: Full=Probable DNA ligase;       
  243::432     1e-06  24%  584 aa  DNLI_THENV RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  353::495     1e-06  31%  603 aa  DNLI_CALMQ RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  378::483     2e-06  31%  944 aa  DNLI4_YEAST RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  374::479     2e-06  39%  907 aa  DNLI4_KLULA RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  348::503     2e-06  32%  598 aa  DNLI_SULAC RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  337::432     2e-06  29%  584 aa  DNLI_PYRAE RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  352::494     2e-06  36%  602 aa  DNLI_AERPE RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  349::506     2e-06  28%  600 aa  DNLI_ACIAM RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  392::476     3e-06  33%  923 aa  DNLI4_SCHPO RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  534::677     3e-06  34%  790 aa  DNLI1_ARATH RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  348::505     4e-06  31%  600 aa  DNLI_SULTO RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  378::480     4e-06  33%  588 aa  DNLI_NITMS RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  393::502     4e-06  34%  946 aa  DNLI4_CANGA RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  352::495     4e-06  35%  601 aa  DNLI2_THEPD RecName: Full=DNA ligase 2;         EC=6.5.1.1;AltName:
  426::514     1e-05  35%  979 aa  DNLI4_ASPFU RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  383::524     2e-05  33%  594 aa  DNLI_HALLT RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  312::399     2e-05  38%  552 aa  DNLI_VACCW RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  312::399     2e-05  38%  552 aa  DNLI_VACCC RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  312::399     2e-05  38%  552 aa  DNLI_VACCA RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  343::442     2e-05  30%  511 aa  DNLI_MYCGI RecName: Full=Probable DNA ligase;       
  842::1077    2e-05  31% 1192 aa  DNLI1_DICDI RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  352::493     4e-05  33%  597 aa  DNLI_STAMF RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  432::520     4e-05  34%  990 aa  DNLI4_PHANO RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  416::504     4e-05  35%  985 aa  DNLI4_COCIM RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  312::399     6e-05  37%  552 aa  DNLI_VARV RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  406::515     6e-05  35%  928 aa  DNLI4_CANAL RecName: Full=DNA ligase 4;         Short=CaLIG4;      
  383::489     8e-05  32%  561 aa  DNLI_METTH RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  349::506     8e-05  28%  598 aa  DNLI_METS5 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  420::525     8e-05  36%  981 aa  DNLI4_ASHGO RecName: Full=DNA ligase 4;         EC=6.5.1.1;AltName:
  506::650     8e-05  31%  768 aa  DNLI1_SCHPO RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  340::495     8e-05  28%  579 aa  DNLI1_METMA RecName: Full=DNA ligase 1;         EC=6.5.1.1;AltName:
  338::490     1e-04  31%  557 aa  DNLI_METTF RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  340::489     1e-04  34%  573 aa  DNLI_METM6 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  352::499     1e-04  30%  567 aa  DNLI_METBU RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  340::489     1e-04  35%  573 aa  DNLI_METM7 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  821::890     4e-04  36% 1017 aa  DNLI_OPITP RecName: Full=Probable DNA ligase;       
  341::490     4e-04  23%  562 aa  DNLI_META3 RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
  336::428     7e-04  28%  556 aa  DNLI_METPE RecName: Full=DNA ligase;         EC=6.5.1.1;AltName:
    1::313

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxGAVPAPMPGFVQPQLATLRTRPPSGAGWIHEIKLDGYRGQAHVGPQGTRIYTRGGHD
Y963_MYCBO      -------------------------PMLATHGTVAGLKASWAFEGKWDGYRLLVEADHGAVRLRSRSGRD
Y938_MYCTU      -------------------------PMLATHGTVAGLKASWAFEGKWDGYRLLVEADHGAVRLRSRSGRD
DNLI_DICTD      -------------------------------------------EPKFDGFRCQIHKKENNVRIFSRNLED
DNLI_DICT6      -------------------------------------------EPKFDGFRCQIHKKENSVRIFSRNLED
DNLI_RHOOB      -------------------------------------------EYKLDGARIQVHRNGDEVRIFTRTLRE
DNLI_SORC5      -------------------------------------------EWKLDGVRVQAHKAGDEVRVFSRGLGP
DNLI_NOCFA      ----------------------------------------------------------------------
DNLI_NOCSJ      ----------------------------------------------------------------------
DNLI_RHOSR      ----------------------------------------------------------------------
DNLI_MYCPA      -------------------------------------GGQAIFEAKLDGARVQIHRAGDQVTVYTRSLDD
DNLI_MYCA1      -------------------------------------GGQAIFEAKLDGARVQIHRAGDQVTVYTRSLDD
DNLI_MYCSS      -------------------------------------GGTAVFEAKLDGARVQIHRRGSDVSVYTRSLDD
DNLI_MYCSK      -------------------------------------GGTAVFEAKLDGARVQIHRRGSDVSVYTRSLDD
DNLI_MYCSJ      -------------------------------------GGTAVFEAKLDGARVQIHRRGSDVSVYTRSLDD
DNLI_STRAW      -------------------------------------------EEKLDGIRVQLHRDGDHVRIYTRTLDD
DNLI_BEUC1      -------------GRAVRPMLAQSAPDVAAAFAKLPGGDVAVSDVKLDGIRIQVHKAGDEVRVFTRSLDD
LIGB_BACSU      ----------------------FVSPMLLHSIKEPFNDENYITELKFDGIRLILSKFDNQIKLYTRHNNE
DNLI_THEVO      -------------------------------------------EYKYDGMRTEIHIVDEKVRLFSRGNEE
DNLI_MYCVP      -------------------------------------GGTALFEAKLDGARVQIHRRGDAVSVFTRSLDD
DNLI_CENSY      ----------------------------------------------------------------------
DNLI_KINRD      -------------------------------------------DTKLDGIRIQVHRGPEGVRIATRTLED
DNLI_METB6      -------------------------------------------EYKYDGSRFQFHKEGAKARMYSRRLED
DNLI_PYRFU      ----------------------------------------------------------------------
DNLI_NATPD      ----------------------------------------------------------------------
DNLI_PYRAB      -------------------------------------------EIKYDGARVQVHKDGEKVTIYSRRLEN
DNLI_MYCS2      -------------------------------------GGTAVLEAKLDGARVQIHRSGCDVSIYTRSLDD
DNLI_ANADE      ---------------------------------------------KLDGARIQAHRDGEAVRVFSRSLRD
DNLI_ACIBL      -----------------------------------------IVEDKYDGIRAQAHISRDKVRIFSRTLDD
DNLI1_KORCO     ----------------------------------------------------------------------
DNLI_STRCO      -------------------------------------GAAAVEE-KLDGIRVQVHRDGGTVRIYTRTLDD
DNLI_THEFM      ----------------------------------------------------------------------
DNLI_MYCMM      -------------------------------------GGATIFEAKLDGARVQIHRTGDEVTVYTRSLDD
DNLI_METLZ      ----------------------------------------------------------------------
DNLI_THEAC      -------------------------------------------EYKYDGMRTETHIERGKVRLFSRGNEE
DNLI_METHJ      -------------------------------------------EFKYDGARFQFHKQNKTCRMYSRRLEE
DNLI_PYRCJ      ----------------------------------------------------------------------
DNLI_MYCTU      -------------------------------------GGTTIFEAKLDGARVQIHRANDQVRIYTRSLDD
DNLI_MYCTA      -------------------------------------GGTTIFEAKLDGARVQIHRANDQVRIYTRSLDD
DNLI_MYCBT      -------------------------------------GGTTIFEAKLDGARVQIHRANDQVRIYTRSLDD
DNLI_MYCBP      -------------------------------------GGTTIFEAKLDGARVQIHRANDQVRIYTRSLDD
DNLI_MYCBO      -------------------------------------GGTTIFEAKLDGARVQIHRANDQVRIYTRSLDD
DNLI_PYRHO      -------------------------------------------EIKYDGARVQVHKDGEKVIIYSRRLEN
DNLI_ARCFU      ----------------------------------------------------------------------
DNLI_ANAD2      ---------------------------------------------KLDGARIQAHRDGGEVRVFSRSLRD
DNLI_PYRAR      -------------------------------------GGAAICEYKYDGERAQIHISQSGVRIFSRRLED
DNLI_ANADF      ---------------------------------------------KLDGARVQVHKDGGEVRVFSRALRD
DNLI1_THEPD     ----------------------------------------------------------------------
DNLI_PYRKO      ----------------------------------------------------------------------
DNLI_METTP      ----------------------------------------------------------------------
DNLI_PICTO      ------------------------------------------YEYKYDGLRTQLHFLKGGIKIFSRGLEE
DNLI_ARTCA      ----------------------------------------------------------------------
DNLI_HALSA      ----------------------------------------------------------------------
DNLI_HALS3      ----------------------------------------------------------------------
DNLI_AQUAE      ----------------------------------------------------------------------
DNLI_MYCUA      -------------------------------------GGATIFEAKLDGARVQIHRTGDEVTVYTRSLDD
DNLI_SACEN      ----------------------------------------------------------------------
DNLI_NANEQ      ----------------------------------------------------------------------
DNLI_PERMH      ----------------------------------------------------------------------
DNLI_METMJ      ----------------------------------------------------------------------
DNLI2_METAC     ----------------------------------------------------------------------
DNLI2_KORCO     ----------------------------------------------------------------------
DNLI_PYRIL      -------------------------------------GGSAICEYKYDGERAQIHLKEGVVKIFSRRLED
DNLI2_METMA     ----------------------------------------------------------------------
DNLI1_XENLA     ----------------------------------------------------------------------
DNLI1_HUMAN     ----------------------------------------------------------------------
DNLI2_METBF     ----------------------------------------------------------------------
DNLI_UNCMA      ----------------------------------------------------------------------
DNLI_ANASK      ---------------------------------------------KLDGARIQAHRDGDEVRVFSRSLRE
DNLI_THENV      -------------------------------------GGAAVCEYKYDGERAQIHISGGSVKIFSRRLED
DNLI_CALMQ      ----------------------------------------------------------------------
DNLI4_YEAST     ----------------------------------------------------------------------
DNLI4_KLULA     ----------------------------------------------------------------------
DNLI_SULAC      ----------------------------------------------------------------------
DNLI_PYRAE      ----------------------------------------------------------------------
DNLI_AERPE      ----------------------------------------------------------------------
DNLI_ACIAM      ----------------------------------------------------------------------
DNLI4_SCHPO     ----------------------------------------------------------------------
DNLI1_ARATH     ----------------------------------------------------------------------
DNLI_SULTO      ----------------------------------------------------------------------
DNLI_NITMS      ----------------------------------------------------------------------
DNLI4_CANGA     ----------------------------------------------------------------------
DNLI2_THEPD     ----------------------------------------------------------------------
DNLI4_ASPFU     ----------------------------------------------------------------------
DNLI_HALLT      ----------------------------------------------------------------------
DNLI_VACCW      ----------------------------------------------------------------------
DNLI_VACCC      ----------------------------------------------------------------------
DNLI_VACCA      ----------------------------------------------------------------------
DNLI_MYCGI      ----------------------------------------------------------------------
DNLI1_DICDI     -------------------------------------------EFKYDGERAQIHRLPDGTHIYTRNLED
DNLI_STAMF      ----------------------------------------------------------------------
DNLI4_PHANO     ----------------------------------------------------------------------
DNLI4_COCIM     ----------------------------------------------------------------------
DNLI_VARV       ----------------------------------------------------------------------
DNLI4_CANAL     ----------------------------------------------------------------------
DNLI_METTH      ----------------------------------------------------------------------
DNLI_METS5      ----------------------------------------------------------------------
DNLI4_ASHGO     ----------------------------------------------------------------------
DNLI1_SCHPO     ----------------------------------------------------------------------
DNLI1_METMA     ----------------------------------------------------------------------
DNLI_METTF      ----------------------------------------------------------------------
DNLI_METM6      ----------------------------------------------------------------------
DNLI_METBU      ----------------------------------------------------------------------
DNLI_METM7      ----------------------------------------------------------------------
DNLI_OPITP      ----------------------------------------------------------------------
DNLI_META3      ----------------------------------------------------------------------
DNLI_METPE      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           WSKMFAPLVAALSDAAXXXXXXXXXXXXXXXXRTDFGXXXXXXXXXXXXXMLFYAFDLLHLDGYDLGPVP
Y963_MYCBO      VTAEYPQLRALAEDLADHHVVLDGEAVVLDS--SGVPSFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTR
Y938_MYCTU      VTAEYPQLRALAEDLADHHVVLDGEAVVLDS--SGVPSFSQMQNRGRDTRVEFWAFDLLYLDGRALLGTR
DNLI_DICTD      NTHMFPDLVEAVSDKNVIIEGEAISYNPETGEFYPFQVTVQRKRKYNISEMVLFAFDILYLNGEDITSLP
DNLI_DICT6      NTYMFPDLVEAVLKQFPDRDVIIEGEAISYNPETGFQVTVQRKRKYNISEMVLFAFDILYLDGEDTTSLP
DNLI_RHOOB      ITGSVPELVAAVFDGETLALTDSGRPRPFQETMSRFGAESARDLLLHP-----YFFDCLHLDGVDLLDSP
DNLI_SORC5      VTKAVPEIVSVVLDGEALAFRPDGAPHPFQVTMRRFGRAHDXXXXXXXXXXXXXFFDVLHLDGEDLLDRP
DNLI_NOCFA      -----------------------------------------------------YFFDCLHLDGRDLLDAP
DNLI_NOCSJ      -----------------------------------------------------YFFDVLHLDGADLLDVS
DNLI_RHOSR      -----------------------------------------------------YFFDCLHLDGVDLLDAP
DNLI_MYCPA      TATLALPVEALIADGEAIALRPDNSPQRFQVTASRFGRSLDVAAAVAAQPLSVFIFDILHCDGIDLLDAP
DNLI_MYCA1      TATLALPVEALIADGEAIALRPDNSPQRFQVTASRFGRSVDVAAAVAAQPLSVFFFDILHCDGVDLLDAP
DNLI_MYCSS      VTARLPEVVEAIADAEAIALRPDGRPHRFQVTASRFGRAAARATQPLSVFM----FDLLHVDGADLLDQP
DNLI_MYCSK      VTARLPEVVEAIADAEAIALRPDGRPHRFQVTASRFGRAAARATQPLSVFM----FDLLHVDGADLLDQP
DNLI_MYCSJ      VTARLPEVVEAIADAEAIALRPDGRPHRFQVTASRFGRAAARATQPLSVFM----FDLLHVDGADLLDQP
DNLI_STRAW      ITDRLPELTAAILDGEVIALDGNGRPRSFQEIXXXXXXXXXXXXXXXXXXXXXXFFDALSVDGRDLLDLP
DNLI_BEUC1      ITGRVPEIVEALPAGALVLDGEALAVDAGGRPRTASRSATRDADVAAAMTLTPFFFDCLHADGRDLVDAP
LIGB_BACSU      VTSKFPELMDL--DIPDGTVLDGEVIVAASGGAPDFEAVMERFMSKKSAHNIVYCFDVIYKDGQSIAAKP
DNLI_THEVO      TTGQFPDIVKSAKETFHVSSVILDGEAVPYNPETGEGRKYDLDKVSNEIPITVFLFDIVYINGKDLSKTP
DNLI_MYCVP      VTALALPVTELIADAEAIALRPDGRPHRFQITASRFGRRGGTPDAGTQRLSVFF-FDLLHADGVDLLDLP
DNLI_CENSY      -------------------------------------------------------FDILYLDGRDCLGIS
DNLI_KINRD      ITXXXXXXXXXXXXXXXXXFVLDGEALVLDGSGRPFQDTASRTAQASGDAVVPYFFDVLHLDGADLLDVA
DNLI_METB6      VSEALPDVIDLLSKATSHDVILDGEVIAIKDDRPRFRRRHDIAEAQEAIRMVPNVFDILYLDGETLIDLP
DNLI_PYRFU      -------------------------------------------------------FDVLYVDGQSLIDTK
DNLI_NATPD      -----------------------------------------------------YAFDCLHVDGEDLLDTP
DNLI_PYRAB      VTRAIPEIVEAIKEALKPTKAIVEGELVAIGEDRRFRRKYNIEEMMEKIPLELNLFDVLYVDGVSLIDTK
DNLI_MYCS2      VTHRLPEVVEAIADAEAIALRPDGRPHLFQVTAARFGRKDPGDLGP----LSVFFFDLLHVDGRDLLDLP
DNLI_ANADE      VTAAVPEVVALLRAAPEPRLVLDGEAIALRADGTPFGRKLDVERLAPELPLTAFFFDALVAGGAELLARP
DNLI_ACIBL      ITDSFPELIPALKAIEHEVILDGEILAWRCGQALAFGRKNVSAAMQREVPVSYVTFDLLYAKGQLVIDRP
DNLI1_KORCO     -----------------------------------------------------YIFDLILLDGSSYLRKP
DNLI_STRCO      ITDRLPEVTEAILDGEAISLDADGRPRSFQETAGRVGSRTDVATAARAVPVSAVFFDVLSVDGRDLLDLP
DNLI_THEFM      -------------------------------------------------------FDVLYVDGESLVDTP
DNLI_MYCMM      VTARLPEVVQAVADGEAIALQPDGRPHRFQVTASRFGRSVNVAAAQAKQPLSVFFFDILHRDGRDLLDAP
DNLI_METLZ      --------------------------------------------------LLPWVFDILAADGETLIDLP
DNLI_THEAC      TTNQFPDITKAASETFKVDSAILDGEAVPYDPDTGEGRKYDLDKVSSEIPITVFLFDIVYLNGRDLSKTP
DNLI_METHJ      VTNAMPDVVALLDEALPDDIIVDGEVIAVQGGHPRFRRKHNVAEAADAITMIPNLFDILYYNQEMLIDLP
DNLI_PYRCJ      ---------------------------------------------------VLYLFDLLYVDGEDLTTQP
DNLI_MYCTU      VTARLPEVVEAVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDLLEAP
DNLI_MYCTA      VTARLPEVVEAVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDLLEAP
DNLI_MYCBT      VTARLPEVVEAVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDLLEAP
DNLI_MYCBP      VTARLPEVVEAVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDLLEAP
DNLI_MYCBO      VTARLPEVVEAVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFFDILHRDGTDLLEAP
DNLI_PYRHO      VTRAIPEIVEAIKEAIEPEKVIVEGELVAIGEERRFRRKHNIEEMMKKIPLELNLFDVLYVDGKSFVDTK
DNLI_ARCFU      -------------------------------------------------------FDILYHDGECID-LP
DNLI_ANAD2      VTAAVPEVVALLRAAPEPRLVLDGEAIALRADGTPFGRRLDVERLAPDLPLTAFFFDALVAGGAEL----
DNLI_PYRAR      ITHAYPDVVKAVREAVSAREAILEGEIVAVDPDTGEKRKHEVAAAMEMYPTVLYLFDIVYVDGEDLTNEP
DNLI_ANADF      VTXXXXPASSLVLDGEAIALRGDGAPEPFQVTMRRFGRKLDVAGLREGVPLSVLFFDALHTAGEDLIARP
DNLI1_THEPD     -----------------------------------------------------HLFDVIYLNGKSLVREP
DNLI_PYRKO      -------------------------------------------------------FDVMFVDGESLIETK
DNLI_METTP      -----------------------------------------------------HLFDIIYMDGASLLDEP
DNLI_PICTO      TTSSFPDIVQNFKSYYSFDSCIIDGESVPYNPETGEGRKYELTEKTREVPIVMFIFDILYLNGKSLVNLP
DNLI_ARTCA      -------------------------------------------------------FDVLHIDGRDLLDEP
DNLI_HALSA      -----------------------------------------------------HAFDCLHAPGEDLLDAP
DNLI_HALS3      -----------------------------------------------------HAFDCLHAPGEDLLDAP
DNLI_AQUAE      -----------------------------------------------------FLFDIIYLDGEDLTLKP
DNLI_MYCUA      VTARLPEVVQAVADGEAIALQPDGRPHRFQVTASRFGRSVNVAAAQAKQPLSVFFSDILHRDGRDLLDAP
DNLI_SACEN      ----------------------------------------------------------------------
DNLI_NANEQ      -----------------------------------------------------HAFDIVYLEGEQLMKKP
DNLI_PERMH      -----------------------------------------------------FIFDIMYLNGEDLTLKP
DNLI_METMJ      -------------------------------------------------------FDILYLDGETLMDRP
DNLI2_METAC     -------------------------------------------------------FDIMYLNGRTLIDLP
DNLI2_KORCO     -----------------------------------------------------YAFDLLYLDGRELLDEQ
DNLI_PYRIL      ITHAYPDVVKAVREAVSAREAILEGEIVAIDPDTGDMLPFQELMHRKRKHEVAVAFDLLYIDGEDLTNEP
DNLI2_METMA     -------------------------------------------------------FDIMYINGKTLIDLP
DNLI1_XENLA     -----------------------------------------------------YAFDMLYLNGESLVKEP
DNLI1_HUMAN     -----------------------------------------------------YAFDLIYLNGESLVREP
DNLI2_METBF     -------------------------------------------------------FDIMYLNGKTLIDLP
DNLI_UNCMA      --------------------------------------------------LILRPFDVLFNQGQSTIDLP
DNLI_ANASK      VTAAVPEVVALLRAAPEPLLVLDGEAIALRADGTPFGRKLDVERLAPDLPLTAFFFDXXXXXXXXXXXXP
DNLI_THENV      ITHAYPDVVKAVKESVAAGEAILEGEIVAVDPDTGDMLPFQELMHRKRKHEVAAAFDVLYLDGEDLTGEP
DNLI_CALMQ      -----------------------------------------------------YLFDVMYVNGQDLTDLP
DNLI4_YEAST     ---------------------------------------------------LYMVFDLLYLNGTSLTPLP
DNLI4_KLULA     ---------------------------------------------------LFVAFDLVYLNGKSLTNLA
DNLI_SULAC      -----------------------------------------------------YLFDLMYNDGEDYTQKP
DNLI_PYRAE      ---------------------------------------------------VLYLFDVLYVDGEDLTEEP
DNLI_AERPE      -----------------------------------------------------FLFDALYVDGEDLTSKP
DNLI_ACIAM      -----------------------------------------------------FLFDLMYYEGEDYTVKP
DNLI4_SCHPO     -------------------------------------------------------FDILYLNGKSLVKYS
DNLI1_ARATH     -----------------------------------------------------FAFDMLYLNGQQLIQEN
DNLI_SULTO      -----------------------------------------------------YLFDLMLYEDADYTMKP
DNLI_NITMS      ----------------------------------------------------------------------
DNLI4_CANGA     ---------------------------------------------------LLMVFDVLYLNGATLVDLP
DNLI2_THEPD     -----------------------------------------------------YLFDVIYMDGEELIEKP
DNLI4_ASPFU     ---------------------------------------------------LLRVFDILYLNGRDLTGYT
DNLI_HALLT      -----------------------------------------------------HAFDCLHADGEDLLDEP
DNLI_VACCW      --------------------------------------------------MCLFVFDCLYFDGFDMTDIP
DNLI_VACCC      --------------------------------------------------MCLFVFDCLYFDGFDMTDIP
DNLI_VACCA      --------------------------------------------------MCLFVFDCLYFDGFDMTDIP
DNLI_MYCGI      ----------------------------------------------------------------------
DNLI1_DICDI     YTQKYPDIVANVTDAATKKILSFQVLSTRARKSVQLSQIKVP--------VCVFAFDLLYLNGQSLIDEP
DNLI_STAMF      -----------------------------------------------------YLFDLLYVDGEDYTLKP
DNLI4_PHANO     ---------------------------------------------------LFRVFDCVYLNDKLLTPYT
DNLI4_COCIM     ---------------------------------------------------LFRIFDILYLNDKALTRYT
DNLI_VARV       --------------------------------------------------MCLFVFDCLYFDGFDMTDIP
DNLI4_CANAL     ----------------------------------------------------FLVFDILFLNGKDLTNYP
DNLI_METTH      ----------------------------------------------------------------------
DNLI_METS5      -----------------------------------------------------FLFDLMFFEGEDYTTKP
DNLI4_ASHGO     ---------------------------------------------------LYAVFDLLYLNGQLLTNQD
DNLI1_SCHPO     -----------------------------------------------------FAFDILYLNGQPLLETP
DNLI1_METMA     -----------------------------------------------------FFFDILYLNGEPLLKRP
DNLI_METTF      -----------------------------------------------------FLFDVL----YHRGPLP
DNLI_METM6      -----------------------------------------------------YFFDVLY---YEKGLIP
DNLI_METBU      -------------------------------------------------------FDILYLNGDVLMDQS
DNLI_METM7      -----------------------------------------------------YFFDVLY---YEKGLIP
DNLI_OPITP      ----------------------------------------------------------------------
DNLI_META3      -----------------------------------------------------YVFDILYYNNKSLIELP
DNLI_METPE      -------------------------------------------------------FDILYRDGETLIDLP


                         +         .         .         .         .         *         .:210
query           LTERKRLLKGLFDRGLEPPVVYSDSMDDGEAMFDGAGRLGWEGIVSKRADAPYRSGDRSLDWQKIKTSKR
Y963_MYCBO      YQDRRKLLETLANASLTVPELLPG---DGAQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNT
Y938_MYCTU      YQDRRKLLETLANASLTVPELLPG---DGAQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNT
DNLI_DICTD      YIRRRQKLEEAISEGEKIFVIITNDPKEIQAFFEECITEGLEGIVAKRLDAPYQAGIRNFNWIKLKRSYQ
DNLI_DICT6      YIRRRQKLEEALVEGEKISIIITNDPKEIQSFFEECITEGLEGIVAKRLDAPYQAGMRNFNWIKLKRSYQ
DNLI_RHOOB      LEERLKALERVAPQHRIPGLIRPDS-EGAATHFDDALAAGHEGVMVKSLTAPYAAGRRGRAWQKVKPEHT
DNLI_SORC5      GSERTAALRQVLDRSLRVPRIELPTXXXXXXXXXXXXXHGHEGVIAKSLAAPYEAGRRRGTWLKVKRART
DNLI_NOCFA      LSERRAALLAVVGEHAIPALIRPEPEAAAE-YFDGALAAGHEGLMVKSLSAPYAAGRRGRSWQKIKPTHT
DNLI_NOCSJ      AAERAAVLERLVPAEHRVPRVVTADLGVAEEFLAGALRSGHEGVVVKSLAAPYEAGRRGASWVKVKPVHT
DNLI_RHOSR      LEERLAALERVAPQHRIPGLIRPDS-DGAATHFDDALAAGHEGVMVKSLAAPYXXXXXXXXWQKVKPEHT
DNLI_MYCPA      TTDRLAALDALV-----PPAQRVDRLLTADP--DAAGRFGHEGVMAKAPGAPYQAGRRGAGWLKVKPVHT
DNLI_MYCA1      TTDRLAALDALV-----PPAQRVDQLLTADP--DAAGRFGHEGVMAKAPGAPYQAGRRGAGWLKVKPVHT
DNLI_MYCSS      TSDRVRVLDDLVPAAHRVDRLVTDDGAAAQRFLEATLAAGHEGVMAKSPNAPYEAGRRGAGWLKVKPVHT
DNLI_MYCSK      TSDRVRVLDDLVPAAHRVDRLVTDDGAAAQRFLEATLAAGHEGVMAKSPNAPYEAGRRGAGWLKVKPVHT
DNLI_MYCSJ      TSDRVRVLDDLVPAAHRVDRLVTDDGAAAQRFLEATLAAGHEGVMAKSPNAPYEAGRRGAGWLKVKPVHT
DNLI_STRAW      FTERHAELARLVPEPLRVRRALVSGPDDGAALADTLAR-GHEGVVVKALDAPYSAGRRGASWLKVKPVHT
DNLI_BEUC1      LRERLEVLDAVAGPHVVTRLTTSDPXXXXXXXXXXV-RDGQEGVVVKATDTPYEAGRRGAGWIKVKPRHT
LIGB_BACSU      LTERKTVLNSL---ELDHPNVFEGTQGNGLAYFNLAKEKNLEGIVIKKANSPYEINKRSHNWLKVINYDY
DNLI_THEVO      YAERRRILEGLFKENLAKRIVSSDT-GTITKFFNQAIEDGCEGLVAKSMDSYYKAGARGWLWIKLKRDYQ
DNLI_MYCVP      TGERIATLDATVPREQRVDRLLTSDPEXXXXXXXXXXXXGHEGVMAKSPTAPYEAGRRGAGWLKVKPVHT
DNLI_CENSY      YSERRALLEGVVDEDSFARCVPVSTIPDESALEDSLENAGCEGLMLKLPDAPYRAGSRGGYWLKLKREYR
DNLI_KINRD      LRERLAALDGFVPPRWRTPRLVTXXXXXXXXXXXXXXXGGHEGVVVKDLDSPYAAGRRGGAWVKVKPVHT
DNLI_METB6      FFERRKKLETVVGKFVAPQVVSTDPQTI-EQTYHDALAAGHEGIMLKVPASPYTPGQRGKNWIKIKPEDT
DNLI_PYRFU      FIDRRRTLEEIIKQNEKIKVLITKKVEEAEAFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLKIKTMEN
DNLI_NATPD      LSERHDRLESLLADGVS-PLSYXXXXXXXXXXXXXXXXXGHEGIMLKNPDSTYTPGSRGKNWLKRKPDET
DNLI_PYRAB      FMERRKKLEEIVETNGKVKILITKNVEEAEQFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLKIKTMEN
DNLI_MYCS2      TEERFGALDALVRQDQRVDRLVTTDTVAAQEFLERTLAAGHEGVMAKSPHAAYEAGRRGAGWLKVKPVHT
DNLI_ANADE      ERERWAALARAIPAERRVPRLVTRDPAEARAFLEDALARGQEGVVAKALDAPYEAGRRGAAWLKVKRAHT
DNLI_ACIBL      LQERAAMLDGIFSEGLRAPQARADSPEELDRLFAAAQERGNEGLMIKDIHSAYAVGRRGKSWLKLKRELA
DNLI1_KORCO     YFERREKLEGLIEDSLVRSLITSDP-DEGMDFMEEALREGHEGVIAKKLNSPYIPGVRGRYWLKVKETNS
DNLI_STRCO      LTERHAELARLVPEPLRVRRTLVHGPEDTGAAEEFLARTGHEGVVVKGLDAAYSAGRRGASWLKVKPVHT
DNLI_THEFM      FMERRKRLEEAVEESERIKLLVTKKAEEAEEFYRRALELGHEGLMAKRLDSVYEPGNRGKKWLKIKPTME
DNLI_MYCMM      TTDRLAALDAVVPARHXXXXXXXXXXXXXXXXXXXXXXXGHEGVMAKSPTAPYLAGRRGAGWLKVKPVHT
DNLI_METLZ      FRERRKILESVMNAYVAPQLV-SDSAEEIEAYYHSSLDNGNEGIMLKVLDSPYLPGNRGKLWIKIK----
DNLI_THEAC      YTERRKILESIFDSFRLAKRIESGDPAEVHRFFNSAIEDGCEGLVAKSTDSFYKAGARGWLWIKLKRDYQ
DNLI_METHJ      FRERRNILTQVASRYVTPQLV-SDDETEIEAYYHTALDAGHEGVMLKLQGSRYTPGVRGKDWVKIKEADT
DNLI_PYRCJ      LIYRRLRLSEVVEEGGDVYIAMFDGAEDVDLFFHEAVSLGTEGLICKSPTSTYEMGARGWNWIKYKRDYR
DNLI_MYCTU      TTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKXXXXXXXXXXXXXXWLKVKPVHT
DNLI_MYCTA      TTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKXXXXXXXXXXXXXXWLKVKPVHT
DNLI_MYCBT      TTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKXXXXXXXXXXXXXXWLKVKPVHT
DNLI_MYCBP      TTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKXXXXXXXXXXXXXXWLKVKPVHT
DNLI_MYCBO      TTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMAKXXXXXXXXXXXXXXWLKVKPVHT
DNLI_PYRHO      FIERRKKLEEIVKPNGKIKVLITKNAEEAEKFYKRALEMGHEGLMAKRLDAVYEPGNRGKKWLKIKTMEN
DNLI_ARCFU      LRERRKLLESAVNESEKIKLIVTDSVDEVRKMYDEAISAGHEGVMIKLPSSPYIPGKRGKNWLKVKAMET
DNLI_ANAD2      LASPERVRWAALERAVPPRLVTRDPAEAGAFLEDALAR-GQEGVVAKALDAPYEAGRRGAAWLKVKRAHT
DNLI_PYRAR      LIYRRVKLSEIVHESDKVQIAKWQMFDDPDTVFHEAVSVGTEGLICKSPTSEYEMGARGWNWIKYKRDYK
DNLI_ANADF      ASERHLALAAAVPDALRVPRLVTSDXXXXXXXXXXXXXRGHEGLLAKSLTAPYEAGRRGASWLKVKRAHT
DNLI1_THEPD     YSTRSRLLREIVSEEILAKKTVAYTRQEALEFYESAVRSGNEGVMSKRHSSVYKPGIRGSDWLKLKSFDT
DNLI_PYRKO      FIDRRNKLEEIVKESEKIKLLITKKVEEAEAFYRRALELGHEGLMAKRLDSIYEPGNRGKKWLKIKTMEN
DNLI_METTP      LEERRRVLVSVADPEIIAEQVVTSDVHRVEEIYREALAAGHEGVMLKNPSSTYTPGKRGKNWLKIKPLLE
DNLI_PICTO      YPERRSILEKNFKENLAKRIV-SDDEHDIMKFFERSIEEGCEGIVAKSIDSIYRAGARGWLWIKFKRDYQ
DNLI_ARTCA      LSERIKVLEAIAPAHRIPGEITADPEVAGRISRD-ALAAGHEGVMLKSVGSLYAAGRRGSNWIKVKPVLT
DNLI_HALSA      FSDRHRRLRXXXXXXXXXXVLVTDDADEIAAFEATALEGGHEGIMLKNPAAPYTPGDRGKDWLKRKPDET
DNLI_HALS3      FSDRHRRLRXXXXXXXXXXVLVTDDADEIAAFEATALEGGHEGIMLKNPAAPYTPGDRGKDWLKRKPDET
DNLI_AQUAE      YPERREILEKVVKRGLVPRKIV-DNVEDLENFFYQAIEEGCEGLVCKAPNSIYQAGKRGFLWIKYKRDYK
DNLI_MYCUA      TTDRLAALDAVVPARHXXXXXXXXXXXXXXXXXXXXXXXGHEGVMAKSPTAPYLAGRRGAGWLKVKPVHT
DNLI_SACEN      ------------------PAVLTADAEHASGIFDDALEAGHEGVMVKSLDSAYAAGRRGRTWRKVKPSHT
DNLI_NANEQ      FKERRALLEKVIDE-KEHEIQLSIGIDDKKAFYQDCLNKGLEGVMFKNLNAPYQPGRRVGYMVKLKTLET
DNLI_PERMH      YPERRKILEKITERINLSERKIVDNVEDLESFFHQAIEDGCEGLVCKQKDSIYQAGKRGFLWIKYKRDYK
DNLI_METMJ      LAERRKALDEVLGAHVXXXXXXXXXXXXXXXXXXXLD-LGHEGVMVKVLDSPYTPGVRGRLWVKVKPGET
DNLI2_METAC     LVERRKALESCVESSVEDEQVITGDLELVEKIYREALNAGHEGVMVKNPNSAYSPGKRGKNWLKKKLMET
DNLI2_KORCO     LDDRRXXXXXXXXXXXXARLVQYEEIDGNERFFEHAVEMGTEGLVVKDPKSIYQAGVRGWSWIKLKRSEP
DNLI_PYRIL      LIYRRVRLSEVVQETEKVSIAKWRVFDDAEEIFHEAVSLGMEGLVCKSPTSVYEMGARGWNWIKYKRDYK
DNLI2_METMA     LLERRKALESCVESSVEAEQVITGDLELVEKIYREALKAGHEGVMVKNPNSVYSPGKRGKNWLKKKLMDT
DNLI1_XENLA     FAKRRQLLRDSFTEGQFMFATYMDNTDEISEFLDQSIKDSCEGLMVKEQDATYEIAKRSHNWLKLKKDYL
DNLI1_HUMAN     LSRRRQLLRENFVE-TEGEFVFATSLDTKDEFLEQSVKDSCEGLMVKTVDATYEIAKRSHNWLKLKKDYL
DNLI2_METBF     LIERRKALESCVESSVEDKQVITGDLDLIEKIYKEALDAGHEGVMVKNPNSFYSPGKRGKNWLKKKLMET
DNLI_UNCMA      LRERRKILEEIVDSVIQPAALVTDQEEKAQELFEESVKSGNEGLMGKDLNATYTPGVRGKKMVKIKSLDT
DNLI_ANASK      ERERWAALERAIPAERRVPRLVTGDXXXXXXXXXXXXXXGQEGVVAKALDAPYEAGRRGAAWLKVKRAHT
DNLI_THENV      LIYRRLRLSEVVHETEKVSIARWRLFDDPDVFFHEAVSLGMEGLVCKSPTSIYEMGARGWNWIKYKRDYK
DNLI_CALMQ      LPDRKKVLFSIIEHVHHADWIITDDADSLEKFFLDAISSGCEGVMCKKLGSVYEMGARGWLWIKYKRDYK
DNLI4_YEAST     LHQRKQYLNSILSPLKNIVEIVRSSVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYL
DNLI4_KLULA     LERRKDYLTKILERSVE--IIQYMKAINAEAIKDSAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYL
DNLI_SULAC      LPDRREKLEEIVTQNDIVKVAYIDKVNELVEYFHQAISDGTEGVIVKSKDSIYQAGARGFLWIKLKKDYQ
DNLI_PYRAE      LIYRRVRLSEIVCETDKVSIAKWRIFDNAEAVFHESVSMGTEGLICKSPSSIYEMGARGWNWIKYKRDYR
DNLI_AERPE      LPERRRRLKEIV---VETPLIETSDPEELWTFFLKAIEEGAEGVMVKHRDSVYTAGVRGWLWVKLKRDYK
DNLI_ACIAM      LSERRKKLESIVEDNDYVHIIITDNVEKLKEFFYQAISEGAEGVMVKAPDAIYQAGSRGWLWIKFKRDYQ
DNLI4_SCHPO     LESRRRILEKVIVRESHRPYKVGSTIEDIEAELRNVIQEGSEGLVIKKPSGSYHLGERMDDWIKVK----
DNLI1_ARATH     LKIRREKLYESFE---EDPAVTSNDIDEIQKFLDASVDVGCEGLIIKTSDATYEPAKRSNNWLKLKKDYM
DNLI_SULTO      LPERRKKLEEVIDKLHIAHHIYTNNVDKLMEFFYDAISNGAEGVMVKSVDSIYQAGSRGFLWIKLKRDYQ
DNLI_NITMS      ------------------PMAIVKNENDIEDFFENSINAGSEGLMLKTLVSPYQAGSRGSHWLKLKREYQ
DNLI4_CANGA     YYKRREYLKQILTPTAHRIEIIKSIRANDEQMIEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYL
DNLI2_THEPD     LDQRRLILEKIVPEG-DEDILLSTAKVVGDAFFEQAISEGCEGVMCKSPGSIYQMGARGWLWIKFKRDYR
DNLI4_ASPFU     LRDRRKALQ----KAVRPPYEEATTKDQVEAALRKVVAEASEGLVLKNPRSPYRLNERHDDWMKVK----
DNLI_HALLT      FRARDRLAEVLSDAAAS--VXXXXXXXXXXXXXXXXXXXXXXXVMLKNPEAAYTPGNRGRDWLKRKPDET
DNLI_VACCW      LYERRSFLK---DVMVEIPIVFSELTNISNEVLDDALTRKLEGLVLKDINGVYEPGKRR--WLKIK----
DNLI_VACCC      LYERRSFLK---DVMVEIPIVFSELTNISNEVLDDALTRKLEGLVLKDINGVYEPGKRR--WLKIK----
DNLI_VACCA      LYERRSFLK---DVMVEIPIVFSELTNISNEVLDDALTRKLEGLVLKDINGVYEPGKRR--WLKIK----
DNLI_MYCGI      -----------------------------QEFFDRTLAAGHEGVMAKSTVAPYEAGRRGAGWLKVKPVHT
DNLI1_DICDI     LIKRREHLVENFSDGVFAFAKYSNISDDIQSYLEEAVEGNCEGLMVKKEKSIYEPSRRSYNWLKIKKDYM
DNLI_STAMF      LPERRAKLVEIIEQTETFQIIRTNNPDELEKFFLKAIEDGAEGVMIKHKNAIYQAGTRGWLWIKYKRDYK
DNLI4_PHANO     LRDRRRALESAVKRRLEHPYIEAHSHTEIEPALRKVVAESSEGLVLKNPRSMYRLNDRNADWMKVK----
DNLI4_COCIM     LRDRRRALEASIKRRLEVHTYIGNSAADIEPQLRKVVAEASEGLVLKNPNSPYRLNDRHDDWMKVK----
DNLI_VARV       LYKRRSFLK---DVMVEIPIVFSELTNISNEVLDDALTRKLEGLVLKDINGVYEPGKRR--WLKIK----
DNLI4_CANAL     LFFRKRILRPIPNRFEVLDTRLGSSSEDIERAIREVVSSRCEGLVLKNVQSKYEDGFRNPDWIKVKPEYL
DNLI_METTH      -----------------------DNLNDALWLFEESIREGHEGIMIKDTEAPYIPGIRGKKMLKFKAEPE
DNLI_METS5      LPERRAKLEEILDKVHIASHIIADRVDKLREYFYQAISEGAEGVMVKSPDSIYQAGSRGWLWIKLKRDYQ
DNLI4_ASHGO     VVKRKEYLKILIPSKNVVHLLSGPRCSDAEAITAALGAAGSEGIVLKKARSKYSVGKRDDSWIKIKPEYL
DNLI1_SCHPO     LNERRKLLYSMFSTGDFTFAKHSDQKXXXXXXXXXXXXVSCEGLMVKMLEGPYEPSKRSRHWLKVKVGDS
DNLI1_METMA     YPERRALLENVVESGIISKRIVTESVEEIEDFFNETIEKGLEGIVVKSSNSYYEAGKRSWFWFKWKQEYS
DNLI_METTF      LWHRREVLESILSEASRMVDVGPDNLDDALWLFKESIREGHEGIMIKDTEAPYIPGIRGKKMLKFKAEPE
DNLI_METM6      LKNRREILEKLFDSELEKIQLNSDDPDLAKEFFNWSLSIGHEGIMIKNPDAPYTPGSRVKTMYKVKPTLE
DNLI_METBU      LLRRREQLVACVENCDSIKVVLTDDVNVVNDIYAAALNGGHEGVMLKNPEASYSPGKRGKNWLKKKIMET
DNLI_METM7      LKDRREILEKLFDTELSKKEIFSNKMDDAKEFFNWSLSIGHEGIMIKNPDAPYTPGSRVKTMYKVKPTLE
DNLI_OPITP      ------------------PVTFAHTASDIEAAFLAARQRGNEGLMAKDPASGYTPGRRGLAWLKLKKAYA
DNLI_META3      LIERRSILEKILTNKHNSHKLTTDNEQKAREFYEWSLSIGHEGVMIKNPNAIYTPGSRVRTMYKFKPTLE
DNLI_METPE      FQSRRAILSATIGPEYLAPQQVLSSAEAVDLLYLEAMAEGHEGVMLKDLLSLYSPGVRGKHWVKIKPEET


                         .         .         .         +         .         .         .:280
query           EHLVIVGYVPATGGIAALHVARRDGDSLVYAGKVGTGFSVKVGADLRRRLAEIETXXXXXXXXXXXXXXX
Y963_MYCBO      QEVVIGGWRAGEGGVGSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLESPFDVPLPARDAKGIT
Y938_MYCTU      QEVVIGGWRAGEGGVGSLLMGIPGPGGLQFAGRVGTGLSERELANLKEMLAPLESPFDVPLPARDAKGIT
DNLI_DICTD      GHLVILGYFKGRGGIGALLVGVYDDERDLFVAKIGTGPTEEEWVRFREVLDEIK----------------
DNLI_DICT6      GHLVILGYFKGRGGIGALLVGVYDDERDLFIAKIGTGPTEEEWVKFREILDEIK----------------
DNLI_RHOOB      LDLVVLGYGRRTGYLSNLHLGARDGGAPIMVGKTFKGLT-------------------------------
DNLI_SORC5      LDLVVLAAEWGTGRLSNLHIGARDAGGFVLLGKTFKGMNDEVLAWQTQRLLELE----------------
DNLI_NOCFA      LDLLVLGYGRRTGYLSNLHLGARD----------------------------------------------
DNLI_NOCSJ      LDLVVLGSGRRQGWLSNIHLGARDTGGLVMLGKTFKGMTDEVLAWQTERFLELET---------------
DNLI_RHOSR      LDLVVLGYGRRTGYLSNLHLGARDGGEPIMVGKTFKGLT-------------------------------
DNLI_MYCPA      LDLVVLGSGRRRGKLSNIHLGARDTGEFVMVGKTFKGMT-------------------------------
DNLI_MYCA1      LDLVVLGSGRRRGKLSNIHLGARDTGEFVMVGKTFKGMT-------------------------------
DNLI_MYCSS      LDLVVLGSGRRTGKLSNIHLGARD----------------------------------------------
DNLI_MYCSK      LDLVVLGSGRRTGKLSNIHLGARD----------------------------------------------
DNLI_MYCSJ      LDLVVLGSGRRTGKLSNIHLGARD----------------------------------------------
DNLI_STRAW      LDLVVLGHGRRTGKLSNLHLGARAADSFAMLGKTFKGMTDAMLTWQTERLTEL-----------------
DNLI_BEUC1      LDLVVLGSGRRRGWLSNIHLGARDAGGFVMLGKTFKGMTDEMLAWQTERFLELET---------------
LIGB_BACSU      TEVLITGY--------------------------------------------------------------
DNLI_THEVO      AQLAFMGHGRRSGTYGALLLANEKNDTFETVCKLGSGFTDDVLFSLPKRFAE------------------
DNLI_MYCVP      LDLVVLGSGRRTGKLSNIHLGARDTGGFVMLGKTFKGMTDEMLAWQTERFLEL-----------------
DNLI_CENSY      NELVIIGAFRRTGRYGTLLLATYDDDTFPSICKVGTGFT-------------------------------
DNLI_KINRD      LDLVVLGSGRRAGWLSNVHLGARDTGGFVMLGKTFKGMTDETLAWQTARFRELQT---------------
DNLI_METB6      LDLAVIGAEWGEGKRASFLVACQDQGKLIPLSRVATGFS-------------------------------
DNLI_PYRFU      LDLVIIGAEWGEGGSFILGAYDPETGEFLEVGKVGSGFT-------------------------------
DNLI_NATPD      LDLVVTGAEWGEGRRANLVVSARADDGYEPVGKVATGITDEELERLHERL--------------------
DNLI_PYRAB      LDLVIIGAEWGEGGSFILGAYDPETGEFLEVGKVGSGFT-------------------------------
DNLI_MYCS2      LDLVVLGSGRRQGKLSNIHLGARDPDSFVMLGKTFKGMT-------------------------------
DNLI_ANADE      LDLVVLGSGRRRGWLSNLHLGARDPASFVMLGKTFKGMTDAMLAWQTDRLKALAT---------------
DNLI_ACIBL      MLDVVVGHGKRAGILSDYTFAVRGGEELLNIGKAYSGLTDKEIAEM------------------------
DNLI1_KORCO     LDLVIVGYGRRHRWYSDYYLAARDPESFLIVGKTFKGLTDEEFEWITQKLEEL-----------------
DNLI_STRCO      LDLVVLGHGRRTGKLSNLHLGARTADSFAMLGKTFKGMTDALLTWQTERLKEL-----------------
DNLI_THEFM      DDLVIIGAEWGEGRLGSFLVAAYDRGEFVPVGKVGSGFTDEDLAEFTKML--------------------
DNLI_MYCMM      LDLVVLGSGRRRGKLSNIHLGARDAGEFVMLGKTFKGMT-------------------------------
DNLI_METLZ      ----------------------------------------------------------------------
DNLI_THEAC      AQLTVVGAFKGTYGALLLATYNDKNDTFETVCKLGSGFSDDVLFSLPKKFEQ------------------
DNLI_METHJ      LDLVVTGAEWGEGKRASFLLSVRDDDRLVPISRVATGFS-------------------------------
DNLI_PYRCJ      SELVVVGAFHGRGXXXXXXXXDPSTDMFYTVCKVGSGFT---DADLRR----------------------
DNLI_MYCTU      LDLVVLGSGRRRGKLSNIHLGARDTGGFVMVGKTFKGMT-------------------------------
DNLI_MYCTA      LDLVVLGSGRRRGKLSNIHLGARDTGGFVMVGKTFKGMT-------------------------------
DNLI_MYCBT      LDLVVLGSGRRRGKLSNIHLGARDTGGFVMVGKTFKGMT-------------------------------
DNLI_MYCBP      LDLVVLGSGRRRGKLSNIHLGARDTGGFVMVGKTFKGMT-------------------------------
DNLI_MYCBO      LDLVVLGSGRRRGKLSNIHLGARDTGGFVMVGKTFKGMT-------------------------------
DNLI_PYRHO      LDLVIIGAEWGEGGSFILGAYDPETGEFLEVGKVGSGFT-------------------------------
DNLI_ARCFU      LDLVVVGGEWGEGWLSSFELACLDTGKLLKVGRVATGFT-------------------------------
DNLI_ANAD2      LDLVVLGSGRRRGWLSNLHLGARDPSTFVMLGKTFKGMTDAMLAWQTERLKALAT---------------
DNLI_PYRAR      SEMI------------------------------------------------------------------
DNLI_ANADF      LDLVVLGSGRREGFLSNLHLGARDGGGFVMLGKTFKGMT-------------------------------
DNLI1_THEPD     IDCVIIGHGRRSGWLSDYHLGVYDEESFLSVGKTFKGLSDAEFEEMTKRLLQLK----------------
DNLI_PYRKO      LDLVIIGAEWGEGRLGSFLVAAYDPHSFLPVGKVGSGFT-------------------------------
DNLI_METTP      SDLVVIGARWGEGKRANLLGSYRDTGELKDVGWVATGITDEMLAELTELFREL-----------------
DNLI_PICTO      SELVVVGAFDGHGGALLLACYNSKDDTFETVCKLGSGFTDEMLSEMPRLLGD------------------
DNLI_ARTCA      YDLVVLGSGRRTGMLSNLHLGALD----------------------------------------------
DNLI_HALSA      LDLVVTGAEWGEGGTFLLSARDAAGDGFETIGKVATGLTDEELAALSDRL--------------------
DNLI_HALS3      LDLVVTGAEWGEGGTFLLSARDAAGDGFETIGKVATGLTDEELAALSDRL--------------------
DNLI_AQUAE      SDLVVVGGFQRKGTFGSLLMACYDPESDMFVTKVGTGFT-------------------------------
DNLI_MYCUA      LDLVVL----------------------------------------------------------------
DNLI_SACEN      LDLVVLGHGRRSGYLSNLHLGARDPD--------------------------------------------
DNLI_NANEQ      LDLVIVGEGKRSGWLTSFTVAALDKDTGNYVGEVGTGIKEK-----------------------------
DNLI_PERMH      SHLVVVGAFARTGYFGSLLMACYDTDQFKTVCKVGTG---------------------------------
DNLI_METMJ      LDLVVVGAERRAGTFGSFLLAVQDQGRLLPVGKVATGITDEVLAEL------------------------
DNLI2_METAC     LDLVVVGYGRRANLIGSYSVACYDPETFLQVGKVGTGLT-------------------------------
DNLI2_KORCO     VDLVVVGAFKRAGTYGALLMAAYSPEEDVFVCKMGSGFT-------------------------------
DNLI_PYRIL      SEMI------------------------------------------------------------------
DNLI2_METMA     LDLVIVGAEWGFGRIGSYTVACYDPDTFLQVGKVGTGLT-------------------------------
DNLI1_XENLA     EDLVVIGAYKRTGIYGGFLLASYDEESEEYQTKIGTGFT-------------------------------
DNLI1_HUMAN     DDLVVIGAYLGRGKRAGRYLASYDEDSLQAICKLGTGFS-------------------------------
DNLI2_METBF     LDLVVVGAEWGFGRRANLTVACYDPKTLLQVGKVGTGLT-------------------------------
DNLI_UNCMA      LDLAIVGHGRKAGWLTSFEVAALDEETYVILGRVASGFSDEQLIEMTEKLKPLIT---------------
DNLI_ANASK      LDLVVLGSGRRRGWLSNLHLGARDTGEFVMLGKTFKGMTDAMLAWQTERLKALAT---------------
DNLI_THENV      SEMI------------------------------------------------------------------
DNLI_CALMQ      SELVVVGAFAGTYGXXXXXXYDPDSDQFYTVCKVGSGFT-------------------------------
DNLI4_YEAST     EELIVIG---------------------------------------------------------------
DNLI4_KLULA     EQLLIIG---------------------------------------------------------------
DNLI_SULAC      SELVIVGAFKRGGKLSSLLMAAYDPDKDTFVCKVASGFSDAELEEVQKMLSE------------------
DNLI_PYRAE      SEMI------------------------------------------------------------------
DNLI_AERPE      SELVVVGAFKRGGKLSSLLMAAYDPDRDVFVCKVATGFT-------------------------------
DNLI_ACIAM      SELVMVGAFHGKGRKGGKYSSNPDKDVFETVCKVASGFTDAELDDLQKKIAELK----------------
DNLI4_SCHPO     ----------------------------------------------------------------------
DNLI1_ARATH     DSIAFHGRGKRTGVYGAFLLACYDVDKEEFQSKIGTGFS-------------------------------
DNLI_SULTO      SELVVVGAFKRGGKLSSLLMAAYDTDTFKTVCKVASGFSDAELDELQKKLMEIK----------------
DNLI_NITMS      NELVVIGGFFGKGGTLLLATYEEDEDTFTSICKVGTGFS-------------------------------
DNLI4_CANGA     EQLVLMGRDPS-----------------------------------------------------------
DNLI2_THEPD     MELVVVGGFHGRGKRAALLMAAYDTDTFKTVCKVGTGFT-------------------------------
DNLI4_ASPFU     ----------------------------------------------------------------------
DNLI_HALLT      LDAVVVGAEWGEGRRAELFGVRAGDDELATIGKVATGLTDEELADLTERL--------------------
DNLI_VACCW      ----------------------------------------------------------------------
DNLI_VACCC      ----------------------------------------------------------------------
DNLI_VACCA      ----------------------------------------------------------------------
DNLI_MYCGI      LDLVVLGSGRRSGKLSNIHLGARDPGTFVMLGKTFKGMTDEMLAWQTRRFLDL-----------------
DNLI1_DICDI     QGMTSLDLVPRTGTYGAYLLACYDENNEEFQTKIGTGFS-------------------------------
DNLI_STAMF      SELVVIGXXXXXXKYGALLMASYNPDKDVFESKVGSGF--------------------------------
DNLI4_PHANO     ----------------------------------------------------------------------
DNLI4_COCIM     ----------------------------------------------------------------------
DNLI_VARV       ----------------------------------------------------------------------
DNLI4_CANAL     EDLVVIGKSPA-----------------------------------------------------------
DNLI_METTH      TDLIVVGGTYGRGKVGSYLLAARDEDSLVTVAHVATGLDDETLQQLSERMEKL-----------------
DNLI_METS5      SELVVVGAFKRGGKFSSLLMAAYNPEKDVFVCKVASGFSDQELDEMQKKINELK----------------
DNLI4_ASHGO     ENLVVIG---------------------------------------------------------------
DNLI1_SCHPO     LDLIVIGAYYGKGGAFLLGCYDPDTETVQSICKLGTGFS-------------------------------
DNLI1_METMA     EGMXXXXXXXXXXXALLCAVLNKEGQRFETLTKVGTGFTEADAEEINRLLSD------------------
DNLI_METTF      TDLIVVGGTYGRGGSYLLAVRDEKSGELKTIAHVATGLDDQTLQDLSERMENLK----------------
DNLI_METM6      NLDVVVGMGKRKDWYGSYEISKDDEDNLHVIGNVGSGLT-------------------------------
DNLI_METBU      LDLVVIGYGKRANLIGSYALACFDPEKFLPIGKVATGFSDEQLAELTEVFSEL-----------------
DNLI_METM7      NLDVVVGMGKRKDWYGSYEISVKDEDNLHVIGNVGTGLT-------------------------------
DNLI_OPITP      TLDVVV------VGVEYGHGKRRD----------------------------------------------
DNLI_META3      SLDVVIGMGKRKEWYGSFEIAVKDYENNLYTGHVGSGLTEEELHNLTEQIKNI-----------------
DNLI_METPE      LDLVVIG---------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           XXXXXMSADVEYRDITASGHLRHASFKGLxxxx
Y963_MYCBO      YVKPALVAEVRYSEWTPEGRLRQSSWRGL----
Y938_MYCTU      YVKPALVAEVRYSEWTPEGRLRQSSWRGL----
DNLI_DICTD      ---------------------------------
DNLI_DICT6      ---------------------------------
DNLI_RHOOB      ---------------------------------
DNLI_SORC5      ---------------------------------
DNLI_NOCFA      ---------------------------------
DNLI_NOCSJ      ---------------------------------
DNLI_RHOSR      ---------------------------------
DNLI_MYCPA      ---------------------------------
DNLI_MYCA1      ---------------------------------
DNLI_MYCSS      ---------------------------------
DNLI_MYCSK      ---------------------------------
DNLI_MYCSJ      ---------------------------------
DNLI_STRAW      ---------------------------------
DNLI_BEUC1      ---------------------------------
LIGB_BACSU      ---------------------------------
DNLI_THEVO      ---------------------------------
DNLI_MYCVP      ---------------------------------
DNLI_CENSY      ---------------------------------
DNLI_KINRD      ---------------------------------
DNLI_METB6      ---------------------------------
DNLI_PYRFU      ---------------------------------
DNLI_NATPD      ---------------------------------
DNLI_PYRAB      ---------------------------------
DNLI_MYCS2      ---------------------------------
DNLI_ANADE      ---------------------------------
DNLI_ACIBL      ---------------------------------
DNLI1_KORCO     ---------------------------------
DNLI_STRCO      ---------------------------------
DNLI_THEFM      ---------------------------------
DNLI_MYCMM      ---------------------------------
DNLI_METLZ      ---------------------------------
DNLI_THEAC      ---------------------------------
DNLI_METHJ      ---------------------------------
DNLI_PYRCJ      ---------------------------------
DNLI_MYCTU      ---------------------------------
DNLI_MYCTA      ---------------------------------
DNLI_MYCBT      ---------------------------------
DNLI_MYCBP      ---------------------------------
DNLI_MYCBO      ---------------------------------
DNLI_PYRHO      ---------------------------------
DNLI_ARCFU      ---------------------------------
DNLI_ANAD2      ---------------------------------
DNLI_PYRAR      ---------------------------------
DNLI_ANADF      ---------------------------------
DNLI1_THEPD     ---------------------------------
DNLI_PYRKO      ---------------------------------
DNLI_METTP      ---------------------------------
DNLI_PICTO      ---------------------------------
DNLI_ARTCA      ---------------------------------
DNLI_HALSA      ---------------------------------
DNLI_HALS3      ---------------------------------
DNLI_AQUAE      ---------------------------------
DNLI_MYCUA      ---------------------------------
DNLI_SACEN      ---------------------------------
DNLI_NANEQ      ---------------------------------
DNLI_PERMH      ---------------------------------
DNLI_METMJ      ---------------------------------
DNLI2_METAC     ---------------------------------
DNLI2_KORCO     ---------------------------------
DNLI_PYRIL      ---------------------------------
DNLI2_METMA     ---------------------------------
DNLI1_XENLA     ---------------------------------
DNLI1_HUMAN     ---------------------------------
DNLI2_METBF     ---------------------------------
DNLI_UNCMA      ---------------------------------
DNLI_ANASK      ---------------------------------
DNLI_THENV      ---------------------------------
DNLI_CALMQ      ---------------------------------
DNLI4_YEAST     ---------------------------------
DNLI4_KLULA     ---------------------------------
DNLI_SULAC      ---------------------------------
DNLI_PYRAE      ---------------------------------
DNLI_AERPE      ---------------------------------
DNLI_ACIAM      ---------------------------------
DNLI4_SCHPO     ---------------------------------
DNLI1_ARATH     ---------------------------------
DNLI_SULTO      ---------------------------------
DNLI_NITMS      ---------------------------------
DNLI4_CANGA     ---------------------------------
DNLI2_THEPD     ---------------------------------
DNLI4_ASPFU     ---------------------------------
DNLI_HALLT      ---------------------------------
DNLI_VACCW      ---------------------------------
DNLI_VACCC      ---------------------------------
DNLI_VACCA      ---------------------------------
DNLI_MYCGI      ---------------------------------
DNLI1_DICDI     ---------------------------------
DNLI_STAMF      ---------------------------------
DNLI4_PHANO     ---------------------------------
DNLI4_COCIM     ---------------------------------
DNLI_VARV       ---------------------------------
DNLI4_CANAL     ---------------------------------
DNLI_METTH      ---------------------------------
DNLI_METS5      ---------------------------------
DNLI4_ASHGO     ---------------------------------
DNLI1_SCHPO     ---------------------------------
DNLI1_METMA     ---------------------------------
DNLI_METTF      ---------------------------------
DNLI_METM6      ---------------------------------
DNLI_METBU      ---------------------------------
DNLI_METM7      ---------------------------------
DNLI_OPITP      ---------------------------------
DNLI_META3      ---------------------------------
DNLI_METPE      ---------------------------------