[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39402.1

[Show Plain Result]


## Summary of Sequence Search
    1::209
  418::488     2e-04  31%  494 aa  MIAB_THEFY RecName: Full=(Dimethylallyl)adenosine tRNA
   29::73      3e-04  45%   90 aa  YPJI_ECOLI RecName: Full=Putative UPF0401 protein ypjI;
  312::404     8e-04  36%  457 aa  MNME_GEOMG RecName: Full=tRNA modification GTPase mnmE;       
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxRTIDGDEPLLSGAIGRRAKTDAPIILAGVIDVWPADSDGIHRVALSDAAGAV
MIAB_THEFY      ----------------------------------------------------------------------
YPJI_ECOLI      ----------------------------------------PLVSAGITDINIEDDQGIHRLIVRDAEGRM
MNME_GEOMG      ------------------RPFDDDDRMILAALAERRKSDLPVTLR-----IPGELEGVHTVAISTATGAG


                         .         .         *         .         .         .         .:140
query           VWRAFAVTEITAGRGRLKAVDEYTALFGIRHPEPAYEYVCAQMKGRGIRPCSDVDHDDWAEATRWVVADG
MIAB_THEFY      -------------------------------------------EGVTVRPGDMVTVEVTYAAPHHLVADS
YPJI_ECOLI      VWRAWNF-EPDAGEG-------------------------------------------------------
MNME_GEOMG      IDDLREAVFETFIHGRAIDSREYVALSQTRHRD-------ALVKARG-----------------------


                         +         .         .         .         .         *         .:210
query           GTRDPRRSWAKSAWRGRAVAHEAYAQAGLTLPMLGTWDPRPSILxxxxxxxxxxxxxxxxxxxxxxxxx
MIAB_THEFY      GIRNLRRTRAGDAWEARNAPERRPTGVLLGMPKVGAPEPQPSVV-------------------------
YPJI_ECOLI      ---------------------------------------------------------------------
MNME_GEOMG      ---------------------------------------------------------------------