[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for rpal2:ABE39446.1

[Show Plain Result]


## Summary of Sequence Search
    1::281
   10::284     5e-60  45%  284 aa  YEAE_ECOLI RecName: Full=Uncharacterized protein yeaE;
   16::289     2e-25  37%  316 aa  AK1BA_HUMAN RecName: Full=Aldo-keto reductase family 1 member B10; 
   14::274     8e-25  33%  276 aa  GR_BACSU RecName: Full=Glyoxal reductase;         Short=GR;        
   10::268     6e-23  36%  275 aa  Y2408_MYCS2 RecName: Full=Uncharacterized oxidoreductase
    3::271     2e-22  34%  301 aa  AKCL2_PIG RecName: Full=1,5-anhydro-D-fructose reductase;       
   10::203     2e-22  41%  331 aa  GS69_BACSU RecName: Full=General stress protein 69;       
   11::290     3e-22  34%  325 aa  AK1A1_PIG RecName: Full=Alcohol dehydrogenase [NADP+];       
    3::210     4e-22  34%  267 aa  DKGB_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    3::289     8e-22  33%  301 aa  AKCL2_RAT RecName: Full=1,5-anhydro-D-fructose reductase;       
   11::290     8e-22  34%  325 aa  AK1A1_BOVIN RecName: Full=Alcohol dehydrogenase [NADP+];       
    3::210     1e-21  34%  267 aa  DKGB_SALTI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    4::289     9e-21  32%  301 aa  AKCL2_MOUSE RecName: Full=1,5-anhydro-D-fructose reductase;        
   14::279     3e-20  32%  284 aa  P100_LEIMA RecName: Full=Probable reductase;         EC=1.1.-.-;
    3::210     3e-20  33%  267 aa  DKGB_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
    3::210     3e-20  33%  267 aa  DKGB_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   11::269     4e-20  35%  276 aa  Y1919_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1919;
   19::210     4e-20  34%  267 aa  DKGB_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   11::263     6e-20  35%  325 aa  AK1A1_PONAB RecName: Full=Alcohol dehydrogenase [NADP+];       
   11::269     1e-19  34%  276 aa  Y1985_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1985;
   10::289     2e-19  32%  316 aa  ALDR_RABIT RecName: Full=Aldose reductase;         Short=AR;       
   10::289     2e-19  31%  316 aa  ALDR_HUMAN RecName: Full=Aldose reductase;         Short=AR;       
    8::297     3e-19  34%  317 aa  XYL1_PICGU RecName: Full=NADPH-dependent D-xylose reductase;       
   42::309     4e-19  34%  310 aa  YCCK_BACSU RecName: Full=Uncharacterized oxidoreductase yccK;      
    9::296     4e-19  36%  318 aa  XYL1_PICST RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   16::289     5e-19  33%  316 aa  ALD1_MOUSE RecName: Full=Aldose reductase-related protein 1;       
   11::290     5e-19  32%  325 aa  AK1A1_RAT RecName: Full=Alcohol dehydrogenase [NADP+];       
   11::290     5e-19  33%  325 aa  AK1A1_MOUSE RecName: Full=Alcohol dehydrogenase [NADP+];       
   14::275     7e-19  37%  323 aa  XYL1_CANSH RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   19::297     1e-18  33%  323 aa  AK1C1_MACFU RecName: Full=Aldo-keto reductase family 1 member C1
   11::217     1e-18  37%  325 aa  AK1A1_HUMAN RecName: Full=Alcohol dehydrogenase [NADP+];       
   10::289     2e-18  30%  316 aa  ALDR_RAT RecName: Full=Aldose reductase;         Short=AR;       
   10::286     2e-18  29%  316 aa  ALDR_PIG RecName: Full=Aldose reductase;         Short=AR;       
   19::297     3e-18  34%  323 aa  AK1C2_HUMAN RecName: Full=Aldo-keto reductase family 1 member C2;  
   19::297     3e-18  33%  323 aa  AK1C1_HUMAN RecName: Full=Aldo-keto reductase family 1 member C1;  
   10::246     4e-18  31%  323 aa  ALDX_SPOSA RecName: Full=Aldehyde reductase 1;         Short=ALR 1;
   13::297     6e-18  31%  323 aa  PGFS2_BOVIN RecName: Full=Prostaglandin F synthase 2;       
   13::297     6e-18  31%  323 aa  PGFS1_BOVIN RecName: Full=Prostaglandin F synthase 1;       
    3::266     6e-18  36%  320 aa  AKCL2_MACFA RecName: Full=1,5-anhydro-D-fructose reductase;        
   19::297     7e-18  32%  323 aa  AK1C1_MACFA RecName: Full=Aldo-keto reductase family 1 member C1
    2::202     7e-18  38%  228 aa  AK1A1_CRIGR RecName: Full=Alcohol dehydrogenase [NADP+];       
   13::297     1e-17  31%  323 aa  DDBX_BOVIN RecName: Full=Dihydrodiol dehydrogenase 3;       
   10::289     1e-17  30%  316 aa  ALDR_MOUSE RecName: Full=Aldose reductase;         Short=AR;       
    9::262     1e-17  32%  315 aa  ALDR_BOVIN RecName: Full=Aldose reductase;         Short=AR;       
   16::289     1e-17  32%  316 aa  ALD2_CRIGR RecName: Full=Aldose reductase-related protein 2;       
   44::281     1e-17  34%  324 aa  YAJO_ECOLI RecName: Full=Uncharacterized oxidoreductase yajO;      
   11::269     1e-17  37%  323 aa  Y2320_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb2320;   
   11::269     1e-17  37%  323 aa  Y2298_MYCTU RecName: Full=Uncharacterized oxidoreductase
   15::276     2e-17  35%  324 aa  XYL2_CANTR RecName: Full=NADPH-dependent D-xylose reductase II,III;
   19::297     2e-17  31%  323 aa  AK1C1_PONAB RecName: Full=Aldo-keto reductase family 1 member C1
   10::214     3e-17  37%  297 aa  ALRA_DICDI RecName: Full=Aldose reductase A;         Short=ARA;    
   16::289     3e-17  31%  316 aa  ALD2_MOUSE RecName: Full=Aldose reductase-related protein 2;       
   10::289     3e-17  32%  324 aa  A1A1A_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] A;       
   13::219     4e-17  36%  326 aa  YDJG_ECOLI RecName: Full=Uncharacterized oxidoreductase ydjG;      
   19::301     4e-17  33%  321 aa  NADO1_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
   14::275     6e-17  26%  280 aa  YTBE_BACSU RecName: Full=Uncharacterized oxidoreductase ytbE;      
   15::276     6e-17  34%  324 aa  XYL1_CANTR RecName: Full=NAD(P)H-dependent D-xylose reductase I,II;
   11::281     6e-17  31%  301 aa  ALDR_ENCCU RecName: Full=Aldose reductase;         Short=AR;       
   17::205     8e-17  33%  284 aa  I3ACR_SCHPO RecName: Full=NAD/NADP-dependent indole-3-acetaldehyde
   17::257     1e-16  34%  312 aa  YPR1_YEAST RecName: Full=Putative reductase 1;         EC=1.1.1.-;
   12::270     1e-16  30%  275 aa  DKGA_ECOLI RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   22::298     1e-16  29%  321 aa  ALRC_DICDI RecName: Full=Aldose reductase C;         Short=ARC;    
   17::257     1e-16  36%  312 aa  GCY_YEAST RecName: Full=Protein GCY;         EC=1.1.1.-;
   13::263     1e-16  30%  323 aa  AKC1H_RAT RecName: Full=Aldo-keto reductase family 1 member C18;   
   11::297     2e-16  35%  319 aa  XYL1_ASPNG RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   13::297     2e-16  30%  323 aa  PE2R_RABIT RecName: Full=Prostaglandin-E(2) 9-reductase;       
   12::270     2e-16  29%  275 aa  DKGA_ECO57 RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   13::263     2e-16  31%  323 aa  AK1CD_MOUSE RecName: Full=Aldo-keto reductase family 1 member C13; 
   20::261     3e-16  38%  325 aa  YBN4_SCHPO RecName: Full=Uncharacterized oxidoreductase C8E4.04;   
    3::266     3e-16  34%  320 aa  AKCL2_HUMAN RecName: Full=1,5-anhydro-D-fructose reductase;        
   15::299     3e-16  31%  325 aa  AK1D1_MOUSE RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   13::296     3e-16  30%  322 aa  AK1CN_HORSE RecName: Full=Aldo-keto reductase family 1 member C23; 
   86::359     4e-16  33%  377 aa  Y1669_ARATH RecName: Full=Uncharacterized oxidoreductase At1g06690,
   13::297     4e-16  30%  323 aa  DHB5_MOUSE RecName: Full=Estradiol 17 beta-dehydrogenase 5;        
   19::274     7e-16  37%  322 aa  XYL1_CANTE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   19::297     1e-15  30%  323 aa  AK1C4_HUMAN RecName: Full=Aldo-keto reductase family 1 member C4;  
   19::297     1e-15  30%  323 aa  AK1C3_PONAB RecName: Full=Aldo-keto reductase family 1 member C3
   16::255     2e-15  33%  322 aa  NADO2_ORYSJ RecName: Full=Probable NAD(P)H-dependent oxidoreductase
   11::263     2e-15  31%  278 aa  DKGA_CORSC RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   17::211     3e-15  34%  312 aa  KAR_YEAST RecName: Full=NADPH-dependent alpha-keto amide reductase;
   13::297     3e-15  27%  323 aa  AKC1H_MOUSE RecName: Full=Aldo-keto reductase family 1 member C18; 
   19::297     3e-15  30%  323 aa  AK1C3_HUMAN RecName: Full=Aldo-keto reductase family 1 member C3;  
    9::288     4e-15  29%  310 aa  S6PD_MALDO RecName: Full=NADP-dependent D-sorbitol-6-phosphate
   18::270     4e-15  30%  277 aa  DKGA_YERPE RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   21::221     6e-15  35%  279 aa  Y4205_MYCGI RecName: Full=Uncharacterized oxidoreductase Mflv_4205;
   15::300     6e-15  30%  326 aa  AK1D1_RABIT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   15::300     6e-15  31%  326 aa  AK1D1_HUMAN RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;    
   19::259     8e-15  31%  320 aa  ALDR_HORVU RecName: Full=Aldose reductase;         Short=AR;       
   25::231     1e-14  31%  275 aa  YER5_SCHPO RecName: Full=Uncharacterized oxidoreductase C2F3.05c;  
   15::302     1e-14  30%  324 aa  XYL1_CANPA RecName: Full=NADH-dependent D-xylose reductase;        
   12::300     1e-14  39%  346 aa  TAS_SHIFL RecName: Full=Protein tas;
   12::300     1e-14  39%  346 aa  TAS_ECOLI RecName: Full=Protein tas;
    5::309     1e-14  31%  310 aa  IOLS_BACSU RecName: Full=Protein iolS;         EC=1.1.1.-;AltName:
    4::161     2e-14  34%  306 aa  YQKF_BACSU RecName: Full=Uncharacterized oxidoreductase yqkF;      
   28::217     2e-14  33%  306 aa  IN22_MAIZE RecName: Full=IN2-2 protein;
   13::263     2e-14  33%  322 aa  DIDH_RAT RecName: Full=3-alpha-hydroxysteroid dehydrogenase;       
   24::225     2e-14  36%  283 aa  Y2407_MYCS2 RecName: Full=Uncharacterized oxidoreductase
   41::264     2e-14  34%  315 aa  6DCS_SOYBN RecName: Full=NAD(P)H-dependent 6'-deoxychalcone
   11::270     3e-14  35%  318 aa  XYL1_PACTA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   37::312     4e-14  30%  340 aa  YAKC_SCHPO RecName: Full=Aldo-keto reductase yakc [NADP+];       
   13::263     5e-14  32%  323 aa  AK1CO_HORSE RecName: Full=Aldo-keto reductase family 1 member
   15::281     6e-14  30%  286 aa  YDBC_ECOLI RecName: Full=Putative oxidoreductase ydbC;       
   13::263     6e-14  32%  318 aa  AK1CL_RAT RecName: Full=Aldo-keto reductase family 1 member C21;   
   24::224     8e-14  34%  282 aa  Y1987_MYCUA RecName: Full=Uncharacterized oxidoreductase MUL_1987; 
   23::223     8e-14  35%  281 aa  Y1744_MYCMM RecName: Full=Uncharacterized oxidoreductase MMAR_1744;
   11::299     8e-14  31%  324 aa  XYL1_TRIRE RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   13::263     8e-14  33%  323 aa  AK1CL_MOUSE RecName: Full=Aldo-keto reductase family 1 member C21; 
   13::291     8e-14  30%  327 aa  AK1A1_XENTR RecName: Full=Alcohol dehydrogenase [NADP+];       
   16::200     2e-13  36%  283 aa  YKW2_SCHPO RecName: Full=Uncharacterized oxidoreductase P32A8.02;  
   41::226     2e-13  34%  284 aa  Y3816_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_3816; 
   38::223     2e-13  34%  281 aa  Y3007_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_3007; 
   10::276     4e-13  32%  327 aa  GRE3_YEAST RecName: Full=NADPH-dependent aldose reductase GRE3;    
   10::288     4e-13  28%  324 aa  A1A1B_DANRE RecName: Full=Alcohol dehydrogenase [NADP+] B;       
   13::278     9e-13  32%  329 aa  XYL1_KLULA RecName: Full=NAD(P)H-dependent D-xylose reductase;     
   12::258     9e-13  31%  277 aa  DKGB_CORSS RecName: Full=2,5-diketo-D-gluconic acid reductase B;   
   19::297     1e-12  28%  323 aa  AK1C4_MACFA RecName: Full=Aldo-keto reductase family 1 member C4;  
   48::277     2e-12  28%  283 aa  Y1984_MYCSK RecName: Full=Uncharacterized oxidoreductase Mkms_1984;
   48::277     2e-12  28%  283 aa  Y1938_MYCSS RecName: Full=Uncharacterized oxidoreductase Mmcs_1938;
   42::284     2e-12  31%  296 aa  MORA_PSEPU RecName: Full=Morphine 6-dehydrogenase;       
   16::293     2e-12  33%  344 aa  KCAB_SCHPO RecName: Full=Putative voltage-gated potassium channel
   13::291     2e-12  29%  327 aa  AK1A1_XENLA RecName: Full=Alcohol dehydrogenase [NADP+];       
   11::181     2e-12  37%  298 aa  YDHF_ECOLI RecName: Full=Oxidoreductase ydhF;         EC=1.-.-.-;
   21::221     2e-12  34%  279 aa  Y2161_MYCVP RecName: Full=Uncharacterized oxidoreductase Mvan_2161;
   12::270     2e-12  27%  275 aa  DKGA_SALTY RecName: Full=2,5-diketo-D-gluconic acid reductase A;   
   12::270     2e-12  27%  275 aa  DKGA_SALTI RecName: Full=Putative 2,5-diketo-D-gluconic acid
   17::290     2e-12  30%  311 aa  ALRB_DICDI RecName: Full=Aldose reductase B;         Short=ARB;    
   18::257     3e-12  32%  300 aa  YCSN_BACSU RecName: Full=Uncharacterized oxidoreductase ycsN;      
   42::297     3e-12  30%  323 aa  AK1C4_MACFU RecName: Full=Aldo-keto reductase family 1 member C4;  
    6::221     5e-12  30%  324 aa  CRO_RANCA RecName: Full=Rho crystallin;
    6::221     6e-12  30%  324 aa  CRO_RANTE RecName: Full=Rho crystallin;
    7::216     1e-11  37%  326 aa  YRPG_BACSU RecName: Full=Uncharacterized oxidoreductase yrpG;      
   48::277     1e-11  28%  283 aa  Y1918_MYCSJ RecName: Full=Uncharacterized oxidoreductase Mjls_1918;
    1::299     1e-11  27%  321 aa  DTDH_MUCMU RecName: Full=4-dihydromethyl-trisporate dehydrogenase; 
   13::291     1e-11  27%  327 aa  AK1A1_CHICK RecName: Full=Alcohol dehydrogenase [NADP+];       
   15::300     1e-11  31%  326 aa  AK1D1_RAT RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase;      
   39::224     2e-11  36%  282 aa  Y2999_MYCTA RecName: Full=Uncharacterized oxidoreductase MRA_2999; 
   39::224     2e-11  36%  282 aa  Y2971_MYCTU RecName: Full=Uncharacterized oxidoreductase
   39::244     2e-11  32%  387 aa  STCV_EMENI RecName: Full=Putative sterigmatocystin biosynthesis
   39::224     3e-11  36%  282 aa  Y2996_MYCBO RecName: Full=Uncharacterized oxidoreductase Mb2996;   
   39::224     3e-11  36%  282 aa  Y2993_MYCBP RecName: Full=Uncharacterized oxidoreductase BCG_2993; 
   27::288     4e-11  28%  306 aa  YH5B_SCHPO RecName: Full=Uncharacterized oxidoreductase C215.11c;  
   21::269     5e-11  32%  321 aa  YDG7_SCHPO RecName: Full=Uncharacterized oxidoreductase C26F1.07;  
   37::226     1e-10  35%  286 aa  Y4483_MYCA1 RecName: Full=Uncharacterized oxidoreductase MAV_4483; 
   37::226     1e-10  34%  286 aa  Y4149_MYCPA RecName: Full=Uncharacterized oxidoreductase MAP_4149; 
   24::224     3e-10  31%  282 aa  Y1669_MYCLE RecName: Full=Uncharacterized oxidoreductase ML1669;   
   24::224     3e-10  31%  282 aa  Y1669_MYCLB RecName: Full=Uncharacterized oxidoreductase MLBr01669;
   24::329     3e-10  30%  388 aa  NORA_ASPFL RecName: Full=Norsolorinic acid reductase;       
    4::209     3e-10  30%  328 aa  KCAB_ORYSJ RecName: Full=Probable voltage-gated potassium channel
   40::245     3e-10  28%  367 aa  KCAB2_XENLA RecName: Full=Voltage-gated potassium channel subunit
   40::320     3e-10  30%  367 aa  KCAB2_HUMAN RecName: Full=Voltage-gated potassium channel subunit
   16::263     3e-10  28%  322 aa  AK1CD_MESAU RecName: Full=Aldo-keto reductase family 1 member C13; 
   24::329     3e-10  30%  388 aa  NORA_ASPPA RecName: Full=Norsolorinic acid reductase;       
   40::320     3e-10  30%  367 aa  KCAB2_RAT RecName: Full=Voltage-gated potassium channel subunit
   40::320     3e-10  30%  367 aa  KCAB2_MOUSE RecName: Full=Voltage-gated potassium channel subunit
   40::320     3e-10  30%  367 aa  KCAB2_BOVIN RecName: Full=Voltage-gated potassium channel subunit
   16::330     7e-10  28%  346 aa  YGHZ_ECO57 RecName: Full=Uncharacterized protein yghZ;
   11::201     1e-09  32%  282 aa  YJ66_YEAST RecName: Full=Uncharacterized oxidoreductase YJR096W;   
   12::261     1e-09  28%  321 aa  YOF5_CAEEL RecName: Full=Uncharacterized oxidoreductase ZK1290.5;  
   16::224     2e-09  28%  346 aa  YGHZ_ECOLI RecName: Full=Uncharacterized protein yghZ;
   16::120     5e-09  36%  129 aa  AKCL1_HUMAN RecName: Full=Aldo-keto reductase family 1 member
   28::218     6e-09  30%  307 aa  A115_TOBAC RecName: Full=Auxin-induced protein PCNT115;
    8::234     1e-08  31%  342 aa  YP088_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase
   58::235     1e-08  28%  367 aa  ARK72_RAT RecName: Full=Aflatoxin B1 aldehyde reductase member 2;  
   39::238     3e-08  31%  385 aa  AAD_PHACH RecName: Full=Aryl-alcohol dehydrogenase [NADP+];        
   34::190     4e-08  29%  276 aa  YHH5_SCHPO RecName: Full=Uncharacterized oxidoreductase C28F2.05;  
   50::227     4e-08  30%  359 aa  ARK72_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
   58::235     9e-08  29%  367 aa  ARK72_MOUSE RecName: Full=Aflatoxin B1 aldehyde reductase member 2;
   22::199     2e-07  30%  331 aa  ARK74_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 4;
   18::195     3e-07  29%  327 aa  ARK73_RAT RecName: Full=Aflatoxin B1 aldehyde reductase member 3;  
   22::199     6e-07  30%  331 aa  ARK73_HUMAN RecName: Full=Aflatoxin B1 aldehyde reductase member 3;
   27::190     1e-06  36%  285 aa  ALKE_BABBO RecName: Full=Aldo-keto reductase;Flags: Fragment;
    9::207     2e-06  30%  334 aa  YEZB_SCHPO RecName: Full=Uncharacterized oxidoreductase C3A11.11c; 
    6::207     7e-06  29%  333 aa  PLR2_SCHPO RecName: Full=Probable pyridoxal reductase 2;       
   28::158     7e-06  31%  335 aa  ARA2_YEAST RecName: Full=D-arabinose 1-dehydrogenase;       
  131::242     1e-05  31%  351 aa  YI7E_SCHPO RecName: Full=Putative aryl-alcohol dehydrogenase
   33::273     2e-05  24%  363 aa  AAD3_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase AAD3; 
   90::230     3e-05  25%  329 aa  AAD4_YEAST RecName: Full=Probable aryl-alcohol dehydrogenase AAD4; 
   35::276     1e-04  25%  376 aa  AAD14_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase
   48::188     3e-04  25%  288 aa  AAD10_YEAST RecName: Full=Putative aryl-alcohol dehydrogenase
    1::281

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSWDTRRFGRGGPEIAPIGQGTWYIDRGDRTAAIAALRRGLDLGMTHIDTAEMYGDAEPLVAEAIDGRRD
YEAE_ECOLI      ----------GDVSLPAVGQGTWYMDASQRKTEVAALRAGIELGLTLIDTAEMYADAEKVVGEALTGLRE
AK1BA_HUMAN     -----------------VGLGTWKSPLGKVKEAVKV---AIDAGYRHIDCAYVYQN-EHEVGEAIQEKRE
GR_BACSU        -----------GVEMPWFGLGVFKVENGNE--ATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESARE
Y2408_MYCS2     -----------GNSIPQVGLGVWQTPAEDTERAVAA---ALQAGYRHIDTAAAYNETETGRAIANSGPRE
AKCL2_PIG       -------------KIPVLGLGTWQAAPGEVTEAVKV---AIDTGYRHFDCAYLYHNENEVIQAKIDERRE
GS69_BACSU      -----------GIEASRIGLGTWAIGGTDEKTSIETIRAALDQGITLIDTAPAYGQSEEIVGKAIKGKRD
AK1A1_PIG       -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALTVGYRHIDCAAIYGNGEALTETVGPGKRE
DKGB_SALTY      --------------IPAFGLGTF---RLKDDVVIASVKTALELGYRAVDTAQIY-DNEAAVGQAIAESRN
AKCL2_RAT       -------------QIPTVGLGTWKASPGEVTDAVKV---AINLGYRHFDCAYLYHNESEVIKEKIKEKRD
AK1A1_BOVIN     -----------GQKMPLIGLGTWKSDPGQVKAAI---KYALSVGYRHIDCAAIYGN-ETEIGEALKENRE
DKGB_SALTI      --------------IPAFGLGTF---RLKDDVVIASVKTALELGYRAVDTAQIY-DNEAAVGQAIAESRN
AKCL2_MOUSE     --------------IPTVGLGTWKASPGEVTDAV---KLAINLGYRHFDCAYLYHNESEVISEKIKEKRE
P100_LEIMA      -----------GVKMPQFGLGVWQSPAGEVTEN--AVNWALCAGYRHIDTAAIYKNEESVGARASGVPRE
DKGB_ECOLI      --------------IPAFGLGTF---RLKDDVVISSVITALELGYRAIDTAQIY-DNEAAVGQAIAESRH
DKGB_ECO57      --------------IPAFGLGTF---RLKDDVVISSVKTALELGYRAIDTAQIY-DNEAAVGLAIAESRH
Y1919_MYCSJ     -----------GNSIPQVGLGVWQTPPEDTERXXXXXXXX---GYRHVDTAAAYGNEEQIAQSGLD--RS
DKGB_YERPE      ---------------------------------IDSVSQALTLGYRAIDTAQIYENEAP-VGQAIQENRD
AK1A1_PONAB     -----------GQKMPLIGLGTWKSEPGQVKAAV---KYALSVGYRHIDCAAIYGN-EPEIGEALKGKRE
Y1985_MYCSK     -----------GNSIPQVGLGVWQTPPEDTERXXXXXXXX---GYRHVDTAAAYGNEEQIAQSGLD--RS
ALDR_RABIT      -----------GAKMPILGLGTWKSPPGQVTEAV---KTAIDLGYRHIDCAHVYQNEEKLKEQVV--KRE
ALDR_HUMAN      -----------GAKMPILGLGTWKSPPGQVTEAVKV---AIDVGYRHIDCAHVYQN-ENEVGVAIQEKRE
XYL1_PICGU      -----------GYEMPSVGFGCWKVDKA---TCADTIYNAIKVGYRLFDGAEDYGNEKEVINRALDEARD
YCCK_BACSU      ------------------------------------VRTALDGGVNFIDTAFIYGRSEELIGEVVQERRN
XYL1_PICST      -----------GYDMPAVGFGCWKVDVDTCSEQIY---RAIKTGYRLFDGAEDYANEKLVVKKAIDEKRE
ALD1_MOUSE      -----------------VGLGTWKSSPGQVKEAVKA---AIDAGYRHIDCAYVYHN-ENEVGEAIQEKRE
AK1A1_RAT       -----------GQKMPLIGLGTWKSEPGQVKAAI---KYALSVGYRHIDCASVYGN-ETEIGEALKESRE
AK1A1_MOUSE     -----------GQKMPLIGLGTWKSEPGQVKAAI---KHALSAGYRHIDCASVYGN-ETEIGEALSGKRE
XYL1_CANSH      -----------GLEMPSIGFGCWKLDK---STAADQVYNAIKAGYRLFDGAEDYGNEQEVVKRAIDETRE
AK1C1_MACFU     -----------------LGFGTYAPAEVPKNKAIEATKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
AK1A1_HUMAN     -----------GQKMPLIGLGTWKSEPGQVKAAV---KYALSVGYRHIDCAAIYGN-EPEIGEALKGKRE
ALDR_RAT        -----------GTKMPTLGLGTWKSPPGQVTEAVKV---AIDMGYRHIDCAQVYQNEEKLKEQVV--KRQ
ALDR_PIG        -----------GAKMPILGLGTWKSPPGKVTEAVKV---AIDLGYRHIDCAHVYQNENEVLQEKLQGKRE
AK1C2_HUMAN     -----------------LGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQIRSKIADGKRE
AK1C1_HUMAN     -----------------LGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQIRSKIADGKRE
ALDX_SPOSA      -----------GASLELVGYGTWQAAPGEVGQGVKV---AIETGYRHLDLAKVYSN-QPEVGAAIKEKRE
PGFS2_BOVIN     -----------GHFIPVLGFGTYAPEEVPKSEALEATKFAIEVGFRHVDSAHLYQNEEQ-VGQAIDGKRE
PGFS1_BOVIN     -----------GHFIPVLGFGTYAPEEVPKSEALEATKFAIEVGFRHVDSAHLYQNEEQ-VGQAIDGKRE
AKCL2_MACFA     -------------DIPAVGLSCWKASPGKVTEAVKV---AIDAGYRHFNCAYFYHNEKEVGAKIKEGRRE
AK1C1_MACFA     -----------------LGFGTYAPAEVPKNKALEATKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
AK1A1_CRIGR     -----------------IGLGTWKSNPGQVKAAI---KYALSVGYRHIDCAAVYGN-EIEIGEALKENRE
DDBX_BOVIN      -----------GHFIPVLGFGTFAPREVPKSEALEVTKFAIEAGFRHIDSAHLYQNEEQ-VGQAIDGKRE
ALDR_MOUSE      -----------GTKMPTLGLGTWKSPPGQVTEAVKV---AIDLGYRHIDCAQVYQNEEKLKEQVV--KRQ
ALDR_BOVIN      -----------GAKMPILGLGTWKSPPGKVTEAVKV---AIDLGYRHIDCAHVYQN-ENEVGLALQAKRE
ALD2_CRIGR      -----------------VGLGTWQSPPGQVKEAVKV---AIDAGYRHIDCAYAYYN-EHEVGEAIQERRE
YAJO_ECOLI      ------------------------------------IKRALEGGINFFDTANSYSDSEEIVGRALRARRE
Y2320_MYCBO     -------------QVSRIGLGTWQFGSGDRYATGAAVKRARALGVTLFDTAEIYGKSERILGEALGDDRT
Y2298_MYCTU     -------------QVSRIGLGTWQFGSGDRYATGAAVKRARALGVTLFDTAEIYGKSERILGEALGDDRT
XYL2_CANTR      -----------GYEMPLVGFGCWKVN--NETAA-DQIYNAIKTGYRLFDGAEDYGN-EKEVGEGINRKRE
AK1C1_PONAB     -----------------LGFGTYAPPEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQIRSKIADGKRE
ALRA_DICDI      -----------GHKIPLVGFGTW---KAETTLVGKAVEVALDAGYRHIDCAAVYLN-EKEVGEAFTKKRE
ALD2_MOUSE      -----------------VGLGTW---KSPPNQVKEAVKAAIDAGYRHIDCAYAYCN-ENEVGEAIQEKRE
A1A1A_DANRE     -----------GQRMPTVGLGTWKSAPGQVKQAVLA---ALDCGYRHIDCAAAYSN-EREVGEALTERRD
YDJG_ECOLI      --------------LSRMGLGTWAIGGGDRQICIDTILEAHRCGINLIDTAPGYGNSEVIVGQALKKLRE
NADO1_ORYSJ     -----------------VGMGTAAFPFTSSEDTTAAMLRAIELGYRHFDTARIYGCVGEAVAEAVRASRA
YTBE_BACSU      -----------GVEMPWFGLGVFQVEEGSEL--VNAVKTAIVHGYRSIDTAAIYGNXXXXXXXXXXXXXX
XYL1_CANTR      -----------GYEMPLVGFGCWKVTNA---TAADQIYNAIKTGYRLFDGAEDYGN-EKEVGEGINRKRE
ALDR_ENCCU      -----------GKEIPTVGLGTWGME--DEAVLEGAIRNALSLGYRHIDTAFIYGNLKKLFDEGVVQRKD
I3ACR_SCHPO     -----------------VGTALFKKEKGEINRTIVSVKNALAAGFIHIDCAEVYGNEEEVGVALKEANRS
YPR1_YEAST      -----------GASIPVLGFGTWRVDNNGYHSVIAALKAGY----RHIDAAAIYLNEEEVGRAIKDSGRE
DKGA_ECOLI      -----------GNVMPQLGLGVW---QASNEEVITAIQKALEVGYRSIDTAAAYKNEEG-VGKALKNNRE
ALRC_DICDI      -----------GNQIPSIGLGTYYSENPGEVGD--AINNALKNGYRHIDGAAFYGN-EKVIGNSLEIKRE
GCY_YEAST       -----------GAQIPQIGLGTWQSKEND---AYKAVLTALKDGYRHIDTAAIYRN-EDQVGQAIKDSRE
AKC1H_RAT       -----------GHSIPVLGFGTYATEENLRKKSMESTKIAIDVGFRHIDCSHLYQNEEEIVSKIEDGKRE
XYL1_ASPNG      -----------GYDMPLVGFGLWKVNNDTCADQIYAIKEGYRL----FDGACDYGEAGQGIARAIDGKRE
PE2R_RABIT      -----------GHFIPVLGFGTYAPEEVPKSKAMEATKIAIDAGFRHIDSAYFYKNEKAIRSKIADGKRE
DKGA_ECO57      -----------GNVMPQLGLGVW---QASNEEVITAIQKALEVGYRSFDTAAAYKNEEG-VGKALKNNRE
AK1CD_MOUSE     -----------GHLIPALGFGTYKPKEVPKSKSLEAACLALDVGYRHVDTAYAY-QVEEEIGQAIQSKRE
YBN4_SCHPO      -----------GDKIPSIGLGTWRSGKDETKNAVCA---ALKAGYRHIDTAHIYGN-EKEIGEGIRESRT
AKCL2_HUMAN     -------------DIPAVGLSSWKASPGKVTEAV---KEAIDAGYRHFDCAYFYHNEREVGAKIKEGRRE
AK1D1_MOUSE     -----------GNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHN-EHEVGEAIEGKRE
AK1CN_HORSE     -----------GHFIHALGFGTYAPNEVPKSKAVEATKSAIDAGFRHIDCAHLY-DNEKEVGLAIDGKRE
Y1669_ARATH     -------------------------------AAKGAFDTSLDNGIDFFDTAEVYGSSETLLGRFIRERKE
DHB5_MOUSE      -----------GHFIPILGFGTYAPQEVPKSKATEATKIAIDAGFRHIDSASMYQNEKEIRSKIADGKRE
XYL1_CANTE      -----------------IGFGCWKLANA---TAGEQVYQAIKAGYRLFDGAEDYGNEKEVVKRAIDEKRE
AK1C4_HUMAN     -----------------LGFGTYAPPEVPRNRAVEVTKLAIEAGFRHIDSAYLYNNEEQIRSKIADGKRE
AK1C3_PONAB     -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
NADO2_ORYSJ     ------------PTMPRIGMGTAAFPFTSSEETTAALLRAIELGYRHFDTARLYGCVSEAVAEAVRASRA
DKGA_CORSC      -----------GNSIPQLGYGVFKVPPADTQRAV---EEALEVGYRHIDTAAIYGNEEGVXXXXXXXXRD
KAR_YEAST       ------------PAIAIIGTGTWYTDATFSNSLVEQIVYALKLGIIHIDAAEIYR-TYPEVGKALEKPRN
AKC1H_MOUSE     -----------GHSIPVLGFGTYATEEHLKKKSMESTKIAIDVGFCHIDCSHLYQNEEEILSKIEDGKRE
AK1C3_HUMAN     -----------------LGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEAIRSKIADGKRE
S6PD_MALDO      -----------GYEMPVIGLGLWRLEKDELKEVIL---NAIKIGYRHFDCAAHYADVGEALAEAFKTKRE
DKGA_YERPE      -----------------LGLGVWQASIQETELAVS---KALEVGYRSIDTAAIYKNXXXXXXXXXXXXRD
Y4205_MYCGI     -----------------IGLGVGELSDAETEQAVTA---ALEAGYRLIDTAAAYGN-EAAVGRAIAASRD
AK1D1_RABIT     -----------GNSIPIIGLGTYSEPKTTPKGSCASVKIAIDTGYRHIDGAYIYQNGETFREKIAEGRRE
AK1D1_HUMAN     -----------GNSIPIIGLGTYSEPKSTPKGACASVKVAIDTGYRHIDGAYIYQN-EHEVGEAIEGRRE
ALDR_HORVU      ---------KSGHAMPAVGLGTW---RAGSDTAHSVRTAITEAGYRHVDTAAEYG-VEKEVGKGLKAARK
YER5_SCHPO      ----------------------------NRTKCFDSVYAALQCGYRHIDSAQMYGRAILKFMEETGTKRE
XYL1_CANPA      -----------GYEIPLVGFGCWKLTND---VASDQIYRAIKSGYRLFDGAEDYAN-EQEVGEGIKRKRE
TAS_SHIFL       -------------EVSTLGLGTMFGEQNSEADAHAQLDYAVAQGINLIDVAEMYGLTETYVGNAKHGSRE
TAS_ECOLI       -------------EVSTLGLGTMFGEQNSEADAHAQLDYAVAQGINLIDVAEMYGLTETYVGNAKHGSRE
IOLS_BACSU      ------KLGKSDLQVFPIGLGTLYPNLNEETGK-ELVREAIRNGVTMLDTAYIYGRSEELIGEVLEFNRE
YQKF_BACSU      -----RKLGTSDLDISEVGLGCMSLGT-EKNKALSILDEAIELGINYLDTADLYGRNEEIVGDAIQNRRH
IN22_MAIZE      -----------------MGMSAFYGPPKPESEMIKLIHHAVDAGVTFLDTSDVYGPHEVLLGKALQGGRE
DIDH_RAT        -----------GNFIPVLGFGTTVPEKVAKDEVIKATKIAIDNGFRHFDSAYLY-EVEEEVGQAIDGKRE
Y2407_MYCS2     --------------VVGIGVGELSDSEAERSVSAA-----LEAGYRLIDTAAAYGN-EAAVGRAIAASRD
6DCS_SOYBN      -----------------------------------AIIEAVKQGYRHFDTAAAYGSEQALLKEAIHVSRQ
XYL1_PACTA      -----------GRKIPAIGMGCWKLENA-ADMVYAAIKEGYRL----FDCACDYGN-EKEVGEGIDGKRK
YAKC_SCHPO      ----------------------------------AVLTHAADLGCTFWDSSDMYGFGEECIGRWFKGRRK
AK1CO_HORSE     -----------GHVIPVLGFGTYAPEEVPKSRTVEVTKLAIDAGFRHIDSAYSYNN-EKEVGQAIDGKRE
YDBC_ECOLI      ------RLGYGAMQLA--GPGVFGPPR-DRHVAITVLREALALGVNHIDTSDFYGPTNQIIREALYPYSD
AK1CL_RAT       -----------GHFIPVLGFGTAMPSELPKSKAKEVTKIAIDAGFHHFDSAFVY-NTEDHVGEAITTRRE
Y1987_MYCUA     -----------------LGMGVAGLSDDETERAVSA---ALEIGCRLIDTAAAYGN-EAAVGRALAASRA
Y1744_MYCMM     -----------------LGMGVAGLSDDETERAVSA---ALEIGCRLIDTAAAYGN-EAAVGRAIAASRA
XYL1_TRIRE      -----------GYDMPQVGFGLWKVDNA---VCADTVYNAIKAGYRLFDGACDYGNEKECVARAIDGKRE
AK1CL_MOUSE     -----------GNFIPVLGFGTALPLECPKSKAKELTKIAIDAGFHHFDSASVY-NTEDHVGEAIDGRRE
AK1A1_XENTR     -----------GQKIPLIGLGTWKSAPGQVKDAV---KYALGVGYRHIDCAFVYGN-ETEVGEAIKESRE
YKW2_SCHPO      -----------GMVIPRIGFGAFMLKYNE---CYGLVTQALDSGYRHIDTAAVYGN-EDICGKAINVKRT
Y3816_MYCA1     -----------------------------------AVSAALEVGCRLIDTAAAYGN-EAAVGRAIAASRA
Y3007_MYCPA     -----------------------------------AVSAALEVGCRLIDTAAAYGN-EAAVGRAIAASRA
GRE3_YEAST      -----------GLKMPLVGLGCWKIDK---KVCANQIYEAIKLGYRLFDGACDYGNEKEVISEGLVSRKD
A1A1B_DANRE     -----------GRKMPLLGLGTWKSEPGLVKQAVIW---ALESGYRHIDCAPIYAN-EPEIGEAFQERRE
XYL1_KLULA      -----------GEKMPLVGLGCWKMPND---VCADQIYEAIKIGYRLFDGAQDYANEKEVVNRAIKEKRE
DKGB_CORSS      -----------GRPFAEPGLGTYNL-RGDE--GVAAMVAAIDSGYRLLDTAVNY-ENESEVGRAVRASRD
AK1C4_MACFA     -----------------LGFGTYAXXXXXXXXXXXXTKLAIEAGFRHIDSAYLYNNEEQIRSKIADGKRE
Y1984_MYCSK     -------------------------------------------GYRLIDTAAVYGN-EAAVGRAVNASRE
Y1938_MYCSS     -------------------------------------------GYRLIDTAAVYGN-EAAVGRAVNASRE
MORA_PSEPU      -------------------------------------------GYRLIDTARSYNN-EAQVGEGIRNSRA
KCAB_SCHPO      -----RFLGRSGLKVSAFSLGGWYGNEGDVEHTKNCLKQAWDLGINTFDTAEIYGNSETVMGKAIKELRS
AK1A1_XENLA     -----------GQKMPLIGLGTWKSAPGQVKDAV---KYALGVGYRHIDCAFVYGN-ETEVGEAIKEKRE
YDHF_ECOLI      -----------GPEFSRFVMGYWRLMDWNMSARVSFIEEHLDLGVTTVDHADIYGQCEAAFGEALKHLRE
Y2161_MYCVP     -----------------IGLGVGELSDAEAEQSVLA---ALEAGYRLIDTAAAYGN-EAAVGRAIAKSRG
DKGA_SALTY      -----------GNVMPQLGLGVW---KASNEEVIAAIHKALEVGYRSIDTATAYQNEEGVALKAASVARE
DKGA_SALTI      -----------GNVMPQLGLGVW---KASNEEVIAAIHKALEVGYRSIDTATAYQNEEGVALKAASVARE
ALRB_DICDI      --------------IPMIGLGTY---NGAKVGEVGAVKVALKSGYRHIDGAAIYGHALKEVFAEGEIKRE
YCSN_BACSU      --------------------GLWRLNEWNYSDALSLIEWCIDHGITTFDHADIYGGCEKLFGNALPGLRE
AK1C4_MACFU     ----------------------------------------IEAGFRHIDSAYLYNNEEQIRSKIADGKRE
CRO_RANCA       ---ETRVTLNDGNMMPILGLGTYAAPDVPKSLAEEAVKTAIDVGYRHIDCAFITGNGNGIRSKISDGKRE
CRO_RANTE       ---ETRVTLNDGNMMPILGLGTYASPHVPKSLAEEAVKIAIDVGYRHIDCAFITGNGNGIRSKISDGKRE
YRPG_BACSU      --------GRTGLRVSRLCLGTFGVDTDEKTA-FRIMDEALDNGIQFFDTANIYGWGKNALTESIIGRRE
Y1918_MYCSJ     -------------------------------------------GYRLIDTAAVYGN-EAAVGRAVNASRE
DTDH_MUCMU      MSTDYLTLNRTGDKMPIRGFGCWKIDTKDCEETVY---QAIKTGYRLFDGACDYGNEVEVINKAINEKRE
AK1A1_CHICK     -----------GQKIPLIGLGTWKSEPGQVKEAV---KYALSVGYRHVDCAAAYSN-EAEIGDAFQEKRE
AK1D1_RAT       -----------GNSIPIIGLGTYSDPRPVPGKTFIAVKTAIDEGYRHIDGAYVYRN-EHEVGEAIEGKRE
Y2999_MYCTA     -----------------------------------AVSAALEIGCRLIDTAYAYGN-EAAVGRAIAASRE
Y2971_MYCTU     -----------------------------------AVSAALEIGCRLIDTAYAYGN-EAAVGRAIAASRE
STCV_EMENI      --------------------GQWTRAMGDVTTAFALLDRFYEAGGNFIDTANFYQGSEKWLGEASRGNRD
Y2996_MYCBO     -----------------------------------AVSAALEIGCRLIDTAYAYGN-EAAVGRAIAASRE
Y2993_MYCBP     -----------------------------------AVSAALEIGCRLIDTAYAYGN-EAAVGRAIAASRE
YH5B_SCHPO      ------RMGFGAMRVT--GDGIWDEPK-DKEACIATLKRLPELNINFIDTADSYGPSENLLREALYPYKG
YDG7_SCHPO      -----------GSKIPGLGLGTW---RSEPNQTKNAVKTALQYGYRHIDAAAIYGNEDEVIKESGVPRKD
Y4483_MYCA1     -------------------------DEETESSVLAALEAGCRL----IDTAASYGN-EAAVGRAIAASRE
Y4149_MYCPA     -------------------------DEETESSVLAALEAGCRL----IDTAASYGN-EAAVGRAIAASRE
Y1669_MYCLE     -----------------LGLGVAELSEDETERAVLA---ALEIGCRLIDTAAAYGN-EAAVSRAIAASRA
Y1669_MYCLB     -----------------LGLGVAELSEDETERAVLA---ALEIGCRLIDTAAAYGN-EAAVSRAIAASRA
NORA_ASPFL      -----------GVRVSPLCLGTMSFGNGDQATSFNMLDTFYESGGNFIDVANFYGDTERWVGEWMAQRRD
KCAB_ORYSJ      -----KNLGRSGLRVSQLSYGAWFGNQLDVKEAKALLQACRDAGVNFFDNAEVYGRAEEIMGQALGWRRS
KCAB2_XENLA     -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
KCAB2_HUMAN     -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
AK1CD_MESAU     --------------IPALGFGTYKPIEVPKSKAMEAANLAIGVGYRHIDTAYAY-QIEEEIGQAIQSKRE
NORA_ASPPA      -----------GVRVSPLCLGTMSFGNGDQATSFNMLDTFYESGGNFIDVANFYGDTERWVGEWMAQRRD
KCAB2_RAT       -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
KCAB2_MOUSE     -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
KCAB2_BOVIN     -----RNLGKSGLRVSCLGLGTWVTFGGQITDEMAEMTLAYDNGINLFDTAEVYGKAEVVLGNIIKKRRS
YGHZ_ECO57      -----RYCGKSGLRLPALSLGLWHVNALESQRAI--LRKAFDLGITHFDLANNYGSAEELLREDFAAYRD
YJ66_YEAST      -----------GFKIPSIALGTYDIPRS-QTAEI--VYEGVKCGYRHFDTAVLYGN-EKEVGDGINHKRE
YOF5_CAEEL      -------------EMPLIGLGTTHSGGYYHDAVLHSIKK---CGYRLIDTAKRYGVEKQLAVKNCSVPRE
YGHZ_ECOLI      -----RYCGKSGLRLPALSLGLWHVNALESQRAI--LRKAFDLGITHFDLANNYGSAEELLREDFAAYRD
AKCL1_HUMAN     -----------GPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEE-VGQAIDGKRE
A115_TOBAC      -----------------MGMSAFYGPPKPEPDMIQLIHHAINSGITLLDTSDVYGPHEILLGKALKGTRE
YP088_YEAST     ------RLGNSGLKISPIVIGCWVIE--DKTQIFKIMKHCYDKGLRTFDTADFYGLSERIIKEFLEYKRE
ARK72_RAT       --------------------------RMDASASAATVRAFLERGLNELDTAFMYCDXXXXXXXXXXXXXX
AAD_PHACH       -----------GDKWHPYGMGTM-----DKEASFKLLDAFYNAGGNFIDTANVYQDSEEFIGEWMEGNRD
YHH5_SCHPO      ----------------------------------------LSLGIRVIDSAITYRNEQDFCHQNVNIKRE
ARK72_HUMAN     --------------------------RMDAPASAAAVRAFLERGHTELDTAFMYSDGQ---SETIXXXXX
ARK72_MOUSE     --------------------------RMDASASAASVRAFLERGHSELDTAFMYCDGQ---SENIXXXXX
ARK74_HUMAN     --------------------------RMDAPTSAAVTRAFLERGHTEIDTAFLYSDGQSETILGGLGLRC
ARK73_RAT       --------------------------RMDVTSSSASVRAFLQRGHTEIDTAFVYANGQ---SETIXXXXX
ARK73_HUMAN     --------------------------RMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQ---SETIXXXXX
ALKE_BABBO      ----------------------------------------------------------------------
YEZB_SCHPO      --------------VGPIGLGTWTENPVPDEEAFRIMNYALSHGCSFWDAGEFYGLSEPLANLQLLSRYD
PLR2_SCHPO      -----------GFKVGPIGLGTWRPKQTPIKQAFELMNYALSQGSNYWNAGEFYGINPPLLADYFEKNAD
ARA2_YEAST      -----------------------YTDEPESIPLEDIIKYAFSHGINAIDTSPYYGPSEVLYGRALSNLRN
YI7E_SCHPO      ----------------------------------------------------------------------
AAD3_YEAST      -------------EVSYDGARSDFLKSMNKNRAFELLDTFYEAGGNFIDAANQNEQSEEWIGEWIQSRRD
AAD4_YEAST      ----------------------------------------------------------------------
AAD14_YEAST     ----------GGASIGDAWSG--FMGSMNKEQAFELLDAFYEAGGNCIDTANSYQESEIWIGEWMASRRD
AAD10_YEAST     ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EVFLVSKVLPSNASRSGAIAACERSLKRLKTDRLDCYLLHWRGKVRLADTVAAFEELVAAGKIRSWGVSN
YEAE_ECOLI      KVFLVSKVYPWNAGGQKAINACEASLRRLNTDYLDLYLLHWSGSFAFEETVAAMEKLIAQGKIRRWGVSN
AK1BA_HUMAN     DLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWGGKATFLDAWEAMEELVDEGLVKALGVSN
GR_BACSU        ELFITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKDKYKDTWRALEKLYKDGKIRAIGVSN
Y2408_MYCS2     DIFLVTKLWNSDQGYDATLAAFDASVQRLGVDYLDLYLIHWPENNKFVDTFKAFAHLRDQGRIRSIGVSN
AKCL2_PIG       DLFIVSKLWCTCHKKSLVKSACTRSLKALKLQYLDLYLIHWPGEVDLLDTWEAMEDLVIEGLVRAIGVSN
GS69_BACSU      QVILATKTLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPDPVPIEETAEVMKELYDAGKIRAIGVSN
AK1A1_PIG       ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPGTIRYKDTWKALEALVAKGLVRALGLSN
DKGB_SALTY      ELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSAVSVEEFMQALLEAKKQGLTREIGISN
AKCL2_RAT       ELFIVSKLWCTYHKQSLVKTACINTLEALNLDYLDLYLIHWSGKVSFLDTWEAMEDLVIEGLVKNIGVSN
AK1A1_BOVIN     ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWRGSTHYKETWRALEALVAKGLVRALGLSN
DKGB_SALTI      ELYITTKIWIENLSKDKLIPSLKESLKKLRTDYVDLTLIHWPSAVSVEEFMQALLEAKKQGLTREIGISN
AKCL2_MOUSE     DLFVVSKLWCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWNGKVSFLDTWEAMEDLVFEGLVKNLGVSN
P100_LEIMA      DVFITTKLWNTEQGYESTLAAFEESRQKLGVDYIDLYLIHWRGKDILSDSWRAFEQLYKEKKVRAIGVSN
DKGB_ECOLI      ELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWNDEVSVEEFMQALLEAKKQGLTREIGISN
DKGB_ECO57      ELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWNDEVSVEEFMQALLEAKKEGLTREIGISN
Y1919_MYCSJ     QVYLVTKLWNSEQGYDATLAAFEASVDRLGVDYLDLYLIHWPEKNLFVDTFRAFARLREDGRIRSIGVSN
DKGB_YERPE      ELFITTKIWIANLSKDKLIPSLRESIQKLKTDYVDLTLIHWNDEVSVAEFMSELLKAKGLGLTRQIGISN
AK1A1_PONAB     ELFVTSKLWNTKHHPEDVEPALQKTLADLQLEYLDLYLMHWRGSTHYKETWKALEALVAKGLVRALGLSN
Y1985_MYCSK     QVYLVTKLWNSEQGYDATLAAFEASVDRLGVDYLDLYLIHWPEKNLFVDTFKAFARLREDGRIRSIGVSN
ALDR_RABIT      ELFIVSKLWCTSHDKSLVKGACQKTXXXXXXXXXXXXXIHWAGNVDFLDTWEAMEGLVDEGLVKSIGVSN
ALDR_HUMAN      ELFIVSKLWCTYHEKGLVKGACQKTXXXXXXXXXXXXXIHWPGKTNILDTWAAMEELVDEGLVKAIGISN
XYL1_PICGU      ELFVVSKLWNSFHDPKNVEKALDRTLSDLKVDYLDLFLIHFPEGVPIIDTWRALEKMVEKGKIRSIGISN
YCCK_BACSU      ELIIATKSIELDNSREFLRSEVEKSLKRLKTDYIDLYYVHFDGKTPLAEVAGTLKELKDEGKIKAIGASN
XYL1_PICST      DLFLTSKLWNNYHHPDNVEKALNRTLSDLQVDYVDLFLIHFPGKVPILETWKALEKLVKAGKIRSIGVSN
ALD1_MOUSE      DLFIVSKLWATFFEKSLVKKAFQNTXXXXXXXXXXXXXVHWKGKVLLSDAWEAMEELVDQGLVKALGISN
AK1A1_RAT       ELFVTSKLWNTKHHPEDVEPAVRKTLADLQLEYLDLYLMHWRGSTHYKETWKALEALVAKGLVKALGLSN
AK1A1_MOUSE     ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWDGTVRYKETWKALEVLVAKGLVKALGLSN
XYL1_CANSH      EIFLTSKLWNNYHDPKNVETALNKTLKDLKVDYVDLFLIHFPEDVPILETWKALEKLVKAGKIRSIGVSN
AK1C1_MACFU     DIFYTSKLWCNSHRPEFVRPALERSLKNLQLDYVDLYLIHFNGKVDLCATWEAMEKCKDAGLAKSIGVSN
AK1A1_HUMAN     ELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWRGSTHYKETWKALEALVAKGLVQALGLSN
ALDR_RAT        DLFIVSKLWCTFHDQSMVKGACQKTXXXXXXXXXXXXXIHWSGNVDFVDTWTAMEQLVDEGLVKAIGVSN
ALDR_PIG        DLFIVSKLWCTDHEKNLVKGACQTTXXXXXXXXXXXXXIHWPTGFKFVETWEAMEELVDEGLVKAIGVSN
AK1C2_HUMAN     DIFYTSK-LWSNSHRPELVRALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
AK1C1_HUMAN     DIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFNGKI-LFDTVEAVEKCKDAGLAKSIGVSN
ALDX_SPOSA      DLFITSKLWNNSHRPEQVEPALDDTLKELGLEYLDLYLIHWPVEVSLVDTWKAMVKLLDTGKVKAIGVSN
PGFS2_BOVIN     DIFYTSKLWCNSLQPELVRPALEKSLQNLQLDYVDLYIIHESGKVDLCHTWEALEKCKDAGLTKSIGVSN
PGFS1_BOVIN     DIFYTSKLWCNSLQPELVRPALEKSLQNLQLDYVDLYIIHESGKVDLCHTWEALEKCKDAGLTKSIGVSN
AKCL2_MACFA     DLFIASKLWCTCHKKSLVKTACRRSLKALKLNYLDLYLIHWPGDTDFLDTWEAMEDLVITGLVKNIGVSN
AK1C1_MACFA     DIFYTSKLWCNSHRPEFVRPALERSLKNLQLDYVDLYLIHFNGKVDLCATWEAMEKCKDAGLAKSIGVSN
AK1A1_CRIGR     ELFVTSKLWNTKHHPEDVEAALRKTLADLQLEYLDLYLMHWRGSTHYKETWKALEALVAKGLVKALGLSN
DDBX_BOVIN      DIFYTSKLWSTSLRPELVRPALEKSLNNLQLDYVDLYIIHFNGKVDLCRTWEALEKCKDAGLTKSIGVSN
ALDR_MOUSE      DLFIVSKLWCTFHDKSMVKGAFQKTXXXXXXXXXXXXXIHWSGNVDFVDTWTAMEQLVDEGLVKTIGVSN
ALDR_BOVIN      DLFIVSKLWCTYHDKDLVKGACQKTXXXXXXXXXXXXXIHWPTGFKFVDTWTAMEELVDEGLVKAIGVSN
ALD2_CRIGR      DLFIVSKLWPTCFERKLLKEAFQXXXXXXXXXXXXXXXIHWTSKITFLDAWEVMEELVDEGLVKALGVSN
YAJO_ECOLI      DVVVATKVLPEGLSRAQILRSIDDSLRRLGMDYVDILQIHWDYNTPIEETLEALNDVVKAGKARYIGASS
Y2320_MYCBO     EVVVASKVFPV-APFPAVIKNRERSARRLQLNRIPLYQIHQPNPV-VPDSVIGMRDLLDSGDIGAAGVSN
Y2298_MYCTU     EVVVASKVFPV-APFPAVIKNRERSARRLQLNRIPLYQIHQPNPV-VPDSVIGMRDLLDSGDIGAAGVSN
XYL2_CANTR      ELFITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPEDVPLLDTWKALEKLVEAGKIKSIGISN
AK1C1_PONAB     DIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLVHFNGKI-LFDTVEAMEKCKDAGLAKSIGVSN
ALRA_DICDI      DVFITSKLWNTFHKKEHVRPALERTLSDLGLQYLDLYLVHWQEFVSIRETWEEMEKLVDAGLVKSIGLSN
ALD2_MOUSE      DLFIVSKLWPTCFEKKLLKEAFQXXXXXXXXXXXXXXXIHWQGRILTSKTTEGMEELVDQGLVKALGVSN
A1A1A_DANRE     DIFVTSKLWNTKHHPDDVEEACXXXXXXXXXXXXXXXXIHWRGDTHYRDTWAAMEKLVDQGLAKAIGLSN
YDJG_ECOLI      QVVVETKCLYKNLSPESIREEVAASLQRLGIDYIDIYMTHWQSVTPIAETVAVLNELKSEGKIRAIGAAN
NADO1_ORYSJ     DVFVTSKIWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPVSLTMEGVWRGMEECHRLGLARAIGVSN
YTBE_BACSU      DLFITSKVWNADLGYEETLAAFETSLSKLGLDYLDLYLIHWPVEGKYKEAWRALETLYKEGRIKAIGVSN
XYL1_CANTR      ELFITSKLWNNFHDPKNVETALNKTLSDLNLDYVDLFLIHFPEDVPLLDTWKALEKLVEAGKIKSIGISN
ALDR_ENCCU      -LFITSKLW--NTFHGCPEDGLRRSLNDLQMDYVDLYLIHWPGKFDAVGVWKKMEALVDLGLAKSIGISN
I3ACR_SCHPO     KLFITSKVMHNVDNIPEAL---NESLRKLGTDYLDLYLLHYEKKIPISEGWKAMETALGTGLVHSVGVSN
YPR1_YEAST      EIFITTKLW--GTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLRVTDTWELMQELPKTGKTKAVGVSN
DKGA_ECOLI      ELFITTKLWNDDHKRPRE--ALLDSLKKLQLDYIDLYLMHWPVPAHYVEAWKGMIELQKEGLIKSIGVCN
ALRC_DICDI      DIFYTSKLWNSCHNSNLVVKHCVKTIEDLGIGYLDLYLIHWPAPVSIRETWQEMEKLVELGLVKSIGVSN
GCY_YEAST       EIFVTTKLWCTQHHEPEV--ALDQSLKRLGLDYVDLYLMHWPARLRAVDTWELMQELPKTGKTKAVGVSN
AKC1H_RAT       DIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFLDTVDLCDTWEAMEKCKDAGLAKSIGVSN
XYL1_ASPNG      ELFIVSKLWNSFHDGDRVEPICRKQLADWGIDYFDLYIVHWKGNATIQETWTAMESLVDKKLARSIGISN
PE2R_RABIT      DIFYTSKLWCTFHRPELVRPSLEDSLKNLQLDYVDLYIIHFHGKVDICATWEAMEKCKDAGLAKSIGVSN
DKGA_ECO57      ELFITTKLWNDDHNRPRE--ALLDSLKKLQLDYIDLYLMHWPVPAHYVEAWKGMIELQKEGLIKSIGVCN
AK1CD_MOUSE     DLFITTKLWCTCFRPELVKPALEKSLKKLQLDYVDLYIMHYQGKVDFCDTWERLEECKDAGLVKSIGVSN
YBN4_SCHPO      DIWVTSK-LWCNAHRAGLVPALEKTLQDLNLEYIDAYLIHWKGEVPIEETWQAMEELLETGKVRYIGISN
AKCL2_HUMAN     DLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPSDTDFLDTWEAMEDLVITGLVKNIGVSN
AK1D1_MOUSE     EIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELYDKTNLCATWEALEACKDAGLVKSLGVSN
AK1CN_HORSE     DIFCTSKLWATSLRLQLVRPALEKSLKNLQLDYVDLYIIHFQGRVDLCATWEAMEKCKDAGLTKSIGVSN
Y1669_ARATH     EVSVATKALPWRFGRESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSN
DHB5_MOUSE      DIFYTSKVW-CTFHRPELVRVCEQSLKQLQLDYVDLYLIHFNGKVDICDTWEAMEKCKDAGLAKSIGVSN
XYL1_CANTE      EIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPEDVPILETWKALEKLVAAGKIKSIGVSN
AK1C4_HUMAN     DIFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFNGKVDLSATWEVMEKCKDAGLAKSIGVSN
AK1C3_PONAB     DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEECKDAGLAKSIGVSN
NADO2_ORYSJ     DVFVTSKLWCSDLHAGRVVPAARETLRNLGMDYVDLLLVHWPATVAMEGVWRGMEECHRLGLARAIGVSN
DKGA_CORSC      DLFITTKLWNDRHDGDEPXXXXXXXXXXXXXDQVDLYLVHW--PTPAADNVHAWEELRAAGLTRSIGVSN
KAR_YEAST       AIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPNGLSLEEAWKDMEQLYKSGKAKNIGVSN
AKC1H_MOUSE     DIFYTSKLWSTSHRPELVRPSLENSLRKLNLDYVDLYLIHFPDTVDLCDTWEAMEKCKDAGLAKSIGVSN
AK1C3_HUMAN     DIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHENGKVDLCTTWEAMEKCKDAGLAKSIGVSN
S6PD_MALDO      ELFITTKIW--NSDHGHVVEACKNSLEKLQIDYLDLYLVHYPGKISLQQTWEGMEKTVSLGLVRSIGLSN
DKGA_YERPE      ELFITTKLW--NDDQHNPQQALETSLQKLQLDYVDLYLIHWPDP-KQDHYVSAWRELVTQGLIRSIGVCN
Y4205_MYCGI     ELFVTTKLATEDAGFQSSQDALRASLERLGLDYVDLYLIHWSQQGKHVDSWGGLMKSKEVGLTRSIGVAN
AK1D1_RABIT     DIFYCGKLWATNHDPVMVRPTLERTLKVLKLDYIDLYIIEWYHKTNLCATWEALEACKDAGLVKSLGVSN
AK1D1_HUMAN     DIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEWLHKSNLCATWEAMEACKDAGLVKSLGVSN
ALDR_HORVU      DLFVTSKIWCTNLAPERVRPALENTLKDLQLDYIDLYHIHWAGEVLEFDMEGVWKELVKDGLVKDIGVCN
YER5_SCHPO      DIWFTSKLNDLSGYKS-TLSSIDASVKACGLGYIDLFLLHSPYGDRI-ESWKALEKGVEEGKLRAIGVSN
XYL1_CANPA      ELFITSKLWNSFHDKKNVEVALMKTLSDLNLDYVDLFYIHFPEEVPLLDTWRALEKLVDQGLAKSIGISN
TAS_SHIFL       KLIIASKVSPDQADRKNIREALHDSLKRLQTDYLDLYQVHWPQRVSLLDTLDALAEYQRAGKIRYIGVSN
TAS_ECOLI       KLIIASKVSPDQADRKNIREALHDSLKRLQTDYLDLYQVHWPQRVSLLDTLDALAEYQRAGKIRYIGVSN
IOLS_BACSU      DVVIATKAAHRKQGNDFVFKSVDESLKRLNTDYIDLFYIHFPDEHTPKDAVNALNEMKKAGKIRSIGVSN
YQKF_BACSU      DIILATKAGNRDPSKAYIKEAVKKSLTRLKTDYIDLYQLH-GGTINIDETIEAFEELKQEGVIRYYGISS
IN22_MAIZE      KVELATKFGVSFADGKREITACEGSFKRLGVDCIDLYYQHRIDKVPIEVTIGELKKLVEEGKIKYIGLSE
DIDH_RAT        DIFYTSK-LWSTFHRPELVRTCEKTLKSTQLDYVDLYIIHFHGKVDICDTWEAMEKCKDAGLAKSIGVSN
Y2407_MYCS2     EIYVTTKLATPDQGFTSSQAAARASLERLGLDYVDLYLIHWPGTSKYVDSWGGLMKVKEDGIARSIGVCN
6DCS_SOYBN      DLFVTSKLWVTENHPHLVLPALRKSLKTLQLEYLDLYLIHWPGKIEVEDLLESMEECQKLGLTKAIGVSN
XYL1_PACTA      DLFITSKLWNNFHAKENVKKALMKSLSDFNLDYFDLYLMHFPEDVPIIETWRAMENLVDEGLVKSIGVSN
YAKC_SCHPO      EIFLATKFGYEKNPETGELSALDLSLKRLGIDCIDLYYVHFSGETPIEKIMGALKKCVEAGKIRYIGLSE
AK1CO_HORSE     DIFYTSKLWLTFLRPELVRPALEKSLTNLQLDYVDLYIIHFHGKVDLCATWEAMEKCKDAGLAKSIGVSN
YDBC_ECOLI      DLTIVTKILPSPAELQKAVHXXXXXXXXXXXXXXXXXXMHGPAEGSIEASLTVLAEMQQQGLVKHIGLSN
AK1CL_RAT       DIFYTSKLWCTSLHPELVRSSLECSLKKLQLDYVDLYLIHFHGKVDLCATWEAMEKCKDAGLAKSIGVSN
Y1987_MYCUA     ELFVTTKVATADHGFTASREACKASLDRLGLDYVDLYLIHWPAPA-VGKYVDAFGGLIQAGFTRSIGVSN
Y1744_MYCMM     ELFVTTKVATADHGFTASREACKASLDRLGLDYVDLYLIHWPAPA-AGKYVDAFGGLIQAGFTRSIGVSN
XYL1_TRIRE      DLFIVSKLWQTFHDEDKVEPITRRQLADWQIDYFDLFLVHWSKTTTLQQTWGAMERLVDKGLARSIGVSN
AK1CL_MOUSE     DIFYTSKVWCTSLHPELVRASLERSLQKLQFDYVDLYLIHYHGKVDLCATWEAMEKCKDAGLTKSIGVSN
AK1A1_XENTR     EVFVTSKLWNNKHHPDDVECALRKTXXXXXXXXXXXXXMHWPGSVQYKDTWKAMEKLVKQGLTKAIGLSN
YKW2_SCHPO      DIFLTSK-LANCSDYYSTRAAIRSSLHHLGT-YIDLFLIQSPGKKSRIASWKAMEEFVDSGDIRSVGVSN
Y3816_MYCA1     ELFVTTKLATSDQGFKGAMDACEASLERLGLDYVDLYLIHWPAPA-LGTYVNSFGGMIQSGHARSIGVSN
Y3007_MYCPA     ELFVTTKLATSDQGFKGAMDACEASLERLGLDYVDLYLIHWPAPA-LGTYVNSFGGMIQSGHARSIGVSN
GRE3_YEAST      -IFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFEAHVPIIDTYRALEECVDEGLIKSIGVSN
A1A1B_DANRE     DVFVTSKLWNTKHHPDDVEPSXXXXXXXXXXXXXXXXXIHWPYAFQRGDTPAAMEKLVGKGLVRAIGLSN
XYL1_KLULA      DLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHYTGKVPLLDTWRALEKLVDQGKIKSLGISN
DKGB_CORSS      ELIVASKIPGRQHGRAEAVDSIRGSLDRLGLDVIDLQLIHWPNPSRWLDTWRGMIDAREAGLVRSIGVSN
AK1C4_MACFA     DIFYTSKLWCTFFRPQLVQPALESSLKKLQLDYVDLYLIHFNGKV-MFDTVEAMEKCKDAGLAKSIGVSN
Y1984_MYCSK     EIYVTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWPAHGKYIDSWGGLMKAKQDGVARSIGVCN
Y1938_MYCSS     EIYVTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWPAHGKYIDSWGGLMKAKQDGVARSIGVCN
MORA_PSEPU      EMFVTTKLFNCDYGYERALRAFDESLGRLGLDYVDLYLLHWPTKDWNAQSWKAAEKILGDGRARAIGVCN
KCAB_SCHPO      EYVITTKVLPNTTSRKHIIEGLNASLKRLGLPYVDVIMAHRPDSVPMEEVVRAFTQLIQDGKAFYWGTSE
AK1A1_XENLA     EVFVTSKLWNNKHHPDDVECALRKTXXXXXXXXXXXXXMHWPGSVQYKDTWKAMEKLVEKGLAKAIGLSN
YDHF_ECOLI      RMEIVSKCGIATTAREEIIKSAEQSLINLATDHLDLLLIHRPDPLMDADEVAAFKHLHQSGKVRHFGVSN
Y2161_MYCVP     ELFVTTKLATDDLGFQSSQDALRASLERLGLDYVDLYLIHWGSQGTYVDSWGGLMKLKELGLTRSIGVSN
DKGA_SALTY      ELFITTKLWNDDQKRPR--EALQESXXXXXXXXXXXXXMHWPVPA-IDHYVDAWKGMIAEGLVKSIGVCN
DKGA_SALTI      ELFITTKLWNDDQKRPR--EALQESXXXXXXXXXXXXXMHWPVPA-IDHYVDAWKGMIAEGLVKSIGVCN
ALRB_DICDI      DIFYVSKLWNSCHHASLVRKHCEKTXXXXXXXXXXXXXIHWLAAVSIRETWQEMEKLVEYGLVKSIGVSN
YCSN_BACSU      NIELVTKVLESNTSKSHILASVEQSLMNLRTDYIDMLLIHRPDPLMDPEGVAAFQALKCSGKVRYFGVSN
AK1C4_MACFU     DIFYTSKLWCTFFRPQLVQPALESSLKKLQLDYVDLYLIHFNGKV-MFDTVEAMEKCKDAGLAKSIGVSN
CRO_RANCA       DIFYTGKLWCTYFSPDMVRKGLERSLRDVGMDYLDLFLMHWYDNVDLCATWEALEARKDAGLVRSLGVSN
CRO_RANTE       DIFYTGKLWCTYFSPEMVRKGLERSLRDVGMDYLDLFLMHWYDNVDLCATWEALEARKDAGLVRSLGVSN
YRPG_BACSU      KVVLATKVYEPNDMRGLSLYKIRRSLKRLQTDHIELYQMHHIDRRTPWDEIEAFETQVRSGKVDYIGSSN
Y1918_MYCSJ     EIYVTTKLAVADQGFGTSQDAARASLERLGLDYVDLYLIHWPAHGKYIDSWGGLMKAKQDGVARSIGVCN
DTDH_MUCMU      DLFIVTKLWNTFHSKKHVRALFDRQLKDTGLEYFDLYLIHFPVPLQYVDPAAELEKIVDAGLARNIGVAN
AK1A1_CHICK     DLFVTSKLWNTKHHPEDVEPALRKTXXXXXXXXXXXXXMHWPGTMRYKDTWKAMEKLVEKGLAKAIGLSN
AK1D1_RAT       EIFYCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMNGRVNLCATWEALEACKDAGLVKSLGVSN
Y2999_MYCTA     ELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPPKYVDAWGGMIQSRGEGHARSIGVSN
Y2971_MYCTU     ELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPPKYVDAWGGMIQSRGEGHARSIGVSN
STCV_EMENI      ELVLATKYTMSQGSHSKSLRSVEASLAKLRTDYIDLLYVHWDFSTSVEEVMQSLHHLVAAGKVLNIGISD
Y2996_MYCBO     ELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPPKYVDAWGGMIQSRGEGHARSIGVSN
Y2993_MYCBP     ELFVTTKLATPDQGFTRSQEACRASLDRLGLDYVDLYLIHWPAPPKYVDAWGGMIQSRGEGHARSIGVSN
YH5B_SCHPO      LIIATKGGLPNEWHPCGAPKFLRQSMRRLGVKQIDLWQLHIDPKVPRKDQFSEIAAMKKEGLIRHVGLSE
YDG7_SCHPO      -IWVTSKLWCNAHAPEAVPKAXXXXXXXXXXXXXXXXXIHWPVSFKIEETWKAMEKLLETGKVRHIGLSN
Y4483_MYCA1     ELFVTTKLGTSRQGFHSAQESCKESXXXXXXXXXXXXXIHWPAP-KLGKYVESFEGMIEAGHVRSIGVSN
Y4149_MYCPA     ELFVTTKLGTSRQGFHSAQESCKESXXXXXXXXXXXXXIHWPAPT-LGKYVESFEGMIEAGHVRSIGVSN
Y1669_MYCLE     QLFVTTKLATPDQGFTKSQDACNASLDRLGMDYVDLYLIHWPAPPQYVDAWGGMIQSRGEGHARSIGVCN
Y1669_MYCLB     QLFVTTKLATPDQGFTKSQDACNASLDRLGMDYVDLYLIHWPAPPQYVDAWGGMIQSRGEGHARSIGVCN
NORA_ASPFL      EIVLSTKYIKSNYQGNHAKSSVKASLQKLQTDYIDLLYVHWDFTTSVEEVMRSLNHLVANGKVLYLGVSD
KCAB_ORYSJ      DVVVSTKLFDKGLSRKHIVEGLRGSLKRLDMDYVDVVYCHRPDATTVEETVRAMNWVIDHGMAFYWGTSE
KCAB2_XENLA     SLVITTKIFERGLSRKHIIEGLKASLERLQLDYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
KCAB2_HUMAN     SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
AK1CD_MESAU     DMFITTKLWCTCFQPELVRPSLEXXXXXLQLEHVDLFIMHYQGKL-LLDTVEALEKXXDAGLVKSIGVSN
NORA_ASPPA      EIVLSTKYIKSNFQGNHAKSSVKASLQKLQTDYIDLLYVHWDFTTSVEEVMRSLNHLVANGKVLYLGVSD
KCAB2_RAT       SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
KCAB2_MOUSE     SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
KCAB2_BOVIN     SLVITTKIFERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDNTPMEETVRAMTHVINQGMAMYWGTSR
YGHZ_ECO57      ELIISTKAYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDETPMEETASALAHAVQSGKALYVGISS
YJ66_YEAST      EIFYTTKLWNSQNGYKRAKAAIRQCLNEVSLQYIDLLLIHSPSKLRL-ETWRAMQEAVDEGLVKSIGVSN
YOF5_CAEEL      EMFLSTKLWPVDCGDE-VYNAFQTSCEKLQTDYLDMYMIHWNQKETKEKTWRQMELLYEDEHVRSIGVSN
YGHZ_ECOLI      ELIISTKAYGSGGSRKYLLASLDQSLKRMGLEYVDIFYSHRVDETPMEETASALAHAVQSGKALYVGISS
AKCL1_HUMAN     EIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIH------------------------------
A115_TOBAC      RVVLATKVLGDEKKAEGVRAACEASLKRLDIDCIDLYYQHRVDRVPIEITXXXXXXXXXXXXXXYIGLSE
YP088_YEAST     TVVIMTKIYQRGLSRKHIIAGVENSVKRLGT-YIDLLQIHRLDETPMKEIMKALNDVVEAGHVRYIGASS
ARK72_RAT       XVKIATKANPKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHTPIVETLQACQQLHQEGKFVELGLSN
AAD_PHACH       QMVVATKYIPQNSLKSMHISVHD-SLRKLRTSYIDIFYVHWDYTCTIEEVMNGLHNLVAQGKVLYLGVSD
YHH5_SCHPO      DITLITKIPDSLQGFERTWKAVEQSLRRTGRPKLDVVLIHSKWPVRRIESWRALLQHQKEGRINKIGVSN
ARK72_HUMAN     RVKIATKANPKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHTPVEETLHACQRLHQEGKFVELGLSN
ARK72_MOUSE     XVKIATKANPKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDSTPVEETLRACHQLHQEGKFVELGLSN
ARK74_HUMAN     RVKIATKANPGNSLKPDSVSQLETSLKRLQCPUVDLFYLHAPDSAPVEETLRACHQLHQEGKFVELGLSN
ARK73_RAT       KVKIATKAAPKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHTPIEETLQACHQLHQEGKFVELGLSN
ARK73_HUMAN     RVKIDTKAIPGNSLKPDSLRQLETSLKRLQCPRVDLFYLHMPDSTPVEETLRACHQLHQEGKFVELGLSN
ALKE_BABBO      -------------SKDNILKAVDGSLSRLNTDYIDLLQLHWPDRYVPMNANGDFHEVFXXGKIRHWGLSN
YEZB_SCHPO      KVFLTHRVHGTRECITKSIKTVRETLKKVKTDLYQCAAID--PDTPIEETMACLKEFVDSGDIRCIGLCE
PLR2_SCHPO      KVFLSVKTLAPHGDPESVTKSVKNALTRLKLDLFQCARVDH--KVPIETTMKALKAFVDSGEISCVGLSE
ARA2_YEAST      EYFICTKVEEFNYSRDFVRFSVHRSCERLHTTYLDLVYLHDVEFVKFPDILEALKELRTKGVIKNFGISG
YI7E_SCHPO      -------------SRKHIFDAVEDSVKRLGT-YIDVLQIHYDPHVSAEEVMRALNDVVESGKVRYIGAST
AAD3_YEAST      QIVIATKFIKSDAGESNTANYCGNSLRKLQTDWIDILYVHWWDYMSIEEFMDSLHILVQQGKVLYLGVSD
AAD4_YEAST      ------------------------SLRKLQTDWIDILYVHWWDYMSIEEVMDSLHILVQQGKVLYLGVSD
AAD14_YEAST     QIVIATKFTGDNHKRSLHVSVRD-SLRKLQTDWIDILYIHWWDYMSIEEVMDSLHILVQQGKVLYLGVSD
AAD10_YEAST     ------------------------SLRKLQTDWIDILYVHWWDYMSIEEVMDSLHILVQQGKVLYLGVSD


                         +         .         .         .         .         *         .:210
query           FDAGDLWELLKVAGPGRIACNQVLYHLRERAIEHAVVPWCEAHGVAVTAYSPFGHDEFPEPRSAEGRLLQ
YEAE_ECOLI      LDYADMQELWQLPGGNQCATNQVLYHLGSRGIEYDLLPWCQQQQMPVMAYSPLAQAGRLRNGLLKNAVVN
AK1BA_HUMAN     FSHFQIEKLLNKPGKYKPVTNQVECH--PYLTQEKLIQYCHSKGITVTAYSPLGSPDRPDPSLLEDPKIK
GR_BACSU        FQVHHLEELLKDA-EIKPMVNQVEFH--PRLTQKELRDYCKGQGIQLEAWSPLMQGQL-----LDNEVLT
Y2408_MYCS2     FEPEHLTTLIEETGP---AVNQIELHQQELRDVHAKL------GIATEAWSPLGQGSL-----LADPVIT
AKCL2_PIG       FNHEQLERLLKPNLRVKPVTNQIECH--PYLTQKKLISFCQSRNVSVTAYRPLGGSSEGVP-LLEDPVIQ
GS69_BACSU      FSIEQMDTFRAVAPLHTI---QPPYNLFEREMEESVLPYAKDNKITTLLY--------------------
AK1A1_PIG       FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDRAEPVLLEEPVVQ
DKGB_SALTY      FTIPLMEKAIAAVGADNIATNQI--ELSPYLQNRKVVDWAKAHGIHITSYMTLAYG-----KALKDEVIA
AKCL2_RAT       FNHEQLDRLLNKPGTNQIECHPYLN-------QKSLIDFCHGRNVSVTAYRPLGGSR-DGVHLMDDIVIR
AK1A1_BOVIN     FNSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARNLEVTAYSPLGSSDREEPVLLKEPVVL
DKGB_SALTI      FTIPLMEKAIAAVGADHIATNQI--ELSPYLQNRKVVDWAKAHGIHITSYMTLAYG-----KALKDEVIA
AKCL2_MOUSE     FNHEQLERLLDKPGRVRPITNQIECH--PYLNQKKLIDFCHKRNVSVTAYRPLG-GSGGGFHLMDDTVIR
P100_LEIMA      FHIHHLEDVLAMCTVTPMVNQVELHPLNNQADLRA---FCDAKQIKVEAWSPLG-----QGKLLSNPILS
DKGB_ECOLI      FTIPLMEKAIAAVGAENIATNQI--ELSPYLQNRKVVAWAKQHGIHITSYMTLAYG-----KALKDEVIA
DKGB_ECO57      FTIPLMEKAIAAVGAENIATNQI--ELSPYLQNRKVVAWAKQHGIHITSYMTLAYG-----KALKDEVIA
Y1919_MYCSJ     FEPEHLRVLIDSTGP---AVNQIELHQRELRELHAQL------GIATEAWSPLGQGSLLAHPTVTG----
DKGB_YERPE      FTIDLMKQAIAAVGAEEIATNQI--ELSPLLQNRNVVDFAKQNGIAVTSYMTLAYGKLAEP------VIK
AK1A1_PONAB     FNSRQIDDILSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLAVTAYSPLGSSDXXXXXXXXXXXXX
Y1985_MYCSK     FEPEHLRVLIDSTGP---AVNQIELHQRELRELHAQL------GIATEAWSPLGQGSLLAHPTVTG----
ALDR_RABIT      FNHLQIERILNKPGKYKPAVNQIECH--PYLTQEKLIQYCHSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
ALDR_HUMAN      FNHLQVEMILNKPGKYKPAVNQIECH--PYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
XYL1_PICGU      FPGALIQDLLRGAKPAVLQIEHHPYLQQPRLIEYV-----QSQGIAITAYSSFGPQSFVEPRVKEHDVIK
YCCK_BACSU      LDYQQLQDF---NADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLAFDDFRKDKQFQGETLK
XYL1_PICST      FPGALLLDLLRGAKPSVLQVEHHPYLQQPRLIEFA-----QSRGIAVTAYSSFGPQSFVELNQGENETIK
ALD1_MOUSE      FNHFQIERLLNKPGKHKPVTNQIESH--PYLTQEKLIQYCQSKGIAVTAYSPLGSPDRPDPVVMEIPKIK
AK1A1_RAT       FSSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSDHPDXXXXXXXXXX
AK1A1_MOUSE     FNSRQIDDVLSVASV-RPAVLQVECH--PYLAQNELIAHCHARGLEVTAYSPLGSSDHPDXXXXXXXXXX
XYL1_CANSH      FPGALLLDLFRGAKPAVLQVEHHPYLQQPKLIEYA-----QKVGITVTAYSSFGPQSFVEPTLFEHDVIK
AK1C1_MACFU     FNRRQLEMILNKPGKYKPVCNQVECHLNQRKL----LDFCKSKDIVLVAYSALGHREKPSPVLLEDPVLC
AK1A1_HUMAN     FNSRQIDDILSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSD-------------
ALDR_RAT        FNPLQIERILNKPGKYKPAVNQIECH--PYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPDPSLLEDPRIK
ALDR_PIG        FNHLQVEKILNKPGKYKPAVNQIEVH--PYLTQEKLIEYCKSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
AK1C2_HUMAN     FNHRLLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
AK1C1_HUMAN     FNRRQLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGHREEPSPVLLEDPVLC
ALDX_SPOSA      FDAKMVDAIIEATGV-TPSVNQIERH--PLLLQPELIAHHKAKNIHITAYSPLGNNTVGAPLLVQHPEIK
PGFS2_BOVIN     FNHKQLEKILNKPGKYKPVCNQVECH--PYLNQSKLLEFCKSHDIVLVAYAALGAQLLSEPVLLEDPVLC
PGFS1_BOVIN     FNHKQLEKILNKPGKYKPVCNQVECH--PYLNQSKLLEFCKSHDIVLVAYAALGAQLLSEPVLLEDPVLC
AKCL2_MACFA     FNHEQLERLLNKPGRFKPVTNQIECH--PYLTQKNLISFCQSRGVSVTAYRPLG-------GSCEGPVIQ
AK1C1_MACFA     FNRRQLEMILNKPGKYKPVCNQVECHLNQRKL----LDFCKSKDIVLVAFSALGHREKPSPVLLEDPVLC
AK1A1_CRIGR     FNSRQIDDILSVASV-RPAVLQVECH--PYLAQNELIAHCQARGLEVTAYSPLGSSD-------------
DDBX_BOVIN      FNHKQLEKILNKPGKYKPVCNQVECH--PYFNQSKLLDFCKSHDIVLVAYGALGSQRLKEPFLLEDPVLS
ALDR_MOUSE      FNPLQIERILNKPGKYKPAVNQIECH--PYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPDPSLLEDPRIK
ALDR_BOVIN      FNHLQVEKILNKPGKYKPAVNQIECH--PYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPDPSILEDPRIK
ALD2_CRIGR      FNHFQIERILNKPGKHKPVTNQVECH--PYLTQEKLIEYCHSKGITVTAYSPLGSPNRPDPSLLEDPKIK
YAJO_ECOLI      MHASQFLELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPLGKNLYKESDENDAQIAE
Y2320_MYCBO     YSLAR-WRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPLAQGLLGGKYGLENRTLR
Y2298_MYCTU     YSLAR-WRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPLAQGLLGGKYGLENRTLR
XYL2_CANTR      FTGALIYDLIRGAKPAVLQIEHHPYLQQPKLIEYV-----QKAGIAITGYSSFGPQSFLEPTLFEHETIK
AK1C1_PONAB     FNRRQLEMILNKPGKYKPVCNQVECH--PYFNQRKLLDFCKSKDIVLVAYSALGEEKWVDPNSLEDPVLC
ALRA_DICDI      FNVQGLMEVLSYARI-KPAANQV--ELHPFLSQPELKKFCDKHNIHLTAYSPLGNGAF------------
ALD2_MOUSE      FNHFQIERLLNKPGKHKPVTNQVECH--PYLTQEKLIQYCHSKGISVTAYSPLGSPDRPDPSLLEDPKIK
A1A1A_DANRE     FNAKQIDDILSIA-KHKPVVNQVECH--PYLVQAELVSHCWSRNLTVTAYSPLGSPDRPWVTPGEALLLD
YDJG_ECOLI      VDADHIREYLQY---GELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSP------------------
NADO1_ORYSJ     FSAKKLEQLLSLAAV-RPAVNQVEVNWQQRTLREV----CRREGVQLCGYSPLGAKGTPWGSAADSGVLQ
YTBE_BACSU      FQIHHLEDLM-TAAEIKPMINQVEFH--PRLTQKELIRYCQNQGIQMEAWSPLMQGQL-----LDHPVLA
XYL1_CANTR      FTGALIYDLIRGAKPAVLQIEHHPYLQQPKLIEYV-----QKAGIAITGYSSFGPQSFLEPTLFEHETIK
ALDR_ENCCU      FGKAN---TEKILGTCRICPAAIQIELHPYLNQKELVEFMKSKGIQVIXXXXXXXXXXXXXKVRDDKTIK
I3ACR_SCHPO     FRIPDLEELLKTSTTPRV--NQIEFHPQVYKAAKPLVEFCQSKGIIVEGYGPLS----PLVRDAQG----
YPR1_YEAST      FSINNIKELLESPNNKVVATNQIEIH--PLLPQDELIAFCKEKGIVVEAYSPFGSANAP---LLKEQAII
DKGA_ECOLI      FQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGKGVFDQ------KVIR
ALRC_DICDI      FNVQNLVDLLTYAKIKPVV-NQVEIH--PYLTQFKLQEYCDKYEIKLVAYSPLGQGKCD---FFSNKILK
GCY_YEAST       FSINNLKDLLASQGNKLTAANQVEIH--PLLPQDELINFCKSKGIVVEAYSPLGSTDAPEP------VIL
AKC1H_RAT       FNRRQLEKILNKPGKHRPVCNQVECHLYLN--QSKLLAYCKMNDIVLVAYGALGTQRYDTPVLLDDPILC
XYL1_ASPNG      FSAQLVMDLLRYARPATLQIEHHPYLTQTRLVEYA-----QKEGLTVTAYSSFGPLSFLEPPLFEHQLVK
PE2R_RABIT      FNRRQLEMILNKPGKYKPVCNQVECH--PYLNQGKLLEFCKSKGIVLVAYSALGSHREPEPVLLEDPLIG
DKGA_ECO57      FQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGKGVFDQ------KVIR
AK1CD_MOUSE     FNHRQLERILNKPGKYKPVCNQVECHLYLN--QRKLLDYCESKDIVLVAYGALGTQRYKEPVLLNDPVLC
YBN4_SCHPO      FNNEYLDRVLKIA--------KVKPTIHQMEL-HPYLPYLEKHQIHVSAYSPLANDAYNSDISIEHKTLV
AKCL2_HUMAN     FNHEQLERLLNKPGRFKPLTNQIECH--PYLTQKNLISFCQSRDVSVTAYRPLG-------GSCEGPVIK
AK1D1_MOUSE     FNRRQLELILNKPGKYKPVTNQVECH--PYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSPPLLNDELLT
AK1CN_HORSE     FNRRQLEMILNKPGKHKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAYSALGSQDQSSPVLLEDPVLC
Y1669_ARATH     YSLRDAYERLKKRGI-PLASNQVNYSLIYRAPEQGVKAACDELGVTLIAYSPIAQGALPEPSGPRGRIIK
DHB5_MOUSE      FNRRQLEKILKKPGKYKPVCNQVECH--PYLNQGKLLDFCRSKDIVLVAYSALGSHDQSSPVLLDNPVLG
XYL1_CANTE      FPGALLLDLLRGAKPAVLQVEHHPYLQQPKLIEFA-----QKAGVTITAYSSFGPQSFVEMN--QGRALK
AK1C4_HUMAN     FNCRQLEMILNKPGKYKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAHSALGHKLWVDPNSLEDPVLC
AK1C3_PONAB     FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
NADO2_ORYSJ     FSAKKLEQLLSFA-VVRPAANQV--EMNPMWQQRTLREVCRREGVQLCGYSPLGAKGTPWGSAADSGVLH
DKGA_CORSC      HLVPHLERI--VAATGVVAVNQIELHPAYQ--QREITDWAAAHDVKIESWGPLGQGKYAEP-------VT
KAR_YEAST       FAVEDLQRILKVA-EVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLG----------------
AKC1H_MOUSE     FNRRQLEMILNKPGKYKPVCNQVECHLYLN--QSKLLAYCKMNDIVLVAYGALGTQRYDTPVLLDDPVLC
AK1C3_HUMAN     FNRRQLEMILNKPGKYKPVCNQVECH--PYFNRSKLLDFCKSKDIVLVAYSALGSQRWVDPNSLEDPVLC
S6PD_MALDO      Y---ELFLTRDCLAYSKIKPAVSQFETHPYFQRDSLVKFCMKHGVLPTAHTPLGKDMFGSVSPLDDPVLN
DKGA_YERPE      FHIPHLQRLIDETGIAPTVNQIELHPLLQQRQLHA---WNATHHIATESWSPLGKGVFDQ------EIIR
Y4205_MYCGI     FHGHHLDDIISLSF-FTPAVNQILHPLLNQAELRAV---NAEHGIATEAYGPLGVGNL-----LSHSAVN
AK1D1_RABIT     FNRQQLELLLNKPGKHKPVCNQVECH--PYFTQPKLLKFCQQHDIIIVAYSPLGTCRNPMPPLLKDTLLN
AK1D1_HUMAN     FNRRQLELILNKPGKHKPVSNQVECH--PYFTQPKLLKFCQQHDIVITAYSPLGTSRNPSPPLLKDALLN
ALDR_HORVU      YTVTKLNRLLRSAKIPPAVCQMEMHPGWK---NDKIFEACKKHGIHVTAYSPLGSS---EKNLAHDPVVE
YER5_SCHPO      FGPHHIQELLD-SHPKIIPCNQIELH--PFCSQQKVVDYCESKGIQLAAYAPLVHGE-----KFGNKQLL
XYL1_CANPA      FSAQLIYDLIRGCTIKPVAL-QIEHH--PYLTQPKLVEYVQLHDIQITGYSSFGPQSFLEPVLLEEPTVK
TAS_SHIFL       ETAFGVMRYLHLADKPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLAKPAGARNTLFS
TAS_ECOLI       ETAFGVMRYLHLADKPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLAKPAGARNTLFS
IOLS_BACSU      FSLEQLKEANK---DGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLEQEHFKGERFKENNKLA
YQKF_BACSU      IRPNVIKEYVK-----------------------------------------------------------
IN22_MAIZE      ASASTIRRAHAVHP---ITAVQLEWSLWSRDAEEDIIPTCRELGIGIVAYSPLGRGFF------------
DIDH_RAT        FNCRQLERILNKPGKYKPVCNQVECHLYLN--QSKMLDYCKSKDIILVSYCTLGSSDQKSPVLLDDPVLC
Y2407_MYCS2     FGAEDLETIVSLT-YFTPAVNQIELHLNQAALREVNA----GYNIVTEAYGPLG----------VGRLLD
6DCS_SOYBN      FSVKKLQNLLSVA-TIRPVVDQVEMNLAWQ--QKKLREFCKENGIIVTAFSPLRKGASRGPNEVENDVLK
XYL1_PACTA      VSGGLLEDLIKAAKPASLQIEHHPYLQQNKLVEYA-----QLKGIVVTGYSNFGPLSFLELGNEENKTIT
YAKC_SCHPO      CSANTIRRAAAVYPVSAVQVEYSPFSLEIERPEIGVMKACRENNITIVCYAPLGRDDFPEPRYQKENFIE
AK1CO_HORSE     FNRRQLEMILNKPGKYKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAYGALGTQRLKSPVLLEDPVLC
YDBC_ECOLI      VTPTQVAEARKIA---EIVCVQNEYNIAHRA-DDAMIDALAHDGIAYVPFFPLGG--FTPLQSST---LS
AK1CL_RAT       FNRRQLEKILNKPGKYKPVCNQVECHLYLNQMK--LLDFCKTNGIILVAYGVLGTQRYNSPVLLNEPVLS
Y1987_MYCUA     FTEEHVSNVIDLTFV-TPAVNQVELHLNQDELRKANA----QHNVVTQSYTPLALGQL-----ADNPTVT
Y1744_MYCMM     FTEEHVSNVIDLTFV-TPAVNQVELHLNQDELRKANA----QHNVVTQSYTPLALGQL-----ADNPTVT
XYL1_TRIRE      YQAQSVYDAL-IYARIKPATLQIEHH--PYLQQPDLVSLAQTEGIVVTAYSSFGPTGFMEPRAMDSPVIK
AK1CL_MOUSE     FNYRQLEMILNKPGKYKPVCNQVECHPYLNQMK--LLDFCKSKDIVLVAYGVLGTQRYNSPVLLDEPVLG
AK1A1_XENTR     FNKRQIDDIISIATV-KPAVLQVECH--PYLAQNELIAYCHAHGLVFTGYSPLGSPDRSWRKPEDPVLLE
YKW2_SCHPO      YGVKHLQELY-ASNPKFYPCNQIELH--PFLSQDDIVKYCQSHDIAIEAYSPLTH---------------
Y3816_MYCA1     FTEEYLTTVIDLTFV-TPAVNQIELHLNQEALRKTNA----EHNVVTQSYTPLALGKLNDHPT-----VN
Y3007_MYCPA     FTEEYLTTVIDLTFV-TPAVNQIELHLNQEALRKTNA----EHNVVTQSYTPLALGKLNDHPT-----VN
GRE3_YEAST      FQGSLIQDLLRGCRIKPVAL-QIEHH--PYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEPTLFENDVIK
A1A1B_DANRE     FNSRQIDDILSVASPTVLQVESHPYLAQVELLSH-----CRDRGLVMTAYSPLGSPDRDEPVLLEEPAIA
XYL1_KLULA      FSGALIQDLLRGARIKPVAL-QIEHH--PYLTQERLIKYVKNAGIQVVAYSSFGPVSFLEPTLFEHDTIK
DKGB_CORSS      FTEPMLKTLIDETGV-TPAVNQV--ELHPYFPQAALRAFHDEHGIRTESWSPLAR----RSXXXXXXXXX
AK1C4_MACFA     FNRRQLEMILNNPGKYKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAHSALGTQRHKSPALLEDPVLC
Y1984_MYCSK     FNAEHLSNIIDLSF-FTPAINQIELHPLLNQAELREVN--AGYGIVTEAYGPLGVGRLLDHAAVTG----
Y1938_MYCSS     FNAEHLSNIIDLSF-FTPAINQIELHPLLNQAELREVN--AGYGIVTEAYGPLGVGRLLDHAAVTG----
MORA_PSEPU      FLEDQLDELI-AASDVVPAVNQI--ELHPYFAQKPLLAKNRALGIVTEAWSPXXXXXXXRKHPLTDPVIT
KCAB_SCHPO      WSAFEIEHAHHIATKYNLVADQPQYYLTRDHFEKDLLPLQQIYGYGATVWSPLKNDGIPEGQTPEGRQIS
AK1A1_XENLA     FNKRQMDDILSIA-TVKPAVLQVECH--PYLAQNELIACCRSHGLVLTGYSPLGSPDRSWRKPEDPVLLE
YDHF_ECOLI      FTPAQ-FALLQSRLPFTLATNQV-----------------------------------------------
Y2161_MYCVP     FHAQHLDDIIGLSF-FTPAVNQILHPLLNQAELRAV---NAEHGIVTEAYSPLGVGSL-----LSNPAVT
DKGA_SALTY      FQIHHLQRLIDETGVTPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGEGVFDQ------KVIR
DKGA_SALTI      FQIHHLQRLIDETGVPPVINQIELHPLMQQRQLHA---WNATHKIQTESWSPLGEGVFDQ------KVIR
ALRB_DICDI      FNVQNLVDLLTYA-KIKPAINQVEVHLSQPNLKY----FCDRYGIVLTAYSPLGQGKCD---LLSNETLK
YCSN_BACSU      F-KDHQYRMLESYLPEKLVTNQIELSAYEENMLDGTLNLCQEKRIPPMAWSPLGGKVFTENTDKDRRVRT
AK1C4_MACFU     FNRRQLEMILNNPGKYKPVCNQVECH--PYLNQSKLLDFCKSKDIVLVAHSALGTQRHKSPALLEDPVLC
CRO_RANCA       FNRRQLERILNKPGKYKPVCNQVECHVYLN--QNKLHSYCKSKDIVLVTYSVLG----------------
CRO_RANTE       FNRRQLERILNKPGKYKPVCNQVECHVYLN--QNKLHSYCKSKDIVLVTYSVLG----------------
YRPG_BACSU      F-AG--WHLVKAQAEAELVTEQHKYSLLERTAEMEVLPAARDLGLGVVAWSP------------------
Y1918_MYCSJ     FNAEHLSNIIDLSF-FTPAINQIELHPLLNQAELREVN--AGYGIVTEAYGPLGVGRLLDHAAVTG----
DTDH_MUCMU      FNCQAILDLLTYA---RIKPAVLQIELHPYLPQERLVKWVKEQGIQITAYSSFGPTSYVDLTESEHASVK
AK1A1_CHICK     FNSRQIDDVLSVA-TVKPAVLQVECH--PYLAQNELIAHCQKRGLVVTAYSPLGSPDRDEPVLLEEPGIK
AK1D1_RAT       FNRRQLEVILNKPGTNQVECHP--YFTQTKLLEVS----ASSMTSFIVAYSPLGTCRNPSPPLLKDELLT
Y2999_MYCTA     FTAENIENLIDLTFV-TPAVNQIELHLNQDELRKANA----QHTVVTQSYCPL----------ALGRLLD
Y2971_MYCTU     FTAENIENLIDLTFV-TPAVNQIELHLNQDELRKANA----QHTVVTQSYCPL----------ALGRLLD
STCV_EMENI      APAAKCNEYARFHGLTRFCVYQGRWACSYRDFEREILPMCQSEGLALAPWGALGRGQY---KSAE-----
Y2996_MYCBO     FTAEHIENLIDLTFV-TPAVNQIELHLNQDELRKANA----QHTVVTQSYCPL----------ALGRLLD
Y2993_MYCBP     FTAEHIENLIDLTFV-TPAVNQIELHLNQDELRKANA----QHTVVTQSYCPL----------ALGRLLD
YH5B_SCHPO      VTVDDIKEAEQYF---PVVSVQNLFNLVNRKNE-KVLEYCEQKGIAFIPWYPLASGALAKP----GTILD
YDG7_SCHPO      FNDTNLERILKVA-KVKPAVHQMELHPFLPQTE-----FVEKHGIHVTAYSPFGNQESKIPKLIEHETIQ
Y4483_MYCA1     F-TEDLLATVIEETDEVPAVNQVELHPRLNQAELRQVH--AQHDVTTQSYSPLG-----VGRLIEEPTVT
Y4149_MYCPA     FTEDLLATVIEETNEVP-AVNQVELHPRLNQAELRQVH--AQHDVTTQSYSPLG-----VGRLIEEPTVT
Y1669_MYCLE     FTEEHLSAIIDLTFV-TPAVNQIELHLNQDEMRKSNA----QHNVITQSYTP-----LVLGRLMDNSTLT
Y1669_MYCLB     FTEEHLSAIIDLTFV-TPAVNQIELHLNQDEMRKSNA----QHNVITQSYTP-----LVLGRLMDNSTLT
NORA_ASPFL      TPA---WLVVKCNAFARFSVYQGHWSCAFRDFERDILPMCESEGMGLAPWGVLGRGQFAEEFSREGRKLD
KCAB_ORYSJ      WSAQQITEAWSVAGP---IVEQPEYNLFSRKVESEFLPLYSTYGLGLTTWSP------------------
KCAB2_XENLA     WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSP------------------
KCAB2_HUMAN     WSSMEIMEAYSVARQFNLTCEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
AK1CD_MESAU     FNMRQLERILNKPGKYKPVCNQVECHVYNN--QSKLLDYCKSKDIVLVAFGALGTQRYKEPVLLNDPVLC
NORA_ASPPA      TPA---WLVVKCNAFARFSVYQGHWSSAFRDFERDILPMCESEGMGLAPWGVLGRGQFAEEFSREGRKLD
KCAB2_RAT       WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
KCAB2_MOUSE     WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
KCAB2_BOVIN     WSSMEIMEAYSVARQFNLICEQAEYHMFQRKVEVQLPELFHKIGVGAMTWSPLAYDSGIPPLSEEGRRLQ
YGHZ_ECO57      YSPERTQKMVELLHEWKILIHQPSYNLLNRWVDKSLLDTLQNNGVGCIAFTPLAQNGIPEDMHREGRLLN
YJ66_YEAST      YGKKHIDELLNWPEKHKPVVNQI--EISPWIMRQELADYCKSKGLVVEAFAPLCH---------------
YOF5_CAEEL      YSIEDLDELLEFASILPHA-NQVELHPWFHQAD--LKNYCDELGILTMGYCPLAKGKY-----LEDETLC
YGHZ_ECOLI      YSPERTQKMVELLREWKILIHQPSYNLLNRWVDKSLLDTLQNNGVGCIAFTP------------------
AKCL1_HUMAN     ----------------------------------------------------------------------
A115_TOBAC      ASASTIRRAHAVHP---ITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLG----------------
YP088_YEAST     MLATEFAELQFTAGWFQFISSQSYYNLLYREDERELIPFAKRHNIGLLPWSP------------------
ARK72_RAT       YEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELLPCLRYFGLRFYAYNP------------------
AAD_PHACH       TPA---WVVSKANNYARMAGKTVIYNITMRDMERDIIPMCIHEGMAIAPWN-------------------
YHH5_SCHPO      YNIHHLEEIISLGLP-LPAINQVEFSAFNN--RPTFLSYCFNHGILVQAFSP------------------
ARK72_HUMAN     YEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNP------------------
ARK72_MOUSE     YEVAEICTLCKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNP------------------
ARK74_HUMAN     YAAWEVAELCKSNGWILPTVYQGMYSATTRQVETELFPCLRHFGLRFYAYNP------------------
ARK73_RAT       YEVAEICTLCKKNGWIMPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------
ARK73_HUMAN     YAAWEVAELCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNP------------------
ALKE_BABBO      WGTLRFYKLAKQAGVAAPASVQLHYNLLCREVEKGFVELCRPQGIAILAYAPLAYLEYMDP-TTSGRLLR
YEZB_SCHPO      ---PSVEEIKRAHSVVRIAAIEVHYSMLFREIEYGVKKLCHDLSIPLVAHSPLAH---------------
PLR2_SCHPO      ASAESIKRALAIVP---IAAVETEYSLFSRDIENGILDTCTQLSIPIIAYAPFCH---------------
ARA2_YEAST      Y---------------------------------------------------------------------
YI7E_SCHPO      MRCYQFIELQNTAGWHKFISMQNYHNLLYREEEREMIPYCQKTGVGLIPWSP------------------
AAD3_YEAST      TPAWVVSAANYYAGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQEERRKNGEGIR
AAD4_YEAST      TPAWVVSAANYYAGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQEERKKNGEGLR
AAD14_YEAST     TPAWVVSAANYYAGKTPFSVYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQEERKKNGEGLR
AAD10_YEAST     TPAWVVSAANYYAGKTPFSIYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQEERKKKGEGLR


                         .         .         .         +         .         .         .:280
query           AIAGAHGATPRQVALAFLTRRPSLFAIPKXXXXXXXXXXXXXXSLRLSDEEIAAIDQAFPLGPEPASLPM
YEAE_ECOLI      EIAHAHNISAAQVLLAWVISHQGVMAIPKAATIAHVQQNAAVLEVELSSAELAMLDKAYPAPKGKTALDM
AK1BA_HUMAN     EIAAKHKKTAAQVLIRFHIQR-NVIVIPKSVTPARIVENIQVFDFKLSDEEMATI---------------
GR_BACSU        QIAEKHNKSVAQVILRW-DLQHGVVTIPKSIKEHRIIENADIFDFELSQEDIDALNKDERVGPNPDEL--
Y2408_MYCS2     GIAEQHGKTPAQVLIRWHIQLGNI-VIPKSVNPERIASNFDVFDFELSGQDIASLETGKRLGPDP-----
AKCL2_PIG       TIAQKHGKSAAQILIRFQIQR-NVIVIPKSVNPKRILENFQVFDFELSEQDM------------------
GS69_BACSU      ----------------------------------------------------------------------
AK1A1_PIG       ALAEKYNRSPAQILLRWQVQR-KVICIPKSVTPSRIPQNIQVFDFTFSPEEMKQLD--------------
DKGB_SALTY      RIAAKHNATPAQVILAW-----------------------------------------------------
AKCL2_RAT       KIAKKHGKSPAQILIRFQIQR-NLIVIPKSVNPSRIRENIQVFDFELTEEELLSLDKNLRLATFPST---
AK1A1_BOVIN     ALAEKHGRSPAQILLRWQVQR-KVSCIPKSVTPSRILENIQVFDFTFSPEEMKQLD--------------
DKGB_SALTI      RIAVKHNATPVQVILAW-----------------------------------------------------
AKCL2_MOUSE     KIAKKHGKSPAQILIRFQIQR-NLIVIPKSVTPSRIRENIQVFDFELTEEELLSLDKNLRLATFPTT---
P100_LEIMA      AIGAKYNKTAAQVILRWNIQK-NLITIPKSVHRERIEENADIFDFELGAEDVMSIDALSRYGPDP-----
DKGB_ECOLI      RIAAKHNATPAQVILAW-----------------------------------------------------
DKGB_ECO57      RIAAKHNATPAQVILAW-----------------------------------------------------
Y1919_MYCSJ     -VAESHGKTAAQALIRWHMQLGNI-VIPKSVNPQRIESNFDVFDFELSEQDMASIEDASRLGPDP-----
DKGB_YERPE      TIAEQHGATPAQVILSW-----------------------------------------------------
AK1A1_PONAB     XXXXKYGGSPAQILLRWQVQR-KVICIPK-----------------------------------------
Y1985_MYCSK     -VAESHGKTAAQALIRWHMQLGNI-VIPKSVNPQRIESNFDVFDFELSEQDMASIEDGSRLGPDP-----
ALDR_RABIT      AIADKHKKTTAQVLIRFPMQR-NLVVIPKSVTPARIAENFQVFDFELSSEDMTTL---------------
ALDR_HUMAN      AIAAKHNKTTAQVLIRFPMQR-NLVVIPKSVTPERIAENFKVFDFELSSQDMTTL---------------
XYL1_PICGU      SVAEKANKTPAQVLLRWATQR-GLAVIPKSNNPDRLLSNLKVNDFDLSQEDFKEISK-------------
YCCK_BACSU      AVAEEKQADTAHVALAWLLTRPAIDAIPGAKRPEQLQDNLKTLNIELTEDEVNFISDIF-----------
XYL1_PICST      AIAAKHGKSPAQVLLRWSSQR-GIAIIPKSNTVPRLLENKDVNSFDLDEQDFADI---------------
ALD1_MOUSE      EIAAKHKKTVAQVLIRFHVQR-NVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAI---------------
AK1A1_RAT       XXXXKHGRSPAQILLRWQVQR-KVICIPKSITPSRILQNIQVFDFTFSPEEMKQLD--------------
AK1A1_MOUSE     XXXXKHGRSPAQILLRWQVQR-KVICIPKSINPSRILQNIQVFDFTFSPEEMKQLD--------------
XYL1_CANSH      AIAAKHNKVPAEVLLRWSAQR-GIAVIPK-----------------------------------------
AK1C1_MACFU     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAID--------------
AK1A1_HUMAN     ----------------------------------------------------------------------
ALDR_RAT        EIAAKYNKTTAQVLIRFPIQR-NLVVIPKSVTPARIAENFKVFDFELSNEDMATL---------------
ALDR_PIG        AIAAKYNKTTAQVLIRFPMQR-NLIVIPKSVTPERIAENFQVFDFELSPEDM------------------
AK1C2_HUMAN     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
AK1C1_HUMAN     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAID--------------
ALDX_SPOSA      RIAEKNGCTPAQVLIAW-----------------------------------------------------
PGFS2_BOVIN     AIAKKHKQTPALVALRYQVQR-GVVVLAKSFNKKRIKENMQVFDFELTPEDMKAID--------------
PGFS1_BOVIN     AIAKKHKQTPALVALRYQVQR-GVVVLAKSFNKKRIKENMQVFDFELTPEDMKAID--------------
AKCL2_MACFA     RIAKEHSKSPAQILIRFQTQR-NVIVIP------------------------------------------
AK1C1_MACFA     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRENMKVFEFQLTSEDMKAID--------------
AK1A1_CRIGR     ----------------------------------------------------------------------
DDBX_BOVIN      AIAKKHRQTPALVALRYQIQR-GVVVLAKSYNKKRIKENIQVFDFELTPEDMKAID--------------
ALDR_MOUSE      AIAAKYNKTTAQVLIRFPIQR-NLVVIPKSVTPVRIAENLKVFDFEVSSEDMATL---------------
ALDR_BOVIN      AIADKYNKTTAQVLIRFPIQR-NLIVIPK-----------------------------------------
ALD2_CRIGR      EIAAKHKKTSAQVLIRFHIQR-NVVVIPKSVTPARIHENFQVFDFQLSDQEMATI---------------
YAJO_ECOLI      RLTGVSGATRAQVALAWLLSKPGIAA--------------------------------------------
Y2320_MYCBO     AIAVDVDAKPAQVALAWLISLPGVVAIP------------------------------------------
Y2298_MYCTU     AIAVDVDAKPAQVALAWLISLPGVVAIP------------------------------------------
XYL2_CANTR      SIADKHGKSPAQVLLRWATQR-NIAVIPK-----------------------------------------
AK1C1_PONAB     ALAKKHKQTPALIALRYQLQR-GVVVLAKSYNEQRIRQNMQVFDFQLTSEDMKTID--------------
ALRA_DICDI      ----------------------------------------------------------------------
ALD2_MOUSE      EIAAKHEKTSAQVLIRFHIQR-NVVVIPKSVTPSRIQENIQVFDFQLSDEEMATI---------------
A1A1A_DANRE     GIAKSYNKTPAQVIIRWHIQR-GVVCIPKSVTPSRIKQNIEVFDFKLSDEDMRLIE--------------
YDJG_ECOLI      ----------------------------------------------------------------------
NADO1_ORYSJ     EIAGAKGKTLAQICLRWLYEQGDVLLV-KTYNEKRMKENLDIFNWELTDEERERISQL----PQLRGLPG
YTBE_BACSU      DIAQTYNKSVAQIILRW-DLQHGIITIPKSTKEHRIKENASVFDFELTQDDIDALNENLRVGPDP-----
XYL1_CANTR      LIADKHGKSPAQVLLRWATQR-NIAVIPK-----------------------------------------
ALDR_ENCCU      AIAKKYGCAPSQIILSYITAQ-GICVIPKSRSKEHLRENIDLK--ELSREDISAID--------------
I3ACR_SCHPO     ----------------------------------------------------------------------
YPR1_YEAST      DMAKKHGVEPAQLIISWSIQR-------------------------------------------------
DKGA_ECOLI      DLADKYGKTPAQIVIRW-HLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDEIAKLDQGKRLGPDP-----
ALRC_DICDI      SIAGKYKKSVANVIFKWLNQR-GIAAIPKSGNHSRIIENFNIFDFQLSNDDIEKIN--------------
GCY_YEAST       EIAKKNNVQPGHVVISWHVQR-------------------------------------------------
AKC1H_RAT       TMAKKYKRTPALIALRYQLER-------------------------------------------------
XYL1_ASPNG      SIAEKHGRTPAQVLLRWATQR-GIAVIPKSNNPQRLKQNLDVTGWNLEEEEIKAI---------------
PE2R_RABIT      ALAKKHQQTPALIALRYQLQR-GIVVLAKSFTEKRIKENIQVFEFQLPSEDMKVID--------------
DKGA_ECO57      DLADKYGKTPAQIVIRW-HLDSGLVVIPKSVTPSRIAENFDVWDFRLDKDEIAKLDQGKRLGPDP-----
AK1CD_MOUSE     DVAKKNKRSPALIALRYLIQR-------------------------------------------------
YBN4_SCHPO      DIANAEGITPANIAISWAVKR-------------------------------------------------
AKCL2_HUMAN     RIAKEHGKSPAQILIRFQIQR-NVIVIP------------------------------------------
AK1D1_MOUSE     SLGKKYNKTQAQIVLRFNIQR-GIVVIPKSFTPERIKENFQIFDFSLTEEEMKDID--------------
AK1CN_HORSE     AMAKKYKRTPALIALRYQLQR-GVVVLAKSYNEKRIKENVQAFGFQLTSEDMKVLD--------------
Y1669_ARATH     QIGENYSKTPTQIALNWLVAQGNVIPIPGAKNAEQAKEFAGAIGWSLTDNEVSEL---------------
DHB5_MOUSE      SMAKKYNRTPALIALRYQLQR-GVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLD--------------
XYL1_CANTE      AIAAKYNKTPAEVLLRWAAQR-GIAVIPK-----------------------------------------
AK1C4_HUMAN     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLD--------------
AK1C3_PONAB     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRENVQVFEFQLTAEDMRAID--------------
NADO2_ORYSJ     DIAQTKGKTLAQICLRWM----------------------------------------------------
DKGA_CORSC      XXXXXHGKTPAQAVLRWHLQK-GFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMDP----------
KAR_YEAST       ----------------------------------------------------------------------
AKC1H_MOUSE     AMAKKYKRTPALIALRYQLDR-GIVALAKSFNEERIRENMQVFDFQLASDDMKILD--------------
AK1C3_HUMAN     ALAKKHKRTPALIALRYQLQR-GVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAID--------------
S6PD_MALDO      DVAKKYGKSVAQICLRWGIQRKTA-VIPKSSKIQRLKENLEVLEFQLSDEDMQLI---------------
DKGA_YERPE      KLAQQYNKTPAQIVIRW-HLDSGLIVIPKSVTPARIRENFEVFDFKLQKEELLAIDCGKRLGPDP-----
Y4205_MYCGI     AIAEAHGRTPAQVLI-------------------------------------------------------
AK1D1_RABIT     SLGKKYKKTAAQIVLRFNVQR-GVVVIPKSFNPERIKENFQIFDFSLTEEEMKDIE--------------
AK1D1_HUMAN     SLGKRYNKTAAQIVLRFNIQR-GVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIE--------------
ALDR_HORVU      KVANKLNKTPGQVLIKWALQR-GTSVIPK-----------------------------------------
YER5_SCHPO      AIASKYNKSEAQIMIRYCLQR-GFIVLPK-----------------------------------------
XYL1_CANPA      SIADKHGKSPAQVLLRYQTQR-GIAVIPRSNSPDRMAQNLSVIDFELTQDDLQAI---------------
TAS_SHIFL       RIARRHGLDPAQMALAFVRRQP------------------------------------------------
TAS_ECOLI       RIARRHGLDPAQMALAFVRRQP------------------------------------------------
IOLS_BACSU      PIAEKHNVDIPHIVLAWYLARPEIILIPGAKRADQLIDNIKTADVTLSQEDISFIDKLF-----------
YQKF_BACSU      ----------------------------------------------------------------------
IN22_MAIZE      ----------------------------------------------------------------------
DIDH_RAT        AIAKKYKQTPALVALRYQLQR-------------------------------------------------
Y2407_MYCS2     AIAEAHGRTAAQVLL-------------------------------------------------------
6DCS_SOYBN      EIAEAHGKSIAQVSLRWLYEQGVTF-VPK-----------------------------------------
XYL1_PACTA      TIAAKHGKTPFQVLLRWVNQR-GIAIIPK-----------------------------------------
YAKC_SCHPO      KIATANNITPGQLSLAWLAQGDDILPIPGTKRVKYLEENFGALKVKLSDATVKEIREA------------
AK1CO_HORSE     AMAKKYKRTPALIALRYLLQR-------------------------------------------------
YDBC_ECOLI      DVAASLGATPMQVALAWLLQRPNILLIPGTSSVAHLRENMAAEKLHLSEEVLSTLD--------------
AK1CL_RAT       SMAKKYNQTPALIALRHQLQR-------------------------------------------------
Y1987_MYCUA     SIAGEYGKTPTQVLL-------------------------------------------------------
Y1744_MYCMM     SIAGEYGKTPTQVLL-------------------------------------------------------
XYL1_TRIRE      ALADKHRRTPAQVLLRWATQR-GIAVIPKTSRPEVMAQNLDNTSFDLDSEDLAKI---------------
AK1CL_MOUSE     SMAKKYNRTPALIALRYQLQR-------------------------------------------------
AK1A1_XENTR     AMAKKYGKSEAQILLRWQVQR-KVVSIPKSVTPTRILQNFQVFDFSLSEEEMQLI---------------
YKW2_SCHPO      ----------------------------------------------------------------------
Y3816_MYCA1     SVAAEYGKTASQVLL-------------------------------------------------------
Y3007_MYCPA     SVAAEYGKTASQVLL-------------------------------------------------------
GRE3_YEAST      KVSQNHGSTTSQVLLRWATQR-GIAVIPK-----------------------------------------
A1A1B_DANRE     ALAKKYNKTPAQIIIRWQTQR-GVVTIPKSITQSRIKENIQVFDFTLESEEMSQV---------------
XYL1_KLULA      SIASKHKVTPQQVLLRWATQN-GIAIIPK-----------------------------------------
DKGB_CORSS      XXAVVYGVTPTQVVLRWHVQLGST-PIPKSADPDRQRENADVFGFALTADQVDAI---------------
AK1C4_MACFA     ALAKKHKRSPALIALRYQLQR-GVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVLD--------------
Y1984_MYCSK     -VAQAHGKTPAQVLLRWSIQLGNV-VIARSANPDRITSNLEVFDFELTDDEMAGLDEGTRFRPDP-----
Y1938_MYCSS     -VAQAHGKTPAQVLLRWSIQLGNV-VIARSANPDRITSNLEVFDFELTDDEMAGLDEGTRFRPDP-----
MORA_PSEPU      TIAEAHGRSAAQVILRWHFQN-DVVAIPKSVNPERIAKNIDVFDFALSDAEMAQLDEGVRIGPDP-----
KCAB_SCHPO      KIAEQIGATPSQLALAWTLKNP------------------------------------------------
AK1A1_XENLA     AMAKKYNISEAQILLRWQVQR-RVVTIPKSVTPARILQNLQVFDFSLSEEEMQLI---------------
YDHF_ECOLI      ----------------------------------------------------------------------
Y2161_MYCVP     AIADAQDRTPAQVLI-------------------------------------------------------
DKGA_SALTY      ELADKYGKTPAQIVIRW-HLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDEIAKLDQGKRLGPDP-----
DKGA_SALTI      ELADKYGKTPAQIVIRW-HLDCGLVVIPKSVTPSRIAENFAVWDFRLDKDEIAKLDQGKRLGPDP-----
ALRB_DICDI      SIADKHNKTVANVIFKWLNQR-GIVTIPKSSNPARIIENFNIFDFQLSNEDMDKIN--------------
YCSN_BACSU      ALESVQGASLDEVMYAWLYTHPA-----------------------------------------------
AK1C4_MACFU     ALAKKHKRSPALIALRYQLQR-GVVVLAKSYNEQRIRENVQVFEFQLTSEDMKVLD--------------
CRO_RANCA       ----------------------------------------------------------------------
CRO_RANTE       ----------------------------------------------------------------------
YRPG_BACSU      ----------------------------------------------------------------------
Y1918_MYCSJ     -VAQAHDKTPAQVLLRWSIQLGNV-VIARSANPDRITSNLEVFDFELTDDEMAGLDEGTRFRPDP-----
DTDH_MUCMU      SVADKHNVSTGQVLLRWALDR-EFAVIPKSVNAGRMKANLEILDIKLDAEDNKTLD--------------
AK1A1_CHICK     KLAEKYKKSPAQILLRWQAQR-KVVTIPKSVTPARILQNLQVFDFSLTEEEMSHV---------------
AK1D1_RAT       SLGKKYNKTQAQIVLRFDIQR-GLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIE--------------
Y2999_MYCTA     SIASEYVKTPAQVLL-------------------------------------------------------
Y2971_MYCTU     SIASEYVKTPAQVLL-------------------------------------------------------
STCV_EMENI      ----------------------------------------------------------------------
Y2996_MYCBO     SIASEYVKTPAQVLL-------------------------------------------------------
Y2993_MYCBP     SIASEYVKTPAQVLL-------------------------------------------------------
YH5B_SCHPO      AVSKDLDRSTSQIALSWLQRSPVMLPIPGTSKVDHLEENVKAAGIQLSSEVFAKLDE-------------
YDG7_SCHPO      KIAKSEGVTGATIAVSWITRGTSV--IPK-----------------------------------------
Y4483_MYCA1     TIAAEYGRTPAQV---------------------------------------------------------
Y4149_MYCPA     TIAAEYGRTPAQV---------------------------------------------------------
Y1669_MYCLE     AIAAEYGKTPAQVLL-------------------------------------------------------
Y1669_MYCLB     AIAAEYGKTPAQVLL-------------------------------------------------------
NORA_ASPFL      QMAQQKNTKATSIAQAYVMHKPYVFPVIGGRKVEHLKENIEALGLVLSEEEIREIDDAEP----------
KCAB_ORYSJ      ----------------------------------------------------------------------
KCAB2_XENLA     ----------------------------------------------------------------------
KCAB2_HUMAN     AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
AK1CD_MESAU     GGAKXXXRSPALIALRYLVQR-------------------------------------------------
NORA_ASPPA      QMAQQKNTKATSIAQAYVMHKPYVFPVIGGRKVEHLKENIEALGLVLSEEEIREIDDAEP----------
KCAB2_RAT       AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
KCAB2_MOUSE     AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
KCAB2_BOVIN     AIAERLGCTLPQLAIAWCLRNEGVSSV-------------------------------------------
YGHZ_ECO57      EMAQQRGQSMAQMALSWLLKRVTSVLVGASRAEQLEENVQALNNLTFSTEELAQIDQ-------------
YJ66_YEAST      ----------------------------------------------------------------------
YOF5_CAEEL      KIASKYQKSPAQICLRWSIQQ-NVPTVPKSTDCRRLKENTNVFDFELSAEDMNTLN--------------
YGHZ_ECOLI      ----------------------------------------------------------------------
AKCL1_HUMAN     ----------------------------------------------------------------------
A115_TOBAC      ----------------------------------------------------------------------
YP088_YEAST     ----------------------------------------------------------------------
ARK72_RAT       ----------------------------------------------------------------------
AAD_PHACH       ----------------------------------------------------------------------
YHH5_SCHPO      ----------------------------------------------------------------------
ARK72_HUMAN     ----------------------------------------------------------------------
ARK72_MOUSE     ----------------------------------------------------------------------
ARK74_HUMAN     ----------------------------------------------------------------------
ARK73_RAT       ----------------------------------------------------------------------
ARK73_HUMAN     ----------------------------------------------------------------------
ALKE_BABBO      ----------------------------------------------------------------------
YEZB_SCHPO      ----------------------------------------------------------------------
PLR2_SCHPO      ----------------------------------------------------------------------
ARA2_YEAST      ----------------------------------------------------------------------
YI7E_SCHPO      ----------------------------------------------------------------------
AAD3_YEAST      SFVGASEQTDAEIKIS------------------------------------------------------
AAD4_YEAST      TVSGTSKQTDKEVKIS------------------------------------------------------
AAD14_YEAST     TFVGGPEQTELEVKIS------------------------------------------------------
AAD10_YEAST     TFFGTSEQTDMEVKIS------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           L
YEAE_ECOLI      V
AK1BA_HUMAN     -
GR_BACSU        -
Y2408_MYCS2     -
AKCL2_PIG       -
GS69_BACSU      -
AK1A1_PIG       -
DKGB_SALTY      -
AKCL2_RAT       -
AK1A1_BOVIN     -
DKGB_SALTI      -
AKCL2_MOUSE     -
P100_LEIMA      -
DKGB_ECOLI      -
DKGB_ECO57      -
Y1919_MYCSJ     -
DKGB_YERPE      -
AK1A1_PONAB     -
Y1985_MYCSK     -
ALDR_RABIT      -
ALDR_HUMAN      -
XYL1_PICGU      -
YCCK_BACSU      -
XYL1_PICST      -
ALD1_MOUSE      -
AK1A1_RAT       -
AK1A1_MOUSE     -
XYL1_CANSH      -
AK1C1_MACFU     -
AK1A1_HUMAN     -
ALDR_RAT        -
ALDR_PIG        -
AK1C2_HUMAN     -
AK1C1_HUMAN     -
ALDX_SPOSA      -
PGFS2_BOVIN     -
PGFS1_BOVIN     -
AKCL2_MACFA     -
AK1C1_MACFA     -
AK1A1_CRIGR     -
DDBX_BOVIN      -
ALDR_MOUSE      -
ALDR_BOVIN      -
ALD2_CRIGR      -
YAJO_ECOLI      -
Y2320_MYCBO     -
Y2298_MYCTU     -
XYL2_CANTR      -
AK1C1_PONAB     -
ALRA_DICDI      -
ALD2_MOUSE      -
A1A1A_DANRE     -
YDJG_ECOLI      -
NADO1_ORYSJ     L
YTBE_BACSU      -
XYL1_CANTR      -
ALDR_ENCCU      -
I3ACR_SCHPO     -
YPR1_YEAST      -
DKGA_ECOLI      -
ALRC_DICDI      -
GCY_YEAST       -
AKC1H_RAT       -
XYL1_ASPNG      -
PE2R_RABIT      -
DKGA_ECO57      -
AK1CD_MOUSE     -
YBN4_SCHPO      -
AKCL2_HUMAN     -
AK1D1_MOUSE     -
AK1CN_HORSE     -
Y1669_ARATH     -
DHB5_MOUSE      -
XYL1_CANTE      -
AK1C4_HUMAN     -
AK1C3_PONAB     -
NADO2_ORYSJ     -
DKGA_CORSC      -
KAR_YEAST       -
AKC1H_MOUSE     -
AK1C3_HUMAN     -
S6PD_MALDO      -
DKGA_YERPE      -
Y4205_MYCGI     -
AK1D1_RABIT     -
AK1D1_HUMAN     -
ALDR_HORVU      -
YER5_SCHPO      -
XYL1_CANPA      -
TAS_SHIFL       -
TAS_ECOLI       -
IOLS_BACSU      -
YQKF_BACSU      -
IN22_MAIZE      -
DIDH_RAT        -
Y2407_MYCS2     -
6DCS_SOYBN      -
XYL1_PACTA      -
YAKC_SCHPO      -
AK1CO_HORSE     -
YDBC_ECOLI      -
AK1CL_RAT       -
Y1987_MYCUA     -
Y1744_MYCMM     -
XYL1_TRIRE      -
AK1CL_MOUSE     -
AK1A1_XENTR     -
YKW2_SCHPO      -
Y3816_MYCA1     -
Y3007_MYCPA     -
GRE3_YEAST      -
A1A1B_DANRE     -
XYL1_KLULA      -
DKGB_CORSS      -
AK1C4_MACFA     -
Y1984_MYCSK     -
Y1938_MYCSS     -
MORA_PSEPU      -
KCAB_SCHPO      -
AK1A1_XENLA     -
YDHF_ECOLI      -
Y2161_MYCVP     -
DKGA_SALTY      -
DKGA_SALTI      -
ALRB_DICDI      -
YCSN_BACSU      -
AK1C4_MACFU     -
CRO_RANCA       -
CRO_RANTE       -
YRPG_BACSU      -
Y1918_MYCSJ     -
DTDH_MUCMU      -
AK1A1_CHICK     -
AK1D1_RAT       -
Y2999_MYCTA     -
Y2971_MYCTU     -
STCV_EMENI      -
Y2996_MYCBO     -
Y2993_MYCBP     -
YH5B_SCHPO      -
YDG7_SCHPO      -
Y4483_MYCA1     -
Y4149_MYCPA     -
Y1669_MYCLE     -
Y1669_MYCLB     -
NORA_ASPFL      -
KCAB_ORYSJ      -
KCAB2_XENLA     -
KCAB2_HUMAN     -
AK1CD_MESAU     -
NORA_ASPPA      -
KCAB2_RAT       -
KCAB2_MOUSE     -
KCAB2_BOVIN     -
YGHZ_ECO57      -
YJ66_YEAST      -
YOF5_CAEEL      -
YGHZ_ECOLI      -
AKCL1_HUMAN     -
A115_TOBAC      -
YP088_YEAST     -
ARK72_RAT       -
AAD_PHACH       -
YHH5_SCHPO      -
ARK72_HUMAN     -
ARK72_MOUSE     -
ARK74_HUMAN     -
ARK73_RAT       -
ARK73_HUMAN     -
ALKE_BABBO      -
YEZB_SCHPO      -
PLR2_SCHPO      -
ARA2_YEAST      -
YI7E_SCHPO      -
AAD3_YEAST      -
AAD4_YEAST      -
AAD14_YEAST     -
AAD10_YEAST     -